Histocompatibility (minor) 13

Overview
NameHistocompatibility (minor) 13
Smed IDSMED30013893
Length (bp)2493
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histocompatibility (minor) 13 (SMED30013893) t-SNE clustered cells

Violin plots show distribution of expression levels for Histocompatibility (minor) 13 (SMED30013893) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histocompatibility (minor) 13 (SMED30013893) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histocompatibility (minor) 13 (SMED30013893) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013893

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013893SMESG000016697.1 dd_Smed_v4_1203_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013893SMESG000016697.1 Contig38954newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013893SMESG000016697.1 Contig38954uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30013893SMESG000016697.1 dd_Smed_v6_1203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013893SMESG000016697.1 dd_Smed_v6_1203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30013893SMESG000016697.1 dd_Smed_v6_1203_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Match: HM13 (histocompatibility minor 13 [Source:HGNC Symbol;Acc:HGNC:16435])

HSP 1 Score: 286.574 bits (732), Expect = 1.831e-88
Identity = 132/202 (65.35%), Postives = 165/202 (81.68%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE+ NPK
Sbjct:  151 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPK 352          

HSP 2 Score: 130.183 bits (326), Expect = 4.787e-32
Identity = 72/147 (48.98%), Postives = 96/147 (65.31%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I
Sbjct:   10 NGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEII 154          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Match: HM13 (histocompatibility minor 13 [Source:HGNC Symbol;Acc:HGNC:16435])

HSP 1 Score: 286.574 bits (732), Expect = 5.721e-88
Identity = 132/202 (65.35%), Postives = 165/202 (81.68%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE+ NPK
Sbjct:  194 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPK 395          

HSP 2 Score: 109.383 bits (272), Expect = 1.200e-24
Identity = 72/190 (37.89%), Postives = 96/190 (50.53%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFK-------------------------------------------IFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFK                                           IFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I
Sbjct:   10 NGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKVYFPNKSYAGSVLKTWKTQKSKKGKTAVIQNPTTRDSHSFPSEIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEII 197          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Match: HM13 (histocompatibility minor 13 [Source:HGNC Symbol;Acc:HGNC:16435])

HSP 1 Score: 283.878 bits (725), Expect = 2.559e-87
Identity = 129/202 (63.86%), Postives = 164/202 (81.19%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE + ++
Sbjct:  151 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYESSAEI 352          

HSP 2 Score: 130.954 bits (328), Expect = 4.604e-32
Identity = 72/148 (48.65%), Postives = 96/148 (64.86%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I 
Sbjct:   10 NGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIIN 155          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Match: HM13 (histocompatibility minor 13 [Source:HGNC Symbol;Acc:HGNC:16435])

HSP 1 Score: 285.034 bits (728), Expect = 2.957e-87
Identity = 129/202 (63.86%), Postives = 164/202 (81.19%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE + ++
Sbjct:  151 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYESSAEI 352          

HSP 2 Score: 130.568 bits (327), Expect = 1.103e-31
Identity = 75/156 (48.08%), Postives = 100/156 (64.10%), Query Frame = 1
Query:   91 MD-VLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            MD  L+   N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I
Sbjct:    1 MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEII 154          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Match: HM13 (histocompatibility minor 13 [Source:HGNC Symbol;Acc:HGNC:16435])

HSP 1 Score: 276.944 bits (707), Expect = 2.411e-85
Identity = 127/195 (65.13%), Postives = 159/195 (81.54%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F 
Sbjct:  151 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFS 345          

HSP 2 Score: 130.568 bits (327), Expect = 2.102e-32
Identity = 72/148 (48.65%), Postives = 96/148 (64.86%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I 
Sbjct:   10 NGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIIN 155          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Match: imp-2 (Intramembrane protease 2 [Source:UniProtKB/Swiss-Prot;Acc:P49049])

HSP 1 Score: 200.29 bits (508), Expect = 5.192e-56
Identity = 101/215 (46.98%), Postives = 142/215 (66.05%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSG-FSSTNYAMLGLGDIVIPGIFVALLLRFDY------SQKKGKQT------YFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E L    + R + I L + + + + ++L +HWI NN+ G++FS+  +E +HL     G +LL GLF YDIFWVFGT+VM +VAK  +API L FP+D+  +G   ++ ++MLGLGDIVIPGIF+ALL RFDY      ++ K  Q       YF+   VAY+ GL  TM VMH FK AQPALLYLVP CL +P++L+VI G+ + L+ Y+++  V
Sbjct:  238 EYLFKIDFDRYDIIALLMCSPILISHLLKRHWITNNIIGVSFSILGIERLHLASFKAGSLLLVGLFFYDIFWVFGTDVMTSVAKGIDAPILLQFPQDIYRNGIMEASKHSMLGLGDIVIPGIFIALLRRFDYRVVQTTAESKAPQGSLKGRYYFVVTVVAYMAGLFITMAVMHHFKAAQPALLYLVPCCLFVPLLLAVIRGELSALWNYDESRHV 452          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 70.8626 bits (172), Expect = 2.447e-12
Identity = 63/225 (28.00%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  736 YPYKRKE-FIGLFISAAVGVWYMLTKH---WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGT--------NVMVTVA-----------KSFEAP------IKLVFPRDLVMSGFSSTN------------YAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGD 1287
            + YK  E FIG+   +    W+++ +    +I  ++  +A  +  ++ + L  +    IL+  +F+YD F VFGT        +VM+ VA           K +  P      +   FP  + ++ F+  N            + +LGLGDIV+PG  VA     +   ++ +  Y     V Y IGL+ T L + + K AQPAL+YLVP+ L   I+L++  G+
Sbjct:  366 HQYKYSEAFIGIICLSFCVTWFIIRRQPYAFILLDVINMALCMHVLKCLRLPSLKWISILMLCMFVYDAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGFQFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGE 590          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 70.8626 bits (172), Expect = 2.684e-12
Identity = 63/225 (28.00%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  736 YPYKRKE-FIGLFISAAVGVWYMLTKH---WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGT--------NVMVTVA-----------KSFEAP------IKLVFPRDLVMSGFSSTN------------YAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGD 1287
            + YK  E FIG+   +    W+++ +    +I  ++  +A  +  ++ + L  +    IL+  +F+YD F VFGT        +VM+ VA           K +  P      +   FP  + ++ F+  N            + +LGLGDIV+PG  VA     +   ++ +  Y     V Y IGL+ T L + + K AQPAL+YLVP+ L   I+L++  G+
Sbjct:  366 HQYKYSEAFIGIICLSFCVTWFIIRRQPYAFILLDVINMALCMHVLKCLRLPSLKWISILMLCMFVYDAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGFQFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGE 590          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 70.8626 bits (172), Expect = 2.684e-12
Identity = 63/225 (28.00%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  736 YPYKRKE-FIGLFISAAVGVWYMLTKH---WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGT--------NVMVTVA-----------KSFEAP------IKLVFPRDLVMSGFSSTN------------YAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGD 1287
            + YK  E FIG+   +    W+++ +    +I  ++  +A  +  ++ + L  +    IL+  +F+YD F VFGT        +VM+ VA           K +  P      +   FP  + ++ F+  N            + +LGLGDIV+PG  VA     +   ++ +  Y     V Y IGL+ T L + + K AQPAL+YLVP+ L   I+L++  G+
Sbjct:  366 HQYKYSEAFIGIICLSFCVTWFIIRRQPYAFILLDVINMALCMHVLKCLRLPSLKWISILMLCMFVYDAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGFQFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGE 590          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Match: imp-1 (IntraMembrane Protease (IMPAS) family [Source:UniProtKB/TrEMBL;Acc:Q93346])

HSP 1 Score: 70.4774 bits (171), Expect = 2.884e-12
Identity = 63/225 (28.00%), Postives = 106/225 (47.11%), Query Frame = 1
Query:  736 YPYKRKE-FIGLFISAAVGVWYMLTKH---WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGT--------NVMVTVA-----------KSFEAP------IKLVFPRDLVMSGFSSTN------------YAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGD 1287
            + YK  E FIG+   +    W+++ +    +I  ++  +A  +  ++ + L  +    IL+  +F+YD F VFGT        +VM+ VA           K +  P      +   FP  + ++ F+  N            + +LGLGDIV+PG  VA     +   ++ +  Y     V Y IGL+ T L + + K AQPAL+YLVP+ L   I+L++  G+
Sbjct:  366 HQYKYSEAFIGIICLSFCVTWFIIRRQPYAFILLDVINMALCMHVLKCLRLPSLKWISILMLCMFVYDAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVPPIEQESVPEKFPMLMQVAHFNPMNECLDMEIELGFQFTILGLGDIVMPGYLVAHCFTMNGFSERVRLIYGFISVVGYGIGLIVTFLALALMKTAQPALIYLVPSTLFPIIMLALCRGE 590          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Match: Spp (gene:FBgn0031260 transcript:FBtr0078080)

HSP 1 Score: 280.796 bits (717), Expect = 1.582e-86
Identity = 128/199 (64.32%), Postives = 166/199 (83.42%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            E +++Y +   + + L IS+A+GVWY+L KHWIANNLFGLAF+++ VE++HLN  VTG ILL GLF YDIFWVFGTNVMVTVAKSFEAPIKLVFP+DL+ +G +++N+AMLGLGDIVIPGIF+ALLLRFD S+K+  + YF +  +AY +GL+ T+ VMHVFKHAQPALLYLVPAC+G P+++++I G+   LF YED+
Sbjct:  160 EDIVNYKFSTHDIVCLVISSAIGVWYLLKKHWIANNLFGLAFAINGVEMLHLNNFVTGVILLSGLFFYDIFWVFGTNVMVTVAKSFEAPIKLVFPQDLIENGLNASNFAMLGLGDIVIPGIFIALLLRFDDSKKRKTRIYFYSTLIAYFLGLLATIFVMHVFKHAQPALLYLVPACMGTPLLVALIRGELKVLFAYEDH 358          

HSP 2 Score: 114.39 bits (285), Expect = 6.631e-27
Identity = 63/136 (46.32%), Postives = 86/136 (63.24%), Query Frame = 1
Query:  127 NENITKNGTTSGVQDP---QGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKK 525
            N N  KN +  G + P   +G+ +AY SL +MA++PI  G+ +SV +L   KKS     +T+T  DA  FPL ASA LFGLYLFFKIF K +IN LL+ YFFVLGV+AL++ L+P+I   +P   P   + +   K
Sbjct:   19 NVNAPKNESAPGEKKPSTPEGMAVAYSSLVVMAMLPIIFGSIRSV-KLHKLKKSTGEKADTMTKKDAMYFPLIASAALFGLYLFFKIFQKVHINYLLTGYFFVLGVIALAHLLSPVINSLMPAAVPKVPFHILFTK 153          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Match: SppL (gene:FBgn0039381 transcript:FBtr0300819)

HSP 1 Score: 104.76 bits (260), Expect = 1.557e-23
Identity = 71/229 (31.00%), Postives = 114/229 (49.78%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI-----------------KLVFPRDLVMSGFSST-NYAMLGLGDIVIPGIFVALLLRFD-YSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            +   E     +S ++   ++LT HW+  +  G+   V+ +  + L  +    +LL GL IYD+FWV      F TNVMV VA +  + P+                 KL  P  LV     +T +++MLGLGD+V+PG+ +  +LR+D Y + +G               + TYF    + Y +GL+T  +   VFK AQPALLYLVP  L   ++++ + GD  +++ 
Sbjct:  180 FTAAELFSFTLSVSIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFPSLHNTGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWS 408          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Match: SppL (gene:FBgn0039381 transcript:FBtr0300820)

HSP 1 Score: 104.76 bits (260), Expect = 1.557e-23
Identity = 71/229 (31.00%), Postives = 114/229 (49.78%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI-----------------KLVFPRDLVMSGFSST-NYAMLGLGDIVIPGIFVALLLRFD-YSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            +   E     +S ++   ++LT HW+  +  G+   V+ +  + L  +    +LL GL IYD+FWV      F TNVMV VA +  + P+                 KL  P  LV     +T +++MLGLGD+V+PG+ +  +LR+D Y + +G               + TYF    + Y +GL+T  +   VFK AQPALLYLVP  L   ++++ + GD  +++ 
Sbjct:  180 FTAAELFSFTLSVSIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFPSLHNTGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWS 408          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Match: SppL (gene:FBgn0039381 transcript:FBtr0084910)

HSP 1 Score: 104.76 bits (260), Expect = 1.655e-23
Identity = 71/229 (31.00%), Postives = 114/229 (49.78%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI-----------------KLVFPRDLVMSGFSST-NYAMLGLGDIVIPGIFVALLLRFD-YSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            +   E     +S ++   ++LT HW+  +  G+   V+ +  + L  +    +LL GL IYD+FWV      F TNVMV VA +  + P+                 KL  P  LV     +T +++MLGLGD+V+PG+ +  +LR+D Y + +G               + TYF    + Y +GL+T  +   VFK AQPALLYLVP  L   ++++ + GD  +++ 
Sbjct:  175 FTAAELFSFTLSVSIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFPSLHNTGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWS 403          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Match: SppL (gene:FBgn0039381 transcript:FBtr0344118)

HSP 1 Score: 104.76 bits (260), Expect = 1.655e-23
Identity = 71/229 (31.00%), Postives = 114/229 (49.78%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI-----------------KLVFPRDLVMSGFSST-NYAMLGLGDIVIPGIFVALLLRFD-YSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            +   E     +S ++   ++LT HW+  +  G+   V+ +  + L  +    +LL GL IYD+FWV      F TNVMV VA +  + P+                 KL  P  LV     +T +++MLGLGD+V+PG+ +  +LR+D Y + +G               + TYF    + Y +GL+T  +   VFK AQPALLYLVP  L   ++++ + GD  +++ 
Sbjct:  175 FTAAELFSFTLSVSIVCIWVLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFPSLHNTGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWS 403          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Zebrafish
Match: hm13 (histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB-GENE-020802-3])

HSP 1 Score: 288.115 bits (736), Expect = 2.301e-89
Identity = 131/199 (65.83%), Postives = 166/199 (83.42%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            E +++Y +  K+ I L IS+ VGVWY+L KHWIANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  ++N+AMLGLGDIVIPGIF+ALLLRFD S KK  +TYF   ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P++++++ G+  ++F+YE+ 
Sbjct:  154 EEIVNYEFDTKDLICLCISSVVGVWYVLKKHWIANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLGASNFAMLGLGDIVIPGIFIALLLRFDVSLKKNTRTYFYTSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVLVALVKGELTEMFRYEEE 352          

HSP 2 Score: 119.398 bits (298), Expect = 1.325e-28
Identity = 66/146 (45.21%), Postives = 94/146 (64.38%), Query Frame = 1
Query:  121 TANENITKNGTTSG-VQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            ++N +   NGT    V   +G  +AY SL +MA++PI+ GA +SV   K +  S  +  ET+T+ DAA FP+ AS  LFGLYLFFK+FS+EY+NMLLS YFFVLG+LALS+T++P + +  P    N  Y+L   + S     E++
Sbjct:   14 SSNGSDLVNGTAGRFVSSAEGTALAYGSLLLMALLPIFFGALRSVGCSKSKGSS--DMPETITSRDAARFPIIASCTLFGLYLFFKVFSQEYVNMLLSMYFFVLGILALSHTMSPFMCRVFPANLSNKQYQLLFTQGSGESKEEIV 157          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Zebrafish
Match: sppl3 (signal peptide peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-050913-71])

HSP 1 Score: 103.219 bits (256), Expect = 2.759e-23
Identity = 63/224 (28.12%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+                + +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  107 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPGMGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQATGEVPGPANMSGRMQRVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 330          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Zebrafish
Match: sppl3 (signal peptide peptidase 3 [Source:ZFIN;Acc:ZDB-GENE-050913-71])

HSP 1 Score: 103.605 bits (257), Expect = 3.845e-23
Identity = 63/224 (28.12%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+                + +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  144 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPGMGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQATGEVPGPANMSGRMQRVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 367          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Zebrafish
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 85.8853 bits (211), Expect = 7.788e-17
Identity = 67/201 (33.33%), Postives = 101/201 (50.25%), Query Frame = 1
Query:  730 LDYPYKRKEFIGLFISA-AVGV---WYMLTKH----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAKS-------FEAPIKLVFPR----DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACL 1251
            L Y +KR +   L +SA  +GV   W +        WI  +  G+AF +  ++ + L       +LL  LF+YD+F+VF        G ++MV VA          + P+ L  PR     LV+       +++LG GDI++PG+ VA   RFD   +   Q YF+A  + Y IGL+ T + + + +  QPALLYLVP  L
Sbjct:  279 LPYCHKRPQVRMLILSAFCIGVSVTWGVFRNEDQWAWILQDALGIAFCLYMLKTIRLPTFKACTLLLVVLFVYDVFFVFITPLLTKSGESIMVEVAAGPSDSSTHEKLPMVLKVPRLNSSPLVLC---DRPFSLLGFGDILVPGLLVAYCHRFDILMQTS-QIYFLACTIGYGIGLLITFVALTLMQMGQPALLYLVPCTL 475          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Match: sppl3 (signal peptide peptidase like 3 [Source:NCBI gene;Acc:394539])

HSP 1 Score: 104.375 bits (259), Expect = 2.714e-23
Identity = 64/223 (28.70%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG--------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+               K +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  143 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQATSDSCSSQGAGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 365          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Match: sppl3 (signal peptide peptidase like 3 [Source:NCBI gene;Acc:394539])

HSP 1 Score: 104.375 bits (259), Expect = 3.335e-23
Identity = 64/223 (28.70%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG--------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+               K +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  173 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQATSDSCSSQGAGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 395          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Match: sppl3 (signal peptide peptidase like 3 [Source:NCBI gene;Acc:394539])

HSP 1 Score: 104.375 bits (259), Expect = 3.524e-23
Identity = 64/223 (28.70%), Postives = 111/223 (49.78%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG--------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+               K +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  173 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQATSDSCSSQGAGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 395          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Match: bpi.4 (bactericidal permeability increasing protein, gene 4 [Source:Xenbase;Acc:XB-GENE-493665])

HSP 1 Score: 88.1965 bits (217), Expect = 1.937e-17
Identity = 64/198 (32.32%), Postives = 103/198 (52.02%), Query Frame = 1
Query:  730 LDYPYKRKEFIGLFISA---AVGVWYMLTKH-----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAK-------SFEAPIKLVFPR-DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACL 1251
            L Y +KR  F  L ++A    V V + + ++     W+  ++ G+AF +  ++ + +       +LL  LFIYD+F+VF        G ++MV VA          + P+ L  PR +          +++LG GDI++PG+ VA   RFD  Q +  + YF+A  +AY IGL+ T + + + +  QPALLYLVP  L
Sbjct:  280 LPYFHKRPPFWKLLLAAFCIVVSVIWGVYRNEDQWAWVLQDILGIAFCLYMLKTIRMPTFKGCTLLLFVLFIYDVFFVFITPYLTKRGESIMVEVASGPSNSTTQEKLPMVLKVPRLNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDI-QVQSSRIYFVACTIAYGIGLLVTFVALALMQKGQPALLYLVPCTL 476          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Match: bpi.4 (bactericidal permeability increasing protein, gene 4 [Source:Xenbase;Acc:XB-GENE-493665])

HSP 1 Score: 88.1965 bits (217), Expect = 1.969e-17
Identity = 64/198 (32.32%), Postives = 103/198 (52.02%), Query Frame = 1
Query:  730 LDYPYKRKEFIGLFISA---AVGVWYMLTKH-----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAK-------SFEAPIKLVFPR-DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACL 1251
            L Y +KR  F  L ++A    V V + + ++     W+  ++ G+AF +  ++ + +       +LL  LFIYD+F+VF        G ++MV VA          + P+ L  PR +          +++LG GDI++PG+ VA   RFD  Q +  + YF+A  +AY IGL+ T + + + +  QPALLYLVP  L
Sbjct:  281 LPYFHKRPPFWKLLLAAFCIVVSVIWGVYRNEDQWAWVLQDILGIAFCLYMLKTIRMPTFKGCTLLLFVLFIYDVFFVFITPYLTKRGESIMVEVASGPSNSTTQEKLPMVLKVPRLNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDI-QVQSSRIYFVACTIAYGIGLLVTFVALALMQKGQPALLYLVPCTL 477          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Match: H13 (histocompatibility 13 [Source:MGI Symbol;Acc:MGI:95886])

HSP 1 Score: 288.886 bits (738), Expect = 1.463e-89
Identity = 135/202 (66.83%), Postives = 166/202 (82.18%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+ A++F YE+ NPK
Sbjct:  151 EEIINYEFDTKDLVCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVAEMFSYEESNPK 352          

HSP 2 Score: 134.806 bits (338), Expect = 1.004e-33
Identity = 74/148 (50.00%), Postives = 97/148 (65.54%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            N +A      NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K S D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I 
Sbjct:   10 NGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKSSSDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIIN 155          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Match: H13 (histocompatibility 13 [Source:MGI Symbol;Acc:MGI:95886])

HSP 1 Score: 285.804 bits (730), Expect = 3.692e-88
Identity = 132/199 (66.33%), Postives = 163/199 (81.91%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+ A++F YE +
Sbjct:  151 EEIINYEFDTKDLVCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVAEMFSYESS 349          

HSP 2 Score: 135.576 bits (340), Expect = 7.635e-34
Identity = 74/148 (50.00%), Postives = 97/148 (65.54%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            N +A      NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K S D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I 
Sbjct:   10 NGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKSSSDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIIN 155          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Match: H13 (histocompatibility 13 [Source:MGI Symbol;Acc:MGI:95886])

HSP 1 Score: 186.808 bits (473), Expect = 3.432e-52
Identity = 96/199 (48.24%), Postives = 124/199 (62.31%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            E +++Y +  K+ + L +S+ VGVWY+L K                                          VFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+ A++F YE +
Sbjct:  151 EEIINYEFDTKDLVCLGLSSVVGVWYLLRK------------------------------------------VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVAEMFSYESS 307          

HSP 2 Score: 135.576 bits (340), Expect = 2.748e-34
Identity = 74/147 (50.34%), Postives = 97/147 (65.99%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            N +A      NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K S D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I
Sbjct:   10 NGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKSSSDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEII 154          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Match: H13 (histocompatibility 13 [Source:MGI Symbol;Acc:MGI:95886])

HSP 1 Score: 134.42 bits (337), Expect = 3.511e-35
Identity = 71/133 (53.38%), Postives = 92/133 (69.17%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKL 513
            N +A      NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K S D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L
Sbjct:   10 NGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKSSSDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQL 140          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Match: Sppl3 (signal peptide peptidase 3 [Source:MGI Symbol;Acc:MGI:1891433])

HSP 1 Score: 103.605 bits (257), Expect = 3.887e-23
Identity = 64/231 (27.71%), Postives = 112/231 (48.48%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG------------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            +   E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+                   K +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  139 FTAAELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 369          
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Match: sp|Q9D8V0|HM13_MOUSE (Minor histocompatibility antigen H13 OS=Mus musculus OX=10090 GN=Hm13 PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.024e-88
Identity = 135/202 (66.83%), Postives = 166/202 (82.18%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+ A++F YE+ NPK
Sbjct:  151 EEIINYEFDTKDLVCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVAEMFSYEESNPK 352          

HSP 2 Score: 134.806 bits (338), Expect = 7.025e-33
Identity = 74/148 (50.00%), Postives = 97/148 (65.54%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            N +A      NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K S D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I 
Sbjct:   10 NGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKSSSDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIIN 155          
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Match: sp|Q8TCT9|HM13_HUMAN (Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13 PE=1 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 8.792e-88
Identity = 132/202 (65.35%), Postives = 165/202 (81.68%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            E +++Y +  K+ + L +S+ VGVWY+L KHWIANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGD+VIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE+ NPK
Sbjct:  151 EEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDVVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPK 352          

HSP 2 Score: 130.183 bits (326), Expect = 2.299e-31
Identity = 72/147 (48.98%), Postives = 96/147 (65.31%), Query Frame = 1
Query:  115 NLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            N +A      N TT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S     E+I
Sbjct:   10 NGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEII 154          
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Match: sp|P49049|IMP2_CAEEL (Intramembrane protease 2 OS=Caenorhabditis elegans OX=6239 GN=imp-2 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.604e-55
Identity = 101/215 (46.98%), Postives = 142/215 (66.05%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSG-FSSTNYAMLGLGDIVIPGIFVALLLRFDY------SQKKGKQT------YFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E L    + R + I L + + + + ++L +HWI NN+ G++FS+  +E +HL     G +LL GLF YDIFWVFGT+VM +VAK  +API L FP+D+  +G   ++ ++MLGLGDIVIPGIF+ALL RFDY      ++ K  Q       YF+   VAY+ GL  TM VMH FK AQPALLYLVP CL +P++L+VI G+ + L+ Y+++  V
Sbjct:  238 EYLFKIDFDRYDIIALLMCSPILISHLLKRHWITNNIIGVSFSILGIERLHLASFKAGSLLLVGLFFYDIFWVFGTDVMTSVAKGIDAPILLQFPQDIYRNGIMEASKHSMLGLGDIVIPGIFIALLRRFDYRVVQTTAESKAPQGSLKGRYYFVVTVVAYMAGLFITMAVMHHFKAAQPALLYLVPCCLFVPLLLAVIRGELSALWNYDESRHV 452          
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Match: sp|O81062|SIP_ARATH (Signal peptide peptidase OS=Arabidopsis thaliana OX=3702 GN=SPP PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.769e-49
Identity = 90/175 (51.43%), Postives = 123/175 (70.29%), Query Frame = 1
Query:  793 WYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            WY   KHW+ANN+ GL+F +  +E++ L    TG ILL GLF YDIFWVF T VMV+VAKSF+APIKL+FP     +G +   Y+MLGLGDIVIPGIFVAL LRFD S+++  Q YF + ++ Y +G++ T++VM+ F+ AQPALLY+VPA +G      +  GD   L  ++++
Sbjct:  154 WYAWKKHWLANNILGLSFCIQGIEMLSLGSFKTGAILLAGLFFYDIFWVFFTPVMVSVAKSFDAPIKLLFP-----TGDALRPYSMLGLGDIVIPGIFVALALRFDVSRRRQPQ-YFTSAFIGYAVGVILTIVVMNWFQAAQPALLYIVPAVIGFLASHCIWNGDIKPLLAFDES 322          

HSP 2 Score: 54.299 bits (129), Expect = 2.312e-6
Identity = 39/96 (40.62%), Postives = 59/96 (61.46%), Query Frame = 1
Query:  199 SLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPD 486
            ++ + A + +Y+G  +SV   KD   +     ET++   A  FPL  SA L  L+L FK  SK+ +N +L+ YFFVLG++ALS TL P I ++LP+
Sbjct:   29 NVILTACITVYVGCFRSV---KDTPPT-----ETMSKEHAMRFPLVGSAMLLSLFLLFKFLSKDLVNAVLTAYFFVLGIVALSATLLPAIRRFLPN 116          
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Match: sp|B9FJ61|SIP2_ORYSJ (Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=SPP2 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.813e-47
Identity = 88/176 (50.00%), Postives = 122/176 (69.32%), Query Frame = 1
Query:  790 VWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDN 1317
            +WY   KHW+ANN+ G++F +  +E++ L    TG ILL GLF YDIFWVF T VMV+VAKSF+APIKL+FP     +G ++  ++MLGLGDIVIPGIFVAL LRFD S+   K  YF + ++ Y +GL  T++VM+ F+ AQPALLY+VP  +G   +  +  G+   L +Y ++
Sbjct:  153 IWYAAKKHWLANNVLGISFCIQGIEMLSLGSFKTGAILLSGLFFYDIFWVFFTPVMVSVAKSFDAPIKLLFP-----TGDAARPFSMLGLGDIVIPGIFVALALRFDVSRGI-KNRYFNSAFLGYTVGLTVTIIVMNWFQAAQPALLYIVPGVIGFVAVHCLWNGEVKPLLEYNES 322          
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Match: A0A4D5RA57 (Minor histocompatibility antigen H13-like OS=Scolopendra viridis OX=118503 PE=4 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 2.283e-134
Identity = 212/412 (51.46%), Postives = 277/412 (67.23%), Query Frame = 1
Query:   94 DVLNATINLTANENIT---KNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNP 1320
            D++N T+    NEN+T   KNGT+  V  P+G+ +AY SL +MA++PI+ G+ +SV   K++K+SG+   +T+T  DAAMFP+ AS  LF LYLFF+IFSKEYIN+LL+ YFFVLGVLALS+ L+PLI   +P+  PN  Y L   K +            ++T+                                                 L++Y +  K+ + LFI + +GVWY+  KHWIANNLFGLAF++S VEL+HLN ++TGCILLGGLF YDIFWVFGT+VMVTVAKSFEAPIKLVFP+DL+  GF + N+AMLGLGDIVIPGIF+ALLLR+D S ++   TYF  G+VAYI+GLM T+ VMHVFKHAQPALLYLVPAC+G P+ +++I GD   +F+YED+P
Sbjct:    3 DIVNETL-AQVNENLTENSKNGTSKPVSTPEGMAVAYGSLLVMAVLPIFFGSFRSVKHHKEKKESGEKP-DTMTQKDAAMFPVIASVALFSLYLFFQIFSKEYINLLLTGYFFVLGVLALSHLLSPLITNLVPEGLPNAYYHLIFTKNNDEKKGNDDTEDKKETID------------------------------------------------LINYSFDHKDLVCLFICSVIGVWYLWKKHWIANNLFGLAFAISGVELLHLNNIITGCILLGGLFFYDIFWVFGTDVMVTVAKSFEAPIKLVFPQDLLEKGFEANNFAMLGLGDIVIPGIFIALLLRYDNSLQRKYNTYFNTGFVAYILGLMGTIFVMHVFKHAQPALLYLVPACIGAPVFIALIKGDVKTMFQYEDHP 364          
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Match: A0A2Y9PTC5 (minor histocompatibility antigen H13 isoform X4 OS=Delphinapterus leucas OX=9749 GN=HM13 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 5.374e-124
Identity = 206/394 (52.28%), Postives = 266/394 (67.51%), Query Frame = 1
Query:  145 NGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED-NPK 1323
            NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S        E+  E T   S+                        + G   +    +     L   +++Y +  K+ + L +S+ VGVWY+L KHW+ANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE+ NPK
Sbjct:   20 NGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSG-------ENKEEPTAMPSSVQG---------------------LTGGRGSPAPGSGLTRPLCPEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWVANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYEESNPK 383          
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Match: A0A2Y9PZ77 (minor histocompatibility antigen H13 isoform X1 OS=Delphinapterus leucas OX=9749 GN=HM13 PE=4 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 1.478e-122
Identity = 203/394 (51.52%), Postives = 265/394 (67.26%), Query Frame = 1
Query:  145 NGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S        E+  E T   S+                        + G   +    +     L   +++Y +  K+ + L +S+ VGVWY+L KHW+ANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F YE + ++
Sbjct:   20 NGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSG-------ENKEEPTAMPSSVQG---------------------LTGGRGSPAPGSGLTRPLCPEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWVANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFSYESSAEI 383          
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Match: A0A2Y9PSA8 (minor histocompatibility antigen H13 isoform X3 OS=Delphinapterus leucas OX=9749 GN=HM13 PE=4 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 2.141e-120
Identity = 201/387 (51.94%), Postives = 260/387 (67.18%), Query Frame = 1
Query:  145 NGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            NGTT     P+G+ +AY SL +MA++PI+ GA +SV R    K + D   ET+T+ DAA FP+ AS  L GLYLFFKIFS+EYIN+LLS YFFVLG+LALS+T++P + K+ P  FPN  Y+L   + S        E+  E T   S+                        + G   +    +     L   +++Y +  K+ + L +S+ VGVWY+L KHW+ANNLFGLAFS++ VEL+HLN V TGCILLGGLFIYD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK   TYF   + AYI GL  T+ +MH+FKHAQPALLYLVPAC+G P+++++  G+  ++F 
Sbjct:   20 NGTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSV-RCARGKNASDMP-ETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSG-------ENKEEPTAMPSSVQG---------------------LTGGRGSPAPGSGLTRPLCPEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWVANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDISLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEVTEMFS 376          
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Match: A0A2M4A077 (Putative signal peptide peptidase OS=Anopheles triannulatus OX=58253 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 1.428e-119
Identity = 201/409 (49.14%), Postives = 263/409 (64.30%), Query Frame = 1
Query:  115 NLTANE--NITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQK----KSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPK 1323
            NLTA E    T N T      P+G+ +AY +L +MA++PI+ G+ +SV   K+QK    K+G+   +T++++DA MFP+ AS  LFGLY+FFKIFSKE IN LL+ YFF LGV+ALS+ L+P+I   +P   P   Y L    F   PP    + S EK                                                   L+DY +   + +   ++  + VWY+L KHWIANNL G+AF+V+ VEL+HLN V TGCILL GLF+YDIFWVFGTNVMVTVA+SFEAPIKLVFP+DL+ +G S++N+A+LGLGDIVIPGIF+ALLLRFD S K+   TYF A Y+AY +GL+ T+ VMHVFKHAQPALLYLVPACLG P++L+++ GD  +L  YED+P+
Sbjct:   15 NLTATEADGATTNATGKIPSTPEGMALAYGTLVVMAMLPIFFGSVRSVKHHKEQKTAFQKTGEKP-DTMSSHDAMMFPIMASCALFGLYMFFKIFSKENINFLLTGYFFFLGVMALSHLLSPVISSLIPASIPKIPYHLS---FVQGPPEGGEKKSKEK-------------------------------------------------RFLIDYRFTTHDIVCFIVALVISVWYLLQKHWIANNLLGIAFAVNGVELLHLNNVATGCILLCGLFVYDIFWVFGTNVMVTVARSFEAPIKLVFPQDLITNGLSASNFAVLGLGDIVIPGIFIALLLRFDNSLKRKSNTYFYATYIAYFVGLLATIFVMHVFKHAQPALLYLVPACLGTPLLLALLKGDIKKLLAYEDHPE 370          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:103034734])

HSP 1 Score: 286.96 bits (733), Expect = 1.552e-87
Identity = 130/202 (64.36%), Postives = 167/202 (82.67%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E +++Y +  K+ I L IS+ VGVWY+L KHW+ANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G +++N+AMLGLGDIVIPGIF+ALLLRFD S K   +TYF   ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P++++++ G+  ++F YE + +V
Sbjct:  244 EEIVNYEFDTKDLICLAISSVVGVWYVLKKHWVANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLERGLNASNFAMLGLGDIVIPGIFIALLLRFDVSLKNNSRTYFYTSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVVVALLKGELTEMFSYESSEEV 445          

HSP 2 Score: 125.176 bits (313), Expect = 8.065e-30
Identity = 70/145 (48.28%), Postives = 94/145 (64.83%), Query Frame = 1
Query:  124 ANENITKNGTTSG-VQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            AN     N T +  V   +G  +AY SL +MA++PI+ GA +SVS  K   K+  +  ET+T+ DAA FP+ AS  LFGLYLFFKIFS+EYINMLLS YFFVLG+LALS+T++P + +  P   PN  Y+L   + S     E++
Sbjct:  105 ANGTDALNATAAKFVATAEGTALAYGSLVLMALLPIFFGALRSVSSSK--SKNASDMPETITSRDAARFPIIASCTLFGLYLFFKIFSQEYINMLLSMYFFVLGILALSHTMSPFMNRVFPANLPNKQYQLLFTQGSGENKEEIV 247          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:103034734])

HSP 1 Score: 286.574 bits (732), Expect = 1.556e-87
Identity = 129/198 (65.15%), Postives = 166/198 (83.84%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYED 1314
            E +++Y +  K+ I L IS+ VGVWY+L KHW+ANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G +++N+AMLGLGDIVIPGIF+ALLLRFD S K   +TYF   ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P++++++ G+  ++F+YE+
Sbjct:  252 EEIVNYEFDTKDLICLAISSVVGVWYVLKKHWVANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLERGLNASNFAMLGLGDIVIPGIFIALLLRFDVSLKNNSRTYFYTSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVVVALLKGELTEMFRYEE 449          

HSP 2 Score: 114.39 bits (285), Expect = 2.398e-26
Identity = 68/151 (45.03%), Postives = 95/151 (62.91%), Query Frame = 1
Query:  124 ANENITKNGTTSG-VQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRL------KDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            AN     N T +  V   +G  +AY SL +MA++PI+ GA +SVS        ++  ++  +  ET+T+ DAA FP+ AS  LFGLYLFFKIFS+EYINMLLS YFFVLG+LALS+T++P + +  P   PN  Y+L   + S     E++
Sbjct:  105 ANGTDALNATAAKFVATAEGTALAYGSLVLMALLPIFFGALRSVSSSKSKVGAENGYENASDMPETITSRDAARFPIIASCTLFGLYLFFKIFSQEYINMLLSMYFFVLGILALSHTMSPFMNRVFPANLPNKQYQLLFTQGSGENKEEIV 255          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:103034734])

HSP 1 Score: 286.189 bits (731), Expect = 3.590e-87
Identity = 130/202 (64.36%), Postives = 167/202 (82.67%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            E +++Y +  K+ I L IS+ VGVWY+L KHW+ANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G +++N+AMLGLGDIVIPGIF+ALLLRFD S K   +TYF   ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P++++++ G+  ++F YE + +V
Sbjct:  252 EEIVNYEFDTKDLICLAISSVVGVWYVLKKHWVANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLERGLNASNFAMLGLGDIVIPGIFIALLLRFDVSLKNNSRTYFYTSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVVVALLKGELTEMFSYESSEEV 453          

HSP 2 Score: 114.39 bits (285), Expect = 2.955e-26
Identity = 68/151 (45.03%), Postives = 95/151 (62.91%), Query Frame = 1
Query:  124 ANENITKNGTTSG-VQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRL------KDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            AN     N T +  V   +G  +AY SL +MA++PI+ GA +SVS        ++  ++  +  ET+T+ DAA FP+ AS  LFGLYLFFKIFS+EYINMLLS YFFVLG+LALS+T++P + +  P   PN  Y+L   + S     E++
Sbjct:  105 ANGTDALNATAAKFVATAEGTALAYGSLVLMALLPIFFGALRSVSSSKSKVGAENGYENASDMPETITSRDAARFPIIASCTLFGLYLFFKIFSQEYINMLLSMYFFVLGILALSHTMSPFMNRVFPANLPNKQYQLLFTQGSGENKEEIV 255          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Match: sppl3 (signal peptide peptidase like 3 [Source:NCBI gene;Acc:103041982])

HSP 1 Score: 103.219 bits (256), Expect = 3.429e-23
Identity = 63/224 (28.12%), Postives = 111/224 (49.55%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            E +   +S  + + ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  + P+                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+                + +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  143 ELLSFSLSVMLVLIWVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPADNPLDVISRKLHLGPGMGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQASGEAPGPANMSGRMQRVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 366          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:103038406])

HSP 1 Score: 85.5001 bits (210), Expect = 7.177e-17
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 1
Query:  730 LDYPYKRKEFIGLFISA---AVGVWYMLTKH-----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAKSFEA-------PIKLVFPR-DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACL 1251
            L Y +KR +   L +SA   +V V + + ++     W+  +  G+AF +  ++ + L       +LL  LF+YD+F+VF        G ++MV VA            P+ L  PR +          +++LG GDI++PG+ VA   RFD   +  +  YF+A  V Y IGL+ T + + + +  QPALLYLVP  L
Sbjct:  257 LPYCHKRPQVRMLLLSAFCVSVSVTWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTLLLVVLFVYDVFFVFITPFFTKSGESIMVEVAAGPSGSSTHEKLPMVLKVPRLNFSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDILMQSSR-IYFLACTVGYGIGLLITFVALALMQMGQPALLYLVPCTL 453          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Sea Lamprey
Match: hm13 (histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB-GENE-020802-3])

HSP 1 Score: 281.952 bits (720), Expect = 3.415e-88
Identity = 131/195 (67.18%), Postives = 164/195 (84.10%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTK-HWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLF 1302
            E +L+Y + RK+   L +S+ VGVWY+L K HWIANNLFGLAF+++ VEL+HLN V TGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  ++N+AMLGLGDIVIPGIF+ALLLRFD S KK  +TYF   ++AYI+GL  T+ VMH FKHAQPALLYLVPAC+G+P++++++ G+  ++F
Sbjct:  151 EEILNYEFDRKDLFCLVLSSVVGVWYILKKKHWIANNLFGLAFALNGVELLHLNNVCTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPQDLLQRGLEASNFAMLGLGDIVIPGIFIALLLRFDISLKKNSRTYFYVSFLAYILGLGLTIFVMHTFKHAQPALLYLVPACIGLPVLVALLKGEVKEMF 345          

HSP 2 Score: 121.709 bits (304), Expect = 2.775e-30
Identity = 64/128 (50.00%), Postives = 87/128 (67.97%), Query Frame = 1
Query:  100 LNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLP 483
            LNAT+   A      N TT     P+G+ +AY SL +MA++PI+ G+ +SV   K   K+     ET+T+ DAA FP+ AS  LFGLYLFFK+FS+EYIN+LLS YFFVLG+LALS+T++P + +  P
Sbjct:    8 LNATL---AVAEAAVNATTKVPSTPEGVALAYGSLVVMALLPIFFGSLRSVKSAKS--KATSEMTETITSRDAARFPIIASCTLFGLYLFFKVFSQEYINLLLSMYFFVLGILALSHTISPAMARVFP 130          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Sea Lamprey
Match: hm13 (histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB-GENE-020802-3])

HSP 1 Score: 112.849 bits (281), Expect = 1.595e-27
Identity = 58/189 (30.69%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  742 YKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKY 1308
            + R++ + L  S +VG+ Y +TKHW  +++   + ++  VEL+ L  +   C+L   L ++DI  V   N           PI LVFP++L   G   + + ++ L  +VIPGIF+A LL+FD S ++  + YF  G  +Y  GL  T ++    ++A P   YL P  LG+P++++    +  ++F +
Sbjct:   84 FDRRDLLSLAASLSVGLCYFVTKHWATSDVLAASLALRGVELLPLCSIPAACLLFACLCLHDITSVESVNCQELSGLEGNIPIALVFPKELFGDGVDVSPFVIVPLDTVVIPGIFIAFLLKFDISIERNSRVYFYTGLTSYAAGLCLTAVLE---QYALPIFPYLAPVYLGLPLLVAAYRAELTEMFCF 269          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Sea Lamprey
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 85.1149 bits (209), Expect = 2.124e-18
Identity = 61/202 (30.20%), Postives = 95/202 (47.03%), Query Frame = 1
Query:  715 LFECLLDYPYKRKEFIGLFISAAVGVWYMLTKH--------WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAK-------SFEAPIKLVFPRDLVMSGFS--STNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPA 1245
            L  C+ + P  R   + +   A   VW +            W+  ++ G+AF    + ++ +       +LL  LF+YDIF+VF        G ++MV VA          + P+ L  PR L  S  S  S  +++LG GDI++PG+ V    RFD         YF+   +AY +GL+ T + + + +  QPALLYLVP 
Sbjct:   66 LAPCMQEPPPVRLAVLAVSCVATAVVWAVFRNEDRCGASWAWVLQDMLGIAFCTYMLRVLRMPSFKACTLLLVMLFVYDIFFVFITPYIMPNGQSIMVEVASGPSDSSSKEKLPMVLKVPR-LAPSELSVCSQPFSLLGFGDILVPGVLVVYCHRFDV-HTNSSHIYFVTSTIAYGLGLLVTFVALVLTRMGQPALLYLVPC 265          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Sea Lamprey
Match: sppl2 (signal peptide peptidase-like 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4265])

HSP 1 Score: 81.6481 bits (200), Expect = 1.987e-16
Identity = 68/211 (32.23%), Postives = 106/211 (50.24%), Query Frame = 1
Query:  739 PYKRKEFIGLFISAAVGVWYMLTKH-----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAK------SFEA-PIKLVFPRDLVMSGFSST--NYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            P  R   +G    A    W +   H     W+  ++ G+AF ++ +  + +       +LLG LF YDIF+VF        G ++MV VA       S E  P+ +  PR L  +  S     +++LG GDI++PG+ VA   RFD  Q +  + YFIA  +AY +GL+ T L + + +  QPALLYLVP  L   ++++   G+    +K
Sbjct:  290 PQVRLLLLGAGCMALAITWGVFRNHSESWAWVLQDILGVAFCLNMLCTVRMPSFRICVLLLGILFFYDIFFVFITPFLTSNGESIMVQVATGPSKSTSHEMLPMVVKVPR-LAATPLSMCYQPFSLLGFGDILVPGLLVAYCHRFDV-QVQSSKLYFIACTMAYGVGLLLTFLALALMRMGQPALLYLVPCTLLSSLLVACFRGELGMFWK 498          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Yeast
Match: YPF1 (Intramembrane aspartyl protease of the perinuclear ER membrane; acts in a branch of ER-associated degradation (ERAD) that degrades functional proteins rather than misfolded proteins; regulates abundance of high-affinity plasma membrane transporters, such as Ctr1p and Zrt1p, during the starvation response; has a presenilin fold; member of the GxGD family of intramembrane proteases; closest human homolog is signal peptide peptidase (SPP) [Source:SGD;Acc:S000001583])

HSP 1 Score: 107.842 bits (268), Expect = 9.671e-25
Identity = 58/186 (31.18%), Postives = 104/186 (55.91%), Query Frame = 1
Query:  796 YMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQT--------------YFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYE 1311
            Y+    W+ +N   +  ++ ++  + L  + +G ++L  LF YDI +VFGT+VMVTVA + + P+KL  P     +  ++ N+++LGLGDI +PG+F+A+  ++D  +                    YFI   V+Y+  L++ M+ + +F  AQPALLY+VP+ L   I+++    D  Q + ++
Sbjct:  323 YLSPNDWLISNAVSMNMAIWSIAQLKLKNLKSGALILIALFFYDICFVFGTDVMVTVATNLDIPVKLSLPVKF-NTAQNNFNFSILGLGDIALPGMFIAMCYKYDIWKWHLDHDDTEFHFLNWSYVGKYFITAMVSYVASLVSAMVSLSIFNTAQPALLYIVPSLLISTILVACWNKDFKQFWNFQ 507          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Nematostella
Match: EDO47550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM71])

HSP 1 Score: 263.462 bits (672), Expect = 8.405e-81
Identity = 125/194 (64.43%), Postives = 159/194 (81.96%), Query Frame = 1
Query:  727 LLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQT-YFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            ++ Y + R + + L  S   GVWY+L KHWIANN+FGLAFS++ VEL+HLN + TGCILLGGLFIYDIFWVFGT+VMVTVAKSFEAPIKLVFP D++  GF++ N+AMLGLGDIVIPGIF+ALLLR+D S+   K T YF A ++AY++GL+TT+LVMH FK AQPALLYLVPAC+G P+ L+++ G+  ++ K
Sbjct:  157 VMHYDFDRIDLLCLGGSFVFGVWYLLKKHWIANNIFGLAFSLNGVELLHLNSISTGCILLGGLFIYDIFWVFGTDVMVTVAKSFEAPIKLVFPMDILEKGFAANNFAMLGLGDIVIPGIFIALLLRYDVSKHGSKSTVYFYATFMAYLVGLITTVLVMHKFKAAQPALLYLVPACVGTPLTLALLRGEIKEILK 350          

HSP 2 Score: 143.28 bits (360), Expect = 2.071e-37
Identity = 75/160 (46.88%), Postives = 109/160 (68.12%), Query Frame = 1
Query:   85 LSMDVLNATI-NLTANENIT-KNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIE 558
            ++  V+N T+ NLTA  N T KN T      P+G++ AY  L +MA++PI+ G+ +SV  + +QKKSG+   E++T+ DAAMFP+ AS  L GLY+FFKIFSKEY+N+LL+ YFF LGVLAL++ L P +E+ +P FFPN  Y  ++ + +     EV+ 
Sbjct:    1 MAESVVNETLANLTAAANETAKNATGRAAATPEGMLTAYTGLIVMALLPIFYGSFRSVHAVLEQKKSGEKP-ESMTSKDAAMFPIIASCTLLGLYIFFKIFSKEYVNLLLTMYFFGLGVLALTHLLRPNVERLMPSFFPNQNYTFDLTEGTGDQKKEVMH 159          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Nematostella
Match: EDO32795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU17])

HSP 1 Score: 115.546 bits (288), Expect = 1.091e-27
Identity = 74/216 (34.26%), Postives = 113/216 (52.31%), Query Frame = 1
Query:  754 EFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-----------------KSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKK--------GKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVIL-GDQAQLFK 1305
            E + L +SA + + ++LT HW+  +   +   VS +  + L  +    +LL GL IYD+FWV      F TNVMV VA                  SF +  ++  P  LV        ++MLGLGDIV+PG+ +  ++R+D  +++         + TYF    V YI+GL+T  +   V+K AQPALLYLVP  L +PI+L   L GD  ++++
Sbjct:  147 ELMSLVLSAMLVLVWILTGHWVLMDALAMGLCVSMIAYIRLPSLKVSTLLLTGLLIYDVFWVFFSAYIFKTNVMVRVATQQANNPVAYVASKFRMNSFNSSPQISLPGKLVFPSQERGRFSMLGLGDIVMPGLLLCFVMRYDKYKRQQAPPTDTESRITYFHCSLVGYIVGLVTATVASEVYKAAQPALLYLVPFTL-LPILLMAYLKGDLRKMWQ 361          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Nematostella
Match: EDO41036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M6])

HSP 1 Score: 90.8929 bits (224), Expect = 3.651e-19
Identity = 66/213 (30.99%), Postives = 108/213 (50.70%), Query Frame = 1
Query:  739 PYKRKEFIGLFISAAVGVWYMLTKH----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAKSF-----------EAPIKLVFPRDLVMSGFS--STNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLF 1302
            P  R   + LF    + +W+ + ++    W+  ++ G++F +S +  + L  +    ILL  L IYDIF+VF        G +VMV VA              + P+ L  PR L  S  S  +  Y++LG GDI++PG+++     FD   K  ++ YF+A  +AY +GL+ T   + + K  QPALLYLVP  L   + ++   G+  +L+
Sbjct:  267 PEVRLIVLALF-CMGMSIWWGIERNASYAWVLQDILGVSFCISLIRNIRLPSLKVCTILLVLLLIYDIFFVFITPLFSASGKSVMVEVATGRVTAWLMCDHKEQLPMVLKIPR-LTKSVLSVCARPYSLLGFGDILVPGLYIGFCHSFDTISKTPRKIYFVATTIAYGVGLLITFGALFLMKTGQPALLYLVPCVLLTGVAIAWYRGELKKLW 477          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:101171062])

HSP 1 Score: 291.197 bits (744), Expect = 1.978e-90
Identity = 132/200 (66.00%), Postives = 165/200 (82.50%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNP 1320
            E +++Y +  K  + L IS+ VGVWY+L KHWIANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK  +TYF + ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P+I+++  G+  ++F+YE+ P
Sbjct:  163 EEIVNYEFDTKNLVCLCISSVVGVWYLLKKHWIANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDIVIPGIFIALLLRFDVSLKKNSRTYFYSSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVIVALFKGELTEMFRYEETP 362          

HSP 2 Score: 129.798 bits (325), Expect = 3.769e-32
Identity = 75/153 (49.02%), Postives = 99/153 (64.71%), Query Frame = 1
Query:   97 VLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            +LNAT    +N     N T   V  P+G  +AY SL  MA++PI+ GA +SV+  K  K S D   ET+T+ DAA FP+ AS  LFGLYLFFK+FS+EYIN+LLS YFFVLGVLALS+T++PL+ +  P   PN  Y+L   + S     E++
Sbjct:   19 ILNAT---DSNGTEALNATAKFVATPEGTALAYGSLVFMALLPIFFGALRSVTCSK-SKNSADMP-ETITSRDAARFPIIASCTLFGLYLFFKVFSQEYINLLLSVYFFVLGVLALSHTMSPLMSRIFPVSLPNKQYQLLFTQGSGESKEEIV 166          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Match: hm13 (histocompatibility minor 13 [Source:NCBI gene;Acc:101171062])

HSP 1 Score: 290.426 bits (742), Expect = 4.405e-90
Identity = 132/200 (66.00%), Postives = 165/200 (82.50%), Query Frame = 1
Query:  721 ECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNP 1320
            E +++Y +  K  + L IS+ VGVWY+L KHWIANNLFGLAF+++ VEL+HLN V TGCILLGGLF+YD+FWVFGTNVMVTVAKSFEAPIKLVFP+DL+  G  + N+AMLGLGDIVIPGIF+ALLLRFD S KK  +TYF + ++AYI GL  T+ VMH FKHAQPALLYLVPAC+G P+I+++  G+  ++F+YE+ P
Sbjct:  175 EEIVNYEFDTKNLVCLCISSVVGVWYLLKKHWIANNLFGLAFALNGVELLHLNNVSTGCILLGGLFVYDVFWVFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEANNFAMLGLGDIVIPGIFIALLLRFDVSLKKNSRTYFYSSFLAYIFGLGLTIFVMHTFKHAQPALLYLVPACVGFPVIVALFKGELTEMFRYEETP 374          

HSP 2 Score: 127.102 bits (318), Expect = 3.787e-31
Identity = 75/164 (45.73%), Postives = 101/164 (61.59%), Query Frame = 1
Query:   97 VLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSV-----------ETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVI 555
            +LNAT    +N     N T   V  P+G  +AY SL  MA++PI+ GA +SV+  K  K+ G+N             ET+T+ DAA FP+ AS  LFGLYLFFK+FS+EYIN+LLS YFFVLGVLALS+T++PL+ +  P   PN  Y+L   + S     E++
Sbjct:   19 ILNAT---DSNGTEALNATAKFVATPEGTALAYGSLVFMALLPIFFGALRSVTCSK-SKELGENDYHSGFRNSADMPETITSRDAARFPIIASCTLFGLYLFFKVFSQEYINLLLSVYFFVLGVLALSHTMSPLMSRIFPVSLPNKQYQLLFTQGSGESKEEIV 178          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Match: sppl3 (signal peptide peptidase like 3 [Source:NCBI gene;Acc:101174932])

HSP 1 Score: 104.76 bits (260), Expect = 1.209e-23
Identity = 63/210 (30.00%), Postives = 105/210 (50.00%), Query Frame = 1
Query:  796 YMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWV------FGTNVMVTVA-KSFEAPI------------------KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKG---------------KQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFK 1305
            ++LT HW+  +   +   V+ +  + L  +   C+LL GL IYD+FWV      F +NVMV VA +  E PI                  +L  P  LV    + ++++MLG+GDIV+PG+ +  +LR+D  +K+                + +YF    + Y +GL+T  +   + + AQPALLYLVP  L   + ++ + GD  +++ 
Sbjct:  159 WVLTGHWLLMDALAMGLCVAMIAFVRLPSLKVSCLLLSGLLIYDVFWVFFSAYIFNSNVMVKVATQPAENPIDVLSRKLHLGPGMGRDVPRLSLPGKLVFPSSTGSHFSMLGIGDIVMPGLLLCFVLRYDNYKKQANGEVPGPGNMSGRMQRVSYFHCTLIGYFVGLLTATVASRIHRAAQPALLYLVPFTLLPLLTMAYLKGDLRRMWS 368          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Match: sppl2 (signal peptide peptidase like 2B [Source:NCBI gene;Acc:101168741])

HSP 1 Score: 85.8853 bits (211), Expect = 5.107e-17
Identity = 63/198 (31.82%), Postives = 101/198 (51.01%), Query Frame = 1
Query:  730 LDYPYKRKEFIGLFISA---AVGVWYMLTKH-----WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAKS-------FEAPIKLVFPR-DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACL 1251
            L Y +KR +   L +SA   AV V +M+ ++     W+  +  G+AF +  ++ + L       +LL  LF+YD+F+VF        G ++MV VA          + P+ L  PR +          +++LG GD+++PG+ V    RFD   +  +  YF+   VAY IGL+ T + + + +  QPALLYLVP  L
Sbjct:  279 LPYFHKRPQVRMLLLSAFCVAVSVVWMVFRNEDQWAWVLQDALGIAFCLYMLKTVRLPTFKACTLLLTVLFVYDVFFVFITPFFTKSGESIMVEVAAGPSDSATHEKLPMVLKVPRLNSSPLALCDRPFSLLGFGDVLVPGLLVVYCHRFDILTQTSR-IYFVTCTVAYGIGLLVTFVALALMQTGQPALLYLVPCTL 475          
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Match: ENSORLT00000015899.2 (signal peptide peptidase-like 2A [Source:NCBI gene;Acc:101156241])

HSP 1 Score: 85.8853 bits (211), Expect = 5.198e-17
Identity = 54/157 (34.39%), Postives = 85/157 (54.14%), Query Frame = 1
Query:  814 WIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVF--------GTNVMVTVAKSFEA-----PIKLVFPR-DLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVP 1242
            W+  ++ G+AF ++ ++ + L+      ILL  L +YD+F+VF        G ++MV VA   +A     P+ +  P             +++LG GDI++PG+ VA   RFD      K+ YFI+  +AY++GL+ T  VM +    QPALLYLVP
Sbjct:  313 WLLQDILGIAFCLNFLKTISLSNFKICVILLSLLLVYDVFFVFITPFFTKDGVSIMVQVALGPDASGGKLPVVMRVPWFSAWAQNLCWMQFSILGYGDIIVPGLLVAYCSRFDVWVGSSKRIYFISSCLAYLLGLILTFAVMLLSGMGQPALLYLVP 469          
BLAST of Histocompatibility (minor) 13 vs. Planmine SMEST
Match: SMESG000016697.1 (SMESG000016697.1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 410/412 (99.51%), Postives = 410/412 (99.51%), Query Frame = 1
Query:   91 MDVLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVXXXXXXXXXXXXXXXXXXXXXXXXXXVEVNGXXXXXXXXXXXXXQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 1326
            MDVLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVSKSTEN NNKSKSKKDKSDKKQSNDNVEVNGELKNLE TNENKTQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV
Sbjct:    1 MDVLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGAQKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKEYINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPPPNEVIESSPEKTVSKSTENSNNKSKSKKDKSDKKQSNDNVEVNGELKNLEKTNENKTQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGLAFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPIKLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQAQLFKYEDNPKV 412          
BLAST of Histocompatibility (minor) 13 vs. Planmine SMEST
Match: SMESG000010558.1 (SMESG000010558.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.769e-8
Identity = 36/109 (33.03%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  979 EAPIKLVFPRDLVMSGFSST-------NYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTYFIAGYVA--YIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVI 1278
            E PI+   PR  +    SS        +Y+M+G GD+++PG F++ +  F     K    Y  +G++   YIIGL+ T LV    +  QPAL++L+P+ +   ++L+VI
Sbjct:  322 EVPIRFKIPRIDMNYKLSSARCQNYSRSYSMVGFGDVILPGAFISYMATFAVMTAKSPVLY--SGFLLFWYIIGLVITYLVAQFAERGQPALVFLLPSIVPTALLLAVI 428          
The following BLAST results are available for this feature:
BLAST of Histocompatibility (minor) 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HM131.831e-8865.35histocompatibility minor 13 [Source:HGNC Symbol;Ac... [more]
HM135.721e-8865.35histocompatibility minor 13 [Source:HGNC Symbol;Ac... [more]
HM132.559e-8763.86histocompatibility minor 13 [Source:HGNC Symbol;Ac... [more]
HM132.957e-8763.86histocompatibility minor 13 [Source:HGNC Symbol;Ac... [more]
HM132.411e-8565.13histocompatibility minor 13 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
imp-25.192e-5646.98Intramembrane protease 2 [Source:UniProtKB/Swiss-... [more]
imp-12.447e-1228.00IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-12.684e-1228.00IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-12.684e-1228.00IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
imp-12.884e-1228.00IntraMembrane Protease (IMPAS) family [Source:Uni... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spp1.582e-8664.32gene:FBgn0031260 transcript:FBtr0078080[more]
SppL1.557e-2331.00gene:FBgn0039381 transcript:FBtr0300819[more]
SppL1.557e-2331.00gene:FBgn0039381 transcript:FBtr0300820[more]
SppL1.655e-2331.00gene:FBgn0039381 transcript:FBtr0084910[more]
SppL1.655e-2331.00gene:FBgn0039381 transcript:FBtr0344118[more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hm132.301e-8965.83histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB... [more]
sppl32.759e-2328.13signal peptide peptidase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
sppl33.845e-2328.13signal peptide peptidase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
sppl27.788e-1733.33signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sppl32.714e-2328.70signal peptide peptidase like 3 [Source:NCBI gene;... [more]
sppl33.335e-2328.70signal peptide peptidase like 3 [Source:NCBI gene;... [more]
sppl33.524e-2328.70signal peptide peptidase like 3 [Source:NCBI gene;... [more]
bpi.41.937e-1732.32bactericidal permeability increasing protein, gene... [more]
bpi.41.969e-1732.32bactericidal permeability increasing protein, gene... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H131.463e-8966.83histocompatibility 13 [Source:MGI Symbol;Acc:MGI:9... [more]
H133.692e-8866.33histocompatibility 13 [Source:MGI Symbol;Acc:MGI:9... [more]
H133.432e-5248.24histocompatibility 13 [Source:MGI Symbol;Acc:MGI:9... [more]
H133.511e-3553.38histocompatibility 13 [Source:MGI Symbol;Acc:MGI:9... [more]
Sppl33.887e-2327.71signal peptide peptidase 3 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D8V0|HM13_MOUSE1.024e-8866.83Minor histocompatibility antigen H13 OS=Mus muscul... [more]
sp|Q8TCT9|HM13_HUMAN8.792e-8865.35Minor histocompatibility antigen H13 OS=Homo sapie... [more]
sp|P49049|IMP2_CAEEL6.604e-5546.98Intramembrane protease 2 OS=Caenorhabditis elegans... [more]
sp|O81062|SIP_ARATH3.769e-4951.43Signal peptide peptidase OS=Arabidopsis thaliana O... [more]
sp|B9FJ61|SIP2_ORYSJ1.813e-4750.00Signal peptide peptidase 2 OS=Oryza sativa subsp. ... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D5RA572.283e-13451.46Minor histocompatibility antigen H13-like OS=Scolo... [more]
A0A2Y9PTC55.374e-12452.28minor histocompatibility antigen H13 isoform X4 OS... [more]
A0A2Y9PZ771.478e-12251.52minor histocompatibility antigen H13 isoform X1 OS... [more]
A0A2Y9PSA82.141e-12051.94minor histocompatibility antigen H13 isoform X3 OS... [more]
A0A2M4A0771.428e-11949.14Putative signal peptide peptidase OS=Anopheles tri... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hm131.552e-8764.36histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
hm131.556e-8765.15histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
hm133.590e-8764.36histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
sppl33.429e-2328.13signal peptide peptidase like 3 [Source:NCBI gene;... [more]
sppl27.177e-1731.82signal peptide peptidase like 2B [Source:NCBI gene... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hm133.415e-8867.18histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB... [more]
hm131.595e-2730.69histocompatibility (minor) 13 [Source:ZFIN;Acc:ZDB... [more]
sppl22.124e-1830.20signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
sppl21.987e-1632.23signal peptide peptidase-like 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YPF19.671e-2531.18Intramembrane aspartyl protease of the perinuclear... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO475508.405e-8164.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327951.091e-2734.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410363.651e-1930.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hm131.978e-9066.00histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
hm134.405e-9066.00histocompatibility minor 13 [Source:NCBI gene;Acc:... [more]
sppl31.209e-2330.00signal peptide peptidase like 3 [Source:NCBI gene;... [more]
sppl25.107e-1731.82signal peptide peptidase like 2B [Source:NCBI gene... [more]
ENSORLT00000015899.25.198e-1734.39signal peptide peptidase-like 2A [Source:NCBI gene... [more]
back to top
BLAST of Histocompatibility (minor) 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000016697.10.000e+099.51SMESG000016697.1[more]
SMESG000010558.13.769e-833.03SMESG000010558.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013893 ID=SMED30013893|Name=Histocompatibility (minor) 13|organism=Schmidtea mediterranea sexual|type=transcript|length=2493bp
TTCATTTGTTAATTTACGTTTTATTTAAATACGTCAATTCATTACAAATA
CAAAATTATTTTCAAATATTGCCACGCTTAATTTTTATCAATGGACGTTT
TAAATGCCACCATAAATTTGACAGCTAATGAAAATATAACCAAAAATGGA
ACTACATCTGGTGTTCAAGATCCTCAAGGCTTGGTCATTGCTTACTTTAG
CTTATTCATAATGGCCATTGTTCCAATTTACATAGGGGCACAAAAATCGG
TTTCCAGATTGAAAGATCAAAAAAAAAGTGGAGATAATAGTGTTGAAACT
TTAACAAATAACGATGCCGCCATGTTTCCTTTATACGCAAGCGCCGGATT
GTTTGGATTGTATTTATTTTTTAAAATATTTTCTAAAGAGTATATAAATA
TGTTATTGAGTACATATTTTTTTGTGTTAGGAGTTTTGGCTTTATCAAAC
ACTTTGAATCCATTAATTGAGAAATATCTGCCAGATTTTTTTCCGAATTG
TTTATACAAATTAGAAATAAAGAAATTTAGTATACCACCACCAAATGAAG
TGATTGAGTCGAGTCCAGAGAAAACTGTATCAAAATCTACTGAAAATATT
AATAATAAATCGAAATCAAAGAAAGATAAATCAGATAAAAAACAATCAAA
TGACAATGTGGAAGTTAATGGAGAATTGAAAAATTTAGAAAATACAAATG
AAAATAAAACTCAATTATTCGAATGTCTTCTGGATTATCCCTACAAACGC
AAGGAATTTATTGGTTTGTTTATTTCAGCTGCCGTCGGAGTTTGGTATAT
GCTAACTAAGCATTGGATCGCTAATAATTTGTTTGGATTAGCTTTTTCAG
TAAGCGCCGTCGAATTAATGCATTTAAACAAAGTGGTAACCGGCTGCATT
CTGTTGGGTGGACTTTTTATTTATGACATTTTCTGGGTATTTGGCACCAA
TGTTATGGTTACCGTTGCTAAATCTTTCGAAGCTCCAATTAAATTGGTAT
TTCCTCGCGATTTGGTCATGTCGGGATTTTCATCTACTAATTATGCAATG
CTCGGCTTAGGAGATATCGTTATTCCTGGAATTTTCGTTGCTCTCTTATT
ACGATTTGACTATAGCCAAAAGAAAGGGAAACAAACCTACTTCATAGCGG
GATATGTTGCATACATCATTGGATTGATGACTACCATGTTGGTTATGCAC
GTTTTCAAGCATGCACAACCCGCGCTTCTTTATCTGGTTCCAGCTTGCTT
AGGGATACCGATCATTCTTTCAGTGATTTTGGGAGACCAAGCTCAGTTGT
TCAAGTATGAAGACAATCCAAAAGTCGAAGAGAGTAAAAGTTCATGAAAA
TCCATTCGAATGATGATCTGTTAGTGTCAGCGATTCTATCCACCGTTGTG
AATTGGTTTTATATCGCTATTGATCTGTCTGTCTGTGTCTGTCTGTGTGT
TCGCATATATTTAATTGGGTGGTCATTTGTTAATTTTGGTGGTGATAAAC
TGTAATATATCATTGTCCGCTGTTATTATTAGTATTGTTATATTTTCTGT
GATCGTCATTCATTTTCATTTGAAATTCATTTTGTATTTCTGTTTGTATT
TTATAGCGGTATTTATTACGGATTCATTCATCCTTTGGTGATAAATTTTG
TTAATTTGGTGCTAATTGAGCACTCGATAGTGATTGGTTGATTGATAAAT
ATATTCATCCAATGAAAATGGGTGAAGGAGTTGTGGAAATCTTTAGTTAA
TTTTATTTTAAATTTTTGGGAATTGTTATTGCTGTCACGTTTGTGGTGGT
TCTCAACAAGCAAGCGTTATTACTAATGCTAAACTCGATAAGAAGTATAT
CAGAGCTATAATAGATCCGAAGTTGCTTTTATTAGAGCTATAAATTGTGG
AAGTTAGACAACTGATTATATTACCACGATTGGATTGGCTTTGAAAATAG
CATCAGGAGATTTGAAATGCTTGCAGTAATCGCAACTTTATTACACAACA
TTGGACTATTTGAAAATTTGGTATTGTCATTACAGATTTAATCACTTCAT
TCTCTAAAACCATTAACAAATCTTTGTTTCACTCTACTATATCCAAATTC
TTCGGTGAATACTCATATTTTAGAATAATAAAGGAACGCTCACAGCGAAC
TTTAGCCACTTACAACGTCAGCACAGCTTTTATCCTTTTAAAAACTTTGT
AAATCTCGCTATATAAATGACACTCATAGTACATAAAATTTAATTTCGAC
CAATTTTTCTTGGTAACTTTTAACGATTTAAAGCCTGCATACTACCTCTA
AATCCAGTGACTCATCAGCAAGTTGCCTAATGTGCCAGTCCATCCACCTA
CAATGTTTAGGCACCAGACAACTTTAACATAAACAAATCGTTATTTTATT
GAACTCTCATAAAACGGGTTCGTTTTAATCCTATAACAAAGGTTTTTGTT
TTGTGTTCCATGTTTATTGGAATGAAAAATTGGCATTTTTCTG
back to top

protein sequence of SMED30013893-orf-1

>SMED30013893-orf-1 ID=SMED30013893-orf-1|Name=SMED30013893-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=419bp
MDVLNATINLTANENITKNGTTSGVQDPQGLVIAYFSLFIMAIVPIYIGA
QKSVSRLKDQKKSGDNSVETLTNNDAAMFPLYASAGLFGLYLFFKIFSKE
YINMLLSTYFFVLGVLALSNTLNPLIEKYLPDFFPNCLYKLEIKKFSIPP
PNEVIESSPEKTVSKSTENINNKSKSKKDKSDKKQSNDNVEVNGELKNLE
NTNENKTQLFECLLDYPYKRKEFIGLFISAAVGVWYMLTKHWIANNLFGL
AFSVSAVELMHLNKVVTGCILLGGLFIYDIFWVFGTNVMVTVAKSFEAPI
KLVFPRDLVMSGFSSTNYAMLGLGDIVIPGIFVALLLRFDYSQKKGKQTY
FIAGYVAYIIGLMTTMLVMHVFKHAQPALLYLVPACLGIPIILSVILGDQ
AQLFKYEDNPKVEESKSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043523regulation of neuron apoptotic process
GO:0006508proteolysis
GO:0033619membrane protein proteolysis
GO:1904211membrane protein proteolysis involved in retrograde protein transport, ER to cytosol
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006639Preselin/SPP
IPR007369Peptidase_A22B_SPP
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005765lysosomal membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005791rough endoplasmic reticulum
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0030660Golgi-associated vesicle membrane
GO:0036513Derlin-1 retrotranslocation complex
GO:0071458integral component of cytoplasmic side of endoplasmic reticulum membrane
GO:0071556integral component of lumenal side of endoplasmic reticulum membrane
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0031625ubiquitin protein ligase binding
GO:0042500aspartic endopeptidase activity, intramembrane cleaving
GO:0042803protein homodimerization activity