Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30013891
Length (bp)2033
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30013891) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30013891) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30013891) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30013891) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013891

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013891h1SMcG0011974 dd_Smed_v4_19460_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30013891h1SMcG0011974 SmedASXL_014151SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
anterior sideSMED30013891h1SMcG0011974 dd_Smed_v4_19460_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013891h1SMcG0011974 dd_Smed_v6_19460_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 83.9593 bits (206), Expect = 1.671e-16
Identity = 64/199 (32.16%), Postives = 96/199 (48.24%), Query Frame = 2
Query:  149 STNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW-YQHSTLG 742
             T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L +     L   +FQ    L+ LDLS N IQ IP+  FR       + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   49 GTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHM-----LPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQIS--CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 85.5001 bits (210), Expect = 2.258e-16
Identity = 64/198 (32.32%), Postives = 96/198 (48.48%), Query Frame = 2
Query:  152 TNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
            T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR       + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQL-----HMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQIS--CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          

HSP 2 Score: 59.3066 bits (142), Expect = 2.129e-8
Identity = 66/242 (27.27%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSL 940
            + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F         L++ N+     I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C     S    +F+   E+  L
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNNQ-----IAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG--GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRC-----SAKEQYFIPGTEDYQL 503          

HSP 3 Score: 53.1434 bits (126), Expect = 2.154e-6
Identity = 38/139 (27.34%), Postives = 68/139 (48.92%), Query Frame = 2
Query:  305 STTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            +T  F+ L+ L  + LSNN      ++ ++   F+    ++ L L+ N ++ I    FR L+  L+ L++ N++    I  DS + L  +  L +  N   Q+ +     F  + SL  L L  NP+ C+C++ WL  W
Sbjct:  557 ATGMFKKLTHLKKINLSNNK-----VSEIEDGAFEGAASVSELHLTANQLESIRSGMFRGLD-GLRTLMLRNNRIS-CIHNDSFTGLRNVRLLSLYDN---QITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGW 685          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: IGSF10 (immunoglobulin superfamily member 10 [Source:HGNC Symbol;Acc:HGNC:26384])

HSP 1 Score: 85.1149 bits (209), Expect = 2.852e-16
Identity = 63/196 (32.14%), Postives = 90/196 (45.92%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCF-----ESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQH 730
            L  IP  +  N+ R+ + Y +L  L   +FS + +LELL L+S G+  I    F  L  L +L +S N      +  LQ + F  L  LT L +  N I+ I    F  L     V +  N  +   + PD+   L  L+   IS    + L   F     + + S M  L +L LHGNPW CDC ++WL  W Q 
Sbjct:   48 LTSIPDSIPPNVERINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNK-----VRKLQKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLNFLRLVHLEGNQLT--KLHPDTFVSLSYLQIFKISFIKFLYLSDNFLTSLPQEMVSYMPDLDSLYLHGNPWTCDCHLKWLSDWIQE 236          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4 (leucine rich repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:15586])

HSP 1 Score: 83.5741 bits (205), Expect = 4.686e-16
Identity = 97/400 (24.25%), Postives = 150/400 (37.50%), Query Frame = 2
Query:  122 FKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHIS------------------------TTAFEHLSQLVILTLSNN--------------SLVIHDINNLQSEIF----------------------------QPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPC-FPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            F   +C      L  +P+ +  N   L +M  N+  ++A+ F H++ LE+L L    +R I                         + AFE+LS+L  L L NN              SL+  D+  L+   +                             PL+GL  L++S N    I    F  L  SLK L + NS+    I  ++   L  L  L+++HNNL  L      +F+ +  L  L LH NPW CDC I WL +W +     +                 CH+P  M    L     + +    F C  P  +    D  + EG    L C    +   + +KW   NGT+L   SR+  I   +  +   L   H  +  +G++ C +
Sbjct:   56 FSKVVCT--RRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGL-SSLKKLWVMNSQVSL-IERNAFDGLASLVELNLAHNNLSSLP---HDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTC-----------CGRCHAPMHMRGRYL-----VEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPM---SSVKWLLPNGTVLSHASRHPRI---SVLNDGTLNFSHVLLSDTGVYTCMV 426          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: LRRC4B (leucine rich repeat containing 4B [Source:HGNC Symbol;Acc:HGNC:25042])

HSP 1 Score: 83.1889 bits (204), Expect = 7.162e-16
Identity = 84/302 (27.81%), Postives = 139/302 (46.03%), Query Frame = 2
Query:  221 LTSLEANEFSHIYQLELLTLNSCG-VRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            + S+ +  F+ +  L  L L     + +IS  AFE L  L  L L   +L   DI NL +     L+ L  L+LS N + +I    F+ L  SL+ L + +++   +I  ++  DL  LE L++SHNNL+ L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P  +      R I    +SH F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   S    I   +  H   L   + T++ +G + C +
Sbjct:  170 IESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNL--KDIPNLTA-----LVRLEELELSGNRLDLIRPGSFQGL-TSLRKLWLMHAQV-ATIERNAFDDLKSLEELNLSHNNLMSLP---HDLFTPLHRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTC-----------CARCHAPAGLKG----RYIGELDQSH-FTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWLTPNGTLMTHGSYRVRI---SVLHDGTLNFTNVTVQDTGQYTCMV 438          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 66.6254 bits (161), Expect = 4.454e-11
Identity = 56/192 (29.17%), Postives = 92/192 (47.92%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHS 733
            L  +P+++  + IRL++    +T +  N+FS +  L+ L L    +  I   +F  L  L  L LS N      I +L   +FQ  + LT LDLS N I ++     +  E  L+VL + +    F +  + +S  V LE L ++ N L   +    + F      + L L  NPW CDC++RW+  W + +
Sbjct:   35 LTEVPQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNR-----IRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPE-FLEVLNL-DKNHIFCLENNVISSWVSLEVLTLNGNRLTTFEEPSNARF------RQLDLFNNPWNCDCRLRWMRKWLEKA 213          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: pxn-1 (Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;Acc:Q1ENI8])

HSP 1 Score: 65.0846 bits (157), Expect = 1.542e-10
Identity = 61/204 (29.90%), Postives = 91/204 (44.61%), Query Frame = 2
Query:   89 CTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCK 700
            C V    D+    V  C+  S+ L RIPK++S N+  L +    +  L+ ++     QLE L L    ++ I     +HL +L  L+L++N LV   I  L S+  +PL     L+L  N IQ I +   RY                    PD       L +LD SHN +  L +    +F  + +L +  LH NPW CDC+
Sbjct:   23 CPVECTCDKKGL-VVDCS--SSGLTRIPKNISRNVRSLVIRNNRIHKLKRSDLEGFNQLETLVLTHNKIKIIEENVLDHLPELKRLSLAHNELVY--IPPLCSD-SRPLAS---LNLKRNHIQFIDEQVLRYF-------------------PD-------LTQLDFSHNRIQSLRT---KLFDNLPALSHAHLHSNPWHCDCR 188          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 62.003 bits (149), Expect = 9.835e-10
Identity = 65/241 (26.97%), Postives = 110/241 (45.64%), Query Frame = 2
Query:  131 AICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISN---SKSP-----------------FSISPDSLSDLVRLERLDISHNNLIQL-DSCFES----------VFSKMISLQNLI----------LHGNPWKCDCKIRWLVFWYQH 730
             I   P T  + IP+   + +++L     ++ +LE  +F+ + +L+ L L    + +I+  AF+ L  L  L+L+ N      I+ L+ ++F  L  L  LDL +N I+ IP   F+ L   LK + + N   S+ P                  SIS D L D  +LE LD+S  N+  + ++ FE+            +K+ SL NLI          +  NP++CD ++   VF  + 
Sbjct:  243 GIFQPPETLFKEIPQ---IEVLKLSGC--SIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNF-----ISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNLPAIESLDVSSNPYRCDGELVNFVFGVED 473          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 62.003 bits (149), Expect = 9.835e-10
Identity = 65/241 (26.97%), Postives = 110/241 (45.64%), Query Frame = 2
Query:  131 AICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISN---SKSP-----------------FSISPDSLSDLVRLERLDISHNNLIQL-DSCFES----------VFSKMISLQNLI----------LHGNPWKCDCKIRWLVFWYQH 730
             I   P T  + IP+   + +++L     ++ +LE  +F+ + +L+ L L    + +I+  AF+ L  L  L+L+ N      I+ L+ ++F  L  L  LDL +N I+ IP   F+ L   LK + + N   S+ P                  SIS D L D  +LE LD+S  N+  + ++ FE+            +K+ SL NLI          +  NP++CD ++   VF  + 
Sbjct:  243 GIFQPPETLFKEIPQ---IEVLKLSGC--SIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNF-----ISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNLPAIESLDVSSNPYRCDGELVNFVFGVED 473          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 61.6178 bits (148), Expect = 1.363e-9
Identity = 65/241 (26.97%), Postives = 110/241 (45.64%), Query Frame = 2
Query:  131 AICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISN---SKSP-----------------FSISPDSLSDLVRLERLDISHNNLIQL-DSCFES----------VFSKMISLQNLI----------LHGNPWKCDCKIRWLVFWYQH 730
             I   P T  + IP+   + +++L     ++ +LE  +F+ + +L+ L L    + +I+  AF+ L  L  L+L+ N      I+ L+ ++F  L  L  LDL +N I+ IP   F+ L   LK + + N   S+ P                  SIS D L D  +LE LD+S  N+  + ++ FE+            +K+ SL NLI          +  NP++CD ++   VF  + 
Sbjct:  243 GIFQPPETLFKEIPQ---IEVLKLSGC--SIPTLEPGQFATLKKLKELDLRVNLIENITAYAFDGLESLTRLSLAGNF-----ISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNLPAIESLDVSSNPYRCDGELVNFVFGVED 473          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: kek2 (gene:FBgn0015400 transcript:FBtr0080252)

HSP 1 Score: 75.8702 bits (185), Expect = 8.432e-14
Identity = 78/298 (26.17%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  299 HISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLE--RLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNS-----------RNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFS 1153
             I   AF  L+ LV L LS N+L      N+ SE FQ    L  L LS N I+ +    FR+L   L  L +SN +    I  ++   +  LE  RLD +    IQ       +  K  SL  + LH N W CDC++  + FW                   ++ + L   P+ M  A L   +   ++  +  C P+   ++S   V EG N+S+ C  +++ +  ++ W  NG ++ ++S              +  S  +  RS + + +   + +G + C      NI GT FS
Sbjct:   92 RIHEKAFRGLTNLVELDLSENAL-----QNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHL-SFLTTLELSNCQVE-RIENEAFVGMDNLEWLRLDGNRIGFIQ----GTHILPK--SLHGISLHSNRWNCDCRLLDIHFWL-----------------VNYNTPLAEEPKCMEPARLKGQVIKSLQREQLACLPEVSPQSSYTEVSEGRNMSITCLVRAIPE-PKVLWLFNGQVMSNDSLMDNLHMYYYIDETIGVSGAEEKRSEIFIYNVGAEDNGTFSC---VGQNIAGTTFS 355          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 72.4034 bits (176), Expect = 1.207e-12
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHST 736
             L  +P+ +S ++ RLE+   NLT +   +F  + +L +L L    +  I   +F+ L  L  L L+NN L     N + S        L  LD+S N I  + +  F+  + SL+ L + N++    +   +   LV LE L +++NNL  L     ++F  +  L+ L L  NP+ CDC + WL  + + +T
Sbjct:   90 GLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSS-----ASLLRLDISNNVITTVGRRVFKGAQ-SLRSLQLDNNQI-TCLDEHAFKGLVELEILTLNNNNLTSLP---HNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSAT 273          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 72.4034 bits (176), Expect = 1.207e-12
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHST 736
             L  +P+ +S ++ RLE+   NLT +   +F  + +L +L L    +  I   +F+ L  L  L L+NN L     N + S        L  LD+S N I  + +  F+  + SL+ L + N++    +   +   LV LE L +++NNL  L     ++F  +  L+ L L  NP+ CDC + WL  + + +T
Sbjct:   90 GLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSS-----ASLLRLDISNNVITTVGRRVFKGAQ-SLRSLQLDNNQI-TCLDEHAFKGLVELEILTLNNNNLTSLP---HNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSAT 273          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 72.4034 bits (176), Expect = 1.240e-12
Identity = 56/194 (28.87%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHST 736
             L  +P+ +S ++ RLE+   NLT +   +F  + +L +L L    +  I   +F+ L  L  L L+NN L     N + S        L  LD+S N I  + +  F+  + SL+ L + N++    +   +   LV LE L +++NNL  L     ++F  +  L+ L L  NP+ CDC + WL  + + +T
Sbjct:   90 GLTSVPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSS-----ASLLRLDISNNVITTVGRRVFKGAQ-SLRSLQLDNNQI-TCLDEHAFKGLVELEILTLNNNNLTSLP---HNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSAT 273          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 67.781 bits (164), Expect = 2.742e-11
Identity = 54/194 (27.84%), Postives = 94/194 (48.45%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHST 736
             L  +P+ +S ++ RLE+   NLT         IY+                T F+ L++L +L L++N      I+ ++   FQ L+ L  LD+S N I  + +  F+  + SL+ L + N++    +   +   LV LE L +++NNL  L     ++F  +  L+ L L  NP+ CDC + WL  + + +T
Sbjct:   90 GLTSVPRKISADVERLELQGNNLTV--------IYE----------------TDFQRLTKLRMLQLTDNQ-----IHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQ-SLRSLQLDNNQI-TCLDEHAFKGLVELEILTLNNNNLTSLP---HNIFGGLGRLRALRLSDNPFACDCHLSWLSRFLRSAT 249          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: igsf10 (immunoglobulin superfamily, member 10 [Source:ZFIN;Acc:ZDB-GENE-130530-827])

HSP 1 Score: 85.8853 bits (211), Expect = 1.086e-16
Identity = 60/199 (30.15%), Postives = 102/199 (51.26%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMI-PKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDL--------VRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  +P D+   + R+ + Y +L+SL+AN  S + +LELL L+S  ++ +  +AF  L+ L +L +S N      +  L  + F+ L  L  L L  N I  I P+ F  Y  K L+++ +  ++    + PD+   +          L+ + +S N L  L +   +V S  + ++NL L GNPW CDC++ WL  W +
Sbjct:   50 LSEMPGDIQTAVERINLGYNSLSSLQANALSGLNKLELLMLHSNMIKTVEDSAFSGLTSLQVLKMSYNR-----VEKLNKDTFRGLDNLVRLQLDHNLITFIHPESF--YGLKRLQLINLEGNQLQ-QLHPDTFISVRFGQILKWSSLKTIYLSDNALGTLPA---AVLSGCVKIENLFLSGNPWSCDCRMSWLAKWIE 237          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4.2 (leucine rich repeat containing 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-7997])

HSP 1 Score: 80.4925 bits (197), Expect = 2.624e-15
Identity = 69/258 (26.74%), Postives = 108/258 (41.86%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHIS------------------------TTAFEHLSQLVILTLSNN--------------SLVIHDINNLQS----------------------------EIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQH 730
            +L R+P  +      L +M  ++ ++EA  F H+  LE+L L    +R I                         + AFE+LS+L  L L +N              SL+  D+  L+                              +  PL+GL  L++S N+   +    FR L KSLK L I NS+   +I  ++  D+  L  L+++HNNL  L      +F+ +  L  L LH NPW+CDC + WL +W + 
Sbjct:   59 SLVRVPPGIPATTRHLNLMENSIETIEAGTFQHLRHLEVLQLGRNSIRQIEVGAFSGLNSLNTLELFDNRLTVIPSGAFEYLSKLRELWLRSNPIESIPSYAFNRVPSLMRLDLGELRKLEYISEGAFEGLHNLKYLNLGMCNLREMPVLTPLVGLEELEMSENYFPELKPGSFRGL-KSLKKLWIMNSRI-TTIERNAFDDVTALVELNLAHNNLSSLP---HDLFAPLSYLVELHLHHNPWRCDCDVVWLAWWLRE 311          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: slit3 (slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-4])

HSP 1 Score: 79.7221 bits (195), Expect = 6.956e-15
Identity = 62/193 (32.12%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNN--LIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQH 730
             + +P+ +  N  RL++   N+T +   +FS +  L +L L +  +  I   AFE L QL  + L+ N L +     L   +FQ    L+ LDLS N IQ +P+  FR +     + + SN  S   I   +   L  LE L +++NN  LI L S     F+ M  L+ L LH N   CDC + WL  W + 
Sbjct:   43 FKTVPRGIPRNAERLDLDRNNITRITKVDFSGLKNLRVLHLENNQISVIERGAFEGLKQLERIRLNRNRLQV-----LPELLFQSTTKLSRLDLSENQIQAVPRKAFRGITTVKNLQLDSNHIS--CIEDGAFRALRDLEILTLNNNNITLIPLSS-----FNHMPKLRTLRLHSNNLHCDCHLSWLSDWLRQ 223          

HSP 2 Score: 57.7658 bits (138), Expect = 5.108e-8
Identity = 43/135 (31.85%), Postives = 62/135 (45.93%), Query Frame = 2
Query:  323 HLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            +L QL +L LSNNS     I++L    F  +  L  L LS+N I+ +P H F  L +SL++L +                          H N   L +  E  F+ + SL +L L  NP  CDC++RWL  W +
Sbjct:  766 NLKQLTLLDLSNNS-----ISHLAPLTFSNMTQLATLILSYNQIRCVPVHAFDGL-RSLRLLTL--------------------------HGN--DLSTVPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWVK 866          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 78.9518 bits (193), Expect = 9.427e-15
Identity = 91/389 (23.39%), Postives = 159/389 (40.87%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHIS------------------------TTAFEHLSQLVILTLSNNSL------VIHDINNLQ----SEI--------------------------------FQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            +LE +P ++S N   L +    +  ++++ F H+  LE+L L+   +R I                         + AFE+LS+L  L L NN +        H + +L+     E+                                  PL+ L  L+LS N +++I    F+ LE   K+ ++ +  S   I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P  +      + I    +SH F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   S    I   +  H   L   + T++ +G + C +
Sbjct:   59 HLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMS--VIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTC-----------CARCHAPPYLKG----KYIGELDQSH-FTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWITPNGTLMTHGSYRVRI---SVLHDGTLNFTNVTLRDTGQYTCMV 421          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 78.9518 bits (193), Expect = 9.427e-15
Identity = 91/389 (23.39%), Postives = 159/389 (40.87%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHIS------------------------TTAFEHLSQLVILTLSNNSL------VIHDINNLQ----SEI--------------------------------FQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            +LE +P ++S N   L +    +  ++++ F H+  LE+L L+   +R I                         + AFE+LS+L  L L NN +        H + +L+     E+                                  PL+ L  L+LS N +++I    F+ LE   K+ ++ +  S   I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P  +      + I    +SH F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   S    I   +  H   L   + T++ +G + C +
Sbjct:   59 HLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMS--VIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTC-----------CARCHAPPYLKG----KYIGELDQSH-FTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWITPNGTLMTHGSYRVRI---SVLHDGTLNFTNVTLRDTGQYTCMV 421          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: rps2 (ribosomal protein S2 [Source:Xenbase;Acc:XB-GENE-1003616])

HSP 1 Score: 87.8113 bits (216), Expect = 4.490e-17
Identity = 77/249 (30.92%), Postives = 113/249 (45.38%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSL------VIHDINNL-------------QSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSIS 847
            L  IPK ++ ++ R+ + Y ++  LE  +FS + +LELL L+S  +R I   A   LS L +L +S N +        H + NL               E F  L  L L+ L  N +  +  H   +L  +L+ + I  + S              ++++ +S N   QL S  E +FS M  L+ + LHGNPW CDCK+ WL  W Q S              S  Q  LC SPR+ +NA  L  IS
Sbjct:   49 LTAIPKQINPDVERINLGYNSIIKLEEMDFSGLQKLELLMLHSNEIRAIHERALNDLSSLQVLKMSYNKVKSFHKNTFHGLKNLVRLHMDHNKLDFINPESFYGLTSLKLVHLEGNLLTQL--HTDTFL--TLRYIHIFKTSS--------------IKQVYLSDN---QLSSLPEDMFSYMTELEGIYLHGNPWSCDCKLEWLRDWAQQS----RDIIKCKKDRSGQQCPLCASPRT-NNAKTLTEIS 271          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.5001 bits (210), Expect = 1.823e-16
Identity = 72/242 (29.75%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPC 877
            L+ +PK++  +  RLE+   N+T +  N+FS + QL +L L    + ++   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR   +   + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G             F      SP        LR +++  I+ HEF C
Sbjct:   50 LKGVPKNIPRSTERLELYGNNITRINKNDFSGLKQLRVLQLMENQISNVERGAFDDMKELERLRLNRNQL-----HTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQIS--CIEDGAFRALRGLEVLTLNNNNITAIPV---SSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTIGL------------FTQCTGPSP--------LRGLNVAEIQKHEFSC 261          

HSP 2 Score: 53.1434 bits (126), Expect = 1.789e-6
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  266 ELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            E+ TL + G+       F  L  L  + LSNN      I+ ++   F+    ++ L L+ N ++ +    FR LE  L+ L++ N++    +  DS + L  +  L +  N   Q+ +     F  + SL  L L  NP+ C+C++ WL  W
Sbjct:  545 EIATLEATGL-------FRKLPHLKKINLSNNK-----ISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLE-GLRTLMLRNNRVS-CVHNDSFTGLRNVRLLSLYDN---QISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDW 679          

HSP 3 Score: 53.1434 bits (126), Expect = 1.899e-6
Identity = 61/224 (27.23%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPK 886
            + LT++ AN    + ++ L  LN  G++ +   AF    +L  + LSNN      I+ +  + FQ L  L  L L  N I  +PK  F  L     +L+ +N  +   I  D+  DL  L  L +  N   ++ S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C  K
Sbjct:  296 KGLTAIPANLPETMTEIRL-ELN--GIKSVPPGAFSPYKKLRRIDLSNNQ-----ISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKIN--CIRADTFQDLQNLSLLSLYDN---KIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRCSGK 488          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.5001 bits (210), Expect = 1.887e-16
Identity = 72/242 (29.75%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPC 877
            L+ +PK++  +  RLE+   N+T +  N+FS + QL +L L    + ++   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR   +   + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G             F      SP        LR +++  I+ HEF C
Sbjct:   52 LKGVPKNIPRSTERLELYGNNITRINKNDFSGLKQLRVLQLMENQISNVERGAFDDMKELERLRLNRNQL-----HTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQIS--CIEDGAFRALRGLEVLTLNNNNITAIPV---SSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTIGL------------FTQCTGPSP--------LRGLNVAEIQKHEFSC 263          

HSP 2 Score: 53.1434 bits (126), Expect = 1.805e-6
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  266 ELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            E+ TL + G+       F  L  L  + LSNN      I+ ++   F+    ++ L L+ N ++ +    FR LE  L+ L++ N++    +  DS + L  +  L +  N   Q+ +     F  + SL  L L  NP+ C+C++ WL  W
Sbjct:  547 EIATLEATGL-------FRKLPHLKKINLSNNK-----ISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLE-GLRTLMLRNNRVS-CVHNDSFTGLRNVRLLSLYDN---QISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDW 681          

HSP 3 Score: 53.1434 bits (126), Expect = 1.899e-6
Identity = 61/224 (27.23%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPK 886
            + LT++ AN    + ++ L  LN  G++ +   AF    +L  + LSNN      I+ +  + FQ L  L  L L  N I  +PK  F  L     +L+ +N  +   I  D+  DL  L  L +  N   ++ S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C  K
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSVPPGAFSPYKKLRRIDLSNNQ-----ISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKIN--CIRADTFQDLQNLSLLSLYDN---KIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRCSGK 490          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.5001 bits (210), Expect = 1.938e-16
Identity = 72/242 (29.75%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPC 877
            L+ +PK++  +  RLE+   N+T +  N+FS + QL +L L    + ++   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR   +   + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G             F      SP        LR +++  I+ HEF C
Sbjct:   57 LKGVPKNIPRSTERLELYGNNITRINKNDFSGLKQLRVLQLMENQISNVERGAFDDMKELERLRLNRNQL-----HTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQIS--CIEDGAFRALRGLEVLTLNNNNITAIPV---SSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTIGL------------FTQCTGPSP--------LRGLNVAEIQKHEFSC 268          

HSP 2 Score: 53.1434 bits (126), Expect = 1.821e-6
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  266 ELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            E+ TL + G+       F  L  L  + LSNN      I+ ++   F+    ++ L L+ N ++ +    FR LE  L+ L++ N++    +  DS + L  +  L +  N   Q+ +     F  + SL  L L  NP+ C+C++ WL  W
Sbjct:  552 EIATLEATGL-------FRKLPHLKKINLSNNK-----ISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLE-GLRTLMLRNNRVS-CVHNDSFTGLRNVRLLSLYDN---QISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDW 686          

HSP 3 Score: 53.1434 bits (126), Expect = 1.916e-6
Identity = 61/224 (27.23%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPK 886
            + LT++ AN    + ++ L  LN  G++ +   AF    +L  + LSNN      I+ +  + FQ L  L  L L  N I  +PK  F  L     +L+ +N  +   I  D+  DL  L  L +  N   ++ S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C  K
Sbjct:  303 KGLTAIPANLPETMTEIRL-ELN--GIKSVPPGAFSPYKKLRRIDLSNNQ-----ISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKIN--CIRADTFQDLQNLSLLSLYDN---KIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRCSGK 495          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: slit1 (slit guidance ligand 1 [Source:NCBI gene;Acc:100036682])

HSP 1 Score: 85.5001 bits (210), Expect = 1.948e-16
Identity = 72/242 (29.75%), Postives = 111/242 (45.87%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPC 877
            L+ +PK++  +  RLE+   N+T +  N+FS + QL +L L    + ++   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR   +   + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G             F      SP        LR +++  I+ HEF C
Sbjct:   38 LKGVPKNIPRSTERLELYGNNITRINKNDFSGLKQLRVLQLMENQISNVERGAFDDMKELERLRLNRNQL-----HTLPELLFQNNQALSRLDLSENLIQAIPRKTFRGATELKNLQLDKNQIS--CIEDGAFRALRGLEVLTLNNNNITAIPV---SSFNHMPKLRTFRLHSNNLFCDCHLAWLSQWLRQRPTIGL------------FTQCTGPSP--------LRGLNVAEIQKHEFSC 249          

HSP 2 Score: 53.1434 bits (126), Expect = 1.817e-6
Identity = 41/152 (26.97%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  266 ELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            E+ TL + G+       F  L  L  + LSNN      I+ ++   F+    ++ L L+ N ++ +    FR LE  L+ L++ N++    +  DS + L  +  L +  N   Q+ +     F  + SL  L L  NP+ C+C++ WL  W
Sbjct:  533 EIATLEATGL-------FRKLPHLKKINLSNNK-----ISEIEDAAFEGAASVSELHLTANHLESVRSGMFRGLE-GLRTLMLRNNRVS-CVHNDSFTGLRNVRLLSLYDN---QISTITPGAFDTLQSLSTLNLLANPFNCNCQLAWLGDW 667          

HSP 3 Score: 53.1434 bits (126), Expect = 1.913e-6
Identity = 61/224 (27.23%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPK 886
            + LT++ AN    + ++ L  LN  G++ +   AF    +L  + LSNN      I+ +  + FQ L  L  L L  N I  +PK  F  L     +L+ +N  +   I  D+  DL  L  L +  N   ++ S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C  K
Sbjct:  284 KGLTAIPANLPETMTEIRL-ELN--GIKSVPPGAFSPYKKLRRIDLSNNQ-----ISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFSGLHALQLLLLNANKIN--CIRADTFQDLQNLSLLSLYDN---KIQSLAKGTFAALRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRCSGK 476          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.1965 bits (217), Expect = 2.439e-17
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMI-PKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQ--------LDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  IP  +  N+ R+ + Y +LT L  N+FS + +LELL L+S G+  +S   F  L  L +L +S N + I     ++ +    L  LT L L  N I+ I P+ F+     +L  L+         + PD+    V L  L I   + I+        L S  + + S M +L++L LHGNPW CDC ++WL  W Q
Sbjct:   48 LTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL---TLLRLVHLEGNRLTKLHPDT---FVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQ 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.1965 bits (217), Expect = 2.439e-17
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMI-PKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQ--------LDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  IP  +  N+ R+ + Y +LT L  N+FS + +LELL L+S G+  +S   F  L  L +L +S N + I     ++ +    L  LT L L  N I+ I P+ F+     +L  L+         + PD+    V L  L I   + I+        L S  + + S M +L++L LHGNPW CDC ++WL  W Q
Sbjct:   48 LTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL---TLLRLVHLEGNRLTKLHPDT---FVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQ 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Igsf10 (immunoglobulin superfamily, member 10 [Source:MGI Symbol;Acc:MGI:1923481])

HSP 1 Score: 88.1965 bits (217), Expect = 2.439e-17
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMI-PKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQ--------LDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  IP  +  N+ R+ + Y +LT L  N+FS + +LELL L+S G+  +S   F  L  L +L +S N + I     ++ +    L  LT L L  N I+ I P+ F+     +L  L+         + PD+    V L  L I   + I+        L S  + + S M +L++L LHGNPW CDC ++WL  W Q
Sbjct:   48 LTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL---TLLRLVHLEGNRLTKLHPDT---FVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQ 235          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 87.8113 bits (216), Expect = 2.489e-17
Identity = 64/198 (32.32%), Postives = 99/198 (50.00%), Query Frame = 2
Query:  152 TNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
            T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L +     L   +FQ    L+ LDLS NF+Q +P+  FR     LK L +  ++    I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQV-----LPELLFQNNQALSRLDLSENFLQAVPRKAFRG-ATDLKNLQLDKNRIS-CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          

HSP 2 Score: 58.9214 bits (141), Expect = 2.090e-8
Identity = 66/242 (27.27%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSL 940
            + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F         L++ N+     I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C     S    +F+   E+  L
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNNQ-----IAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG--GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETTGARCASPRRLANKRIGQ-----IKSKKFRC-----SAKEQYFIPGTEDYHL 503          

HSP 3 Score: 51.6026 bits (122), Expect = 4.211e-6
Identity = 37/139 (26.62%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  305 STTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            +T  F+ LS L  + LSNN      ++ ++   F+    ++ L L+ N ++ I    FR L+  L+ L++ N++    I  DS + L  +  L +  N++  +       F  + +L  L L  NP+ C+C + WL  W
Sbjct:  557 ATGLFKKLSHLKKINLSNNK-----VSEIEDGTFEGAASVSELHLTANQLESIRSGMFRGLD-GLRTLMLRNNRIS-CIHNDSFTGLRNVRLLSLYDNHITTISP---GAFDTLQALSTLNLLANPFNCNCHLSWLGDW 685          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 84.7297 bits (208), Expect = 2.644e-16
Identity = 63/199 (31.66%), Postives = 97/199 (48.74%), Query Frame = 2
Query:  149 STNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
             T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L +     L   +FQ    L+ LDLS NF+Q +P+  FR       + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   49 GTGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQV-----LPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQLDKNRIS--CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          

HSP 2 Score: 59.6918 bits (143), Expect = 1.264e-8
Identity = 66/240 (27.50%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  200 LEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVG 919
            ++   + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F  L     +L+ +N  +   I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F    +C +K   F  G
Sbjct:  293 VDCRGKGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNN-----QIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKIN--CIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETTGARCASPRRLANKRIGQ-----IKSKKF----RCSAKEQYFIPG 497          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6WRH9|IGS10_RAT (Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.019e-18
Identity = 62/195 (31.79%), Postives = 97/195 (49.74%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCF-----ESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  IP  +  N+ R+ + Y +LT L  N+F  + +LELL L+S G+  +S   F  L  L +L +S N + I     ++ + F  L  L  L L  N I+ I    F Y   SL+++ +  ++    + PD+   L  L+    S    + L   F     + + S M +L++L LHGNPW CDC ++WL  W Q
Sbjct:   48 LTSIPDGIPANVERINLGYNSLTRLTENDFDGLSKLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IRKDTFYGLGSLVRLHLDHNNIEFINPEAF-YGLTSLRLVHLEGNRLT-KLHPDTFVSLSYLQIFKTSFIKYLFLSDNFLTSLPKEMVSYMPNLESLYLHGNPWTCDCHLKWLSEWMQ 235          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3V1M1|IGS10_MOUSE (Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.706e-16
Identity = 65/199 (32.66%), Postives = 98/199 (49.25%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMI-PKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQ--------LDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L  IP  +  N+ R+ + Y +LT L  N+FS + +LELL L+S G+  +S   F  L  L +L +S N + I     ++ +    L  LT L L  N I+ I P+ F+     +L  L+         + PD+    V L  L I   + I+        L S  + + S M +L++L LHGNPW CDC ++WL  W Q
Sbjct:   48 LTSIPDGIPANVERVNLGYNSLTRLTENDFSGLSRLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQI-----IEKDTLYGLRSLTRLHLDHNNIEFINPEAFYGL---TLLRLVHLEGNRLTKLHPDT---FVSLSYLQIFKTSFIKYLYLSDNFLTSLPKEMVSSMPNLESLYLHGNPWTCDCHLKWLSEWMQ 235          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TR4|SLIT1_MOUSE (Slit homolog 1 protein OS=Mus musculus OX=10090 GN=Slit1 PE=1 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 1.741e-16
Identity = 64/198 (32.32%), Postives = 99/198 (50.00%), Query Frame = 2
Query:  152 TNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
            T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L +     L   +FQ    L+ LDLS NF+Q +P+  FR     LK L +  ++    I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQV-----LPELLFQNNQALSRLDLSENFLQAVPRKAFRG-ATDLKNLQLDKNRIS-CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          

HSP 2 Score: 58.9214 bits (141), Expect = 1.462e-7
Identity = 66/242 (27.27%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSL 940
            + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F         L++ N+     I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C     S    +F+   E+  L
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNNQ-----IAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG--GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETTGARCASPRRLANKRIGQ-----IKSKKFRC-----SAKEQYFIPGTEDYHL 503          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O88279|SLIT1_RAT (Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 9.447e-16
Identity = 77/272 (28.31%), Postives = 119/272 (43.75%), Query Frame = 2
Query:  152 TNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPCFPKCLSKNSDFFVGEGENVSLP-CSFQS 958
            T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L +     L   +FQ    L+ LDLS N +Q +P+  FR       + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G F                C  P S      LR +++  ++  EF C             G+GE   +P C+  S
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQV-----LPELLFQNNQALSRLDLSENSLQAVPRKAFRGATDLKNLQLDKNQIS--CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFTQ--------------CSGPAS------LRGLNVAEVQKSEFSC------------SGQGEAAQVPACTLSS 279          

HSP 2 Score: 58.9214 bits (141), Expect = 1.606e-7
Identity = 66/242 (27.27%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSL 940
            + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F         L++ N+     I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C     S    +F+   E+  L
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNNQ-----IAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG--GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETTGARCASPRRLANKRIGQ-----IKSKKFRC-----SAKEQYFIPGTEDYHL 503          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|O75093|SLIT1_HUMAN (Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4)

HSP 1 Score: 85.5001 bits (210), Expect = 1.084e-15
Identity = 64/198 (32.32%), Postives = 96/198 (48.48%), Query Frame = 2
Query:  152 TNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
            T L+ IPK++  N  RLE+   N+T +  N+F+ + QL +L L    +  +   AF+ + +L  L L+ N L     + L   +FQ    L+ LDLS N IQ IP+  FR       + +  N  S   I   +   L  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQL-----HMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQIS--CIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIG 237          

HSP 2 Score: 59.3066 bits (142), Expect = 1.023e-7
Identity = 66/242 (27.27%), Postives = 106/242 (43.80%), Query Frame = 2
Query:  215 QNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSL 940
            + LT++ AN    + ++ L  LN  G++ I   AF    +L  + LSNN      I  +  + FQ L  L  L L  N I  +P+  F         L++ N+     I PD+  DL  L  L + ++N IQ  S  +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C     S    +F+   E+  L
Sbjct:  298 KGLTAIPANLPETMTEIRL-ELN--GIKSIPPGAFSPYRKLRRIDLSNNQ-----IAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFG--GLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSL-YDNKIQ--SLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRC-----SAKEQYFIPGTEDYQL 503          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5K3EQX5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 4.107e-36
Identity = 121/380 (31.84%), Postives = 182/380 (47.89%), Query Frame = 2
Query:   38 IMFAL**KIRKRLQIRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFF-RYLEKSLKVLIISNSKS--PFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXX---XXHFQSALCHSPRSMHNAILLRSISI-PIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSV 1156
            I F+L    +  + +RGCTV+       +K A+C+  S+ L ++P DL   LI L +  Q +  L+  E   +  LE   L+SC +  +    F+ L++L IL+L NNSL + D N+        L  L +LDLS N +  IP +FF   L KSL  L + ++K+  P  I    L  L  L+ LD+S + L  L S F  VF+KM  L+ L L GNPW CDC +RWL  WY   +L S        +    ++  +  C SP ++   ++        I+  EF C     SK        G N+SL C   +  Q T + W  NG  L ++SR  V ++ +    S L +     + +G+W C    +D  I   FS+
Sbjct:    6 IAFSLLLLAKTTIAVRGCTVIAIQPDLRWKKAVCDSHSSLLTKVPPDLPEMLISLRVTQQEIRRLDNQELRRLVYLEEFYLDSCQLEQLELNVFQGLNRLRILSLRNNSLRL-DENSFLPATLHRLPALEVLDLSENPLGQIPGNFFPTSLGKSLFELRLGHTKNEFPLRIEASVLEVLRNLQILDLSFSGLETLSSDFRVVFNKMGRLKELQLGGNPWHCDCNLRWLREWYLADSLPSMQLSYEQKTKFGTTNLVTPTCKSPYAVKRRLIFAPPGGEAIEPEEFVCKQWIDSKMKHVIATLGSNISLSCDGYTETQTT-VVWFRNGLPLLNSSRYTVSQTSSLDFTSYLNISEVRYEDAGMWEC--CLEDGCITQKFSI 381          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A0V0J9I4 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR91065 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 9.618e-36
Identity = 107/337 (31.75%), Postives = 159/337 (47.18%), Query Frame = 2
Query:   80 IRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQP--LIGLTLLD---LSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ------------HSTLGXXXXXXXXXXXXHFQS------ALCHSPRSMHNAILLRSISI---PIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKS 1012
            ++GC   +  D  N + +IC+   T+  RIP+ L   +++L +  QN+  L+  + +H+  L  L L+S  +R I   AF  +  L  L+L NN LV      L ++ F P  LI +  L+   L  N +  +P HFF  + KSL+ L+++ +   F++S DSL  L  +E LDIS+N L  L   F  +FS M  L+ L L GNPW CDC +RWL  W Q            H+ +G               S        C +P  +          +   P+ S E  C PK LSK+S+     GENV++ C F++      I W  NG  L S
Sbjct:   24 VKGCVTFVDGDDYNARHSICDKTDTHFSRIPETLPKEVVKLTVNNQNIPVLDGKQLAHLPNLTYLNLDSNRLRVIHRDAFHSVPFLRSLSLRNNQLV------LSAQSFNPGALIDMNYLEELNLMKNPLGRVPSHFFYPVRKSLRTLVLAGATQDFNLSLDSLEGLFEIEFLDISYNRLHTLSDAFSGLFSTM-KLKKLYLFGNPWHCDCSLRWLRQWTQENNDTQFYVDLRHTEMGHLIDVGQFDGNLGVLSMETTNQPRCETPAHLSGRSFFPISGLPNNPVTSSEMACPPKPLSKSSNVRAKVGENVTVSCVFEA-SSVDEIFWYKNGYPLSS 352          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A3P8EXC8 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3162 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.570e-35
Identity = 108/403 (26.80%), Postives = 187/403 (46.40%), Query Frame = 2
Query:   65 RKRLQIRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY----------QHSTLGXXXXXXXXXXXXHFQ-------------SALCHSPRSMHNAILLRSISI----PIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSN-SRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWSSNNDKQ 1189
            +    +RGC   +  +  + + +IC+ P T+   IP  L   +++L + +Q++T L + +F H+  L  L L+S  +  I    F  L  L  L+L  N L+I  +++   ++   LIGL  L+L  N +  +PK  F  +  SL+ L++S     F + P +L  L  L+ LD+S+N+L  L   FES    M  L+ L L+GNPW+CDC +RWL  W+          +    G       PS+   +                 C SP ++    L    ++    P+++ +F C P+ L+ N    +  G N +L C F + D    + W  NGTL++   +R  + ++  +  ++ LT+       +G + C++      + T FSV      N+D Q
Sbjct:   95 KAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTFHVLKHLQTLSLRFN-LLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTMLQLLDLSYNHLESLPESFESTLHHM-QLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFFA-DPTGIVVWYRNGTLIQQRWARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSV----QVNSDDQ 490          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183A877 (Ig-like domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.688e-35
Identity = 108/403 (26.80%), Postives = 187/403 (46.40%), Query Frame = 2
Query:   65 RKRLQIRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY----------QHSTLGXXXXXXXXXXXXHFQ-------------SALCHSPRSMHNAILLRSISI----PIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSN-SRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWSSNNDKQ 1189
            +    +RGC   +  +  + + +IC+ P T+   IP  L   +++L + +Q++T L + +F H+  L  L L+S  +  I    F  L  L  L+L  N L+I  +++   ++   LIGL  L+L  N +  +PK  F  +  SL+ L++S     F + P +L  L  L+ LD+S+N+L  L   FES    M  L+ L L+GNPW+CDC +RWL  W+          +    G       PS+   +                 C SP ++    L    ++    P+++ +F C P+ L+ N    +  G N +L C F + D    + W  NGTL++   +R  + ++  +  ++ LT+       +G + C++      + T FSV      N+D Q
Sbjct:   95 KAAFSVRGCVTYVAGEDYSMRQSICDKPDTHFTTIPAALPSQVVKLTVNHQDITELNSTQFKHLPNLTYLDLDSNKIVRIHPNTFHVLKHLQTLSLRFN-LLIFSVDSFHPDVTHGLIGLENLNLLQNPMGYVPKRIFAPIGSSLRSLVLSGGSEDFQLDPGALDGLTMLQLLDLSYNHLESLPESFESTLHHM-QLKELYLYGNPWRCDCNLRWLKVWFLKYNSKLIYSRPVPEGVNRNLLDPSAQRWYDYNYDGTGDGPSLLQPRCASPYALFGRPLFSHQTLAGLQPVRTTDFHCLPQALTANQPVQLTLGSNATLTCEFFA-DPTGIVVWYRNGTLIQQRWARMSMHQTTGRTFQAELTVQDVQPSDAGTYVCFLDTGHGRVNTTFSV----QVNSDDQ 490          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5J4NSQ5 (Ig-like domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006736 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.728e-35
Identity = 113/375 (30.13%), Postives = 179/375 (47.73%), Query Frame = 2
Query:   62 IRKRLQIRGCTVMLKSDQSNFK--VAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRY-LEKSLKVLIISNSKS-PFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSAL----CHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDT-KRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVL 1159
            IR    ++GC +     Q NFK   AIC+  ST   +IP +L VNL+ L +  + +  L  +    +  LE+L + SCGV  + T A + LS L  L+L NNSL +   N L  E+   L  L +L+L+ N I +IP  FF   +   +  L + ++KS    I PD+ S + RL  LD+S + L  L    E     M+ L  L L GN W CDCK+RWL  W++H +  +           H +  L    C +P  M +  +       +   +F C P+ L++  +  V  G++V   C F + D  TR+ W  N  ++++ SR  +I   T + + + L +    +  S  W C +   ++ I   F+V 
Sbjct:   28 IRYVEAVQGCNIFF---QENFKWKRAICDSESTGQIQIPLELPVNLVDLSVKLRLIPLLTNSGLLPLIHLEILQIESCGVVRVETNALQSLSNLRHLSLRNNSLHL-GYNGLPKEVLNSLPNLRVLNLAENPIDLIPDSFFALTMGSQIHTLWLGSTKSSAMHIEPDAFSHMPRLRLLDLSFSKLTNLPPNMEQSLRNMVELSELYLGGNLWHCDCKLRWLRVWFRHHS-SNRIQYIQKHLDLHGKKLLTEPTCFTPDMMRDRPIFGE---QVTEEDFKCVPRMLTEGRNVTVIAGKSVRFSCEFYA-DPVTRVLWYRNNEMIQNTSRTSMIMHRTGETYLATLHVASDEVADSERWSCLLEGHESWINATFTVF 393          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4.2 (leucine rich repeat containing 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-7997])

HSP 1 Score: 85.5001 bits (210), Expect = 6.488e-17
Identity = 98/403 (24.32%), Postives = 154/403 (38.21%), Query Frame = 2
Query:  122 FKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHIS------------------------TTAFEHLSQLVILTLSNN--------------SLVIHDINNLQS----------------------------EIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPC-FPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNS---RNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            F   +C   S  L R+P  +  N   L +M  ++  ++A+ F H++ LE+L L    +R I                         + AFE+LS+L  L L NN              SL+  D+  L+                              +  PL+GL  L++S N+   I    FR L KSLK L I NS+   ++  ++  D+  L  L+++HNNL  L      +F+ +  L  L LH NPW+CDC + WL +W +                +      CH+P  +    L+      +    F C  P  L    D  +       L C    +     ++W   NGT+L   S   R YV+   T    +VL         +G++ C +
Sbjct:   50 FSKVVCTRRS--LVRVPSGIPANTRHLNLMENSIEIIQADTFRHLHHLEVLQLGRNSIRKIEVGAFNGLTNLNTLELFDNRLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLYNLKYLNLGMCNLREMPVLSPLVGLEELEMSENYFPEIKPGSFRGL-KSLKKLWIMNSRI-TTMERNAFDDVTALVELNLAHNNLSSLP---HDLFAPLSYLVELHLHHNPWRCDCDVVWLAWWLRE-----------YIPTNSTCCGRCHTPAHLRGRYLVE-----VDQTTFQCSAPFILDAPRDLNISAERVAELKCRTAPMSS---VRWLLPNGTVLTHGSNHPRIYVLNDGTLNFSNVLA------SDTGVYTCMV 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4bb (leucine rich repeat containing 4Bb [Source:ZFIN;Acc:ZDB-GENE-091116-44])

HSP 1 Score: 80.8777 bits (198), Expect = 1.805e-15
Identity = 85/372 (22.85%), Postives = 148/372 (39.78%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSL------------------------------VIHDINNLQ--------------SEIFQPLIGLTLLDLSFNFIQMIPKHF----FRYLEKSLKVLIISNSKSPFS-ISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
             L+ +P+ +SVN   L +   ++  ++++ F H+  LE+L L+   +R I   AF  L  L+ L L +N L                                H + +L+                 F+ L+ L  L+L    ++ +P          LE S   L +     P S I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P         R I   +   +F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   +    I   +  H   L   + T++ +G + C +
Sbjct:   58 GLDEVPQSISVNTRYLNLQENSIQLIKSDTFKHLSHLEILQLSKNHIRQIEVGAFNGLPNLITLELFDNRLPLVPSQAFEYLSKLRELWLRNNPIETLPAYAFHRVPSLRRLDLGELRKLSFISEAAFEGLVNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGLVAQSLPLSLIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLQQLERVHLNHNPWVCNCDVLWLSWWLKETVPDNSTC-----------CARCHAPPGTKG----RYIG-DLDQRDFTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWLTPNGTLMTHGAYKVRI---SVLHDGTLNFTNVTMQDTGPYTCMV 405          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: slit3 (slit guidance ligand 3 [Source:NCBI gene;Acc:103037708])

HSP 1 Score: 81.2629 bits (199), Expect = 2.042e-15
Identity = 75/240 (31.25%), Postives = 109/240 (45.42%), Query Frame = 2
Query:  167 IPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNN--LIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIP-IKSHEFPC 877
            +P+ +  N  RL++   N+T +   +FS +  L +L L +  +  I   AF+ L QL  L L+ N L +     L   +FQ    L  LDLS N IQ IP+  FR +     + + SN  S   I   +   L  LE L +++NN  LI L S     F+ M  L+ L LH N   CDC + WL  W +               L+HF    C SP  M      R +S+P ++  +F C
Sbjct:   54 VPRGIPRNAERLDVDRNNITRITKVDFSGLKNLRVLHLENNQISVIERGAFQDLKQLERLRLNRNRLQV-----LPELLFQSTPKLGRLDLSENQIQAIPRKSFRGITNVKNLQLDSNHIS--CIEDGAFRALRDLEILTLNNNNITLIPLSS-----FNHMPKLRTLRLHSNNLHCDCHLSWLSDWLRQRK-----------GLAHFTQ--CMSPAHM------RGLSVPDVQKRDFVC 262          

HSP 2 Score: 58.151 bits (139), Expect = 3.216e-8
Identity = 43/134 (32.09%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  326 LSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQ 727
            L QL ++ LSNNS     I++L   IF  +  L+ L LS+N I+ +P H F  L +SL++L +                          H N   L +  E  F+ + SL +L L  NP  CDC++RWL  W +
Sbjct:  775 LKQLSLVDLSNNS-----ISSLTPFIFSNMTQLSTLILSYNQIRCVPVHAFDGL-RSLRLLTL--------------------------HGN--DLSTIPEGAFNHLTSLSHLALGANPLYCDCELRWLSQWVK 874          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4bb (leucine rich repeat containing 4Bb [Source:ZFIN;Acc:ZDB-GENE-091116-44])

HSP 1 Score: 80.4925 bits (197), Expect = 2.510e-15
Identity = 84/374 (22.46%), Postives = 149/374 (39.84%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSL------------------------------VIHDINNLQ--------------SEIFQPLIGLTLLDLSFNFIQMIPK--HFFRYLE-----KSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
             L+ +P+ +SVN   L +   ++  ++++ F H+  LE+L L+   +R I   AF  L  L+ L L +N L                                H + +L+                 F+ L+ L  L+L    ++ +P      R  E       L V +++ S     I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P         R I   +   +F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   +    I   +  H   L   + T++ +G + C +
Sbjct:   58 GLDEVPQSISVNTRYLNLQENSIQLIKSDTFKHLSHLEILQLSKNHIRQIEVGAFNGLPNLITLELFDNRLPLVPSQAFEYLSKLRELWLRNNPIETLPAYAFHRVPSLRRLDLGELRKLSFISEAAFEGLVNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGVELVAQSLPLSLIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLQQLERVHLNHNPWVCNCDVLWLSWWLKETVPDNSTC-----------CARCHAPPGTKG----RYIG-DLDQRDFTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWLTPNGTLMTHGAYKVRI---SVLHDGTLNFTNVTMQDTGPYTCMV 407          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: lrrc4bb (leucine rich repeat containing 4Bb [Source:ZFIN;Acc:ZDB-GENE-091116-44])

HSP 1 Score: 80.4925 bits (197), Expect = 2.653e-15
Identity = 85/372 (22.85%), Postives = 148/372 (39.78%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSL------------------------------VIHDINNLQ--------------SEIFQPLIGLTLLDLSFNFIQMIPKHF----FRYLEKSLKVLIISNSKSPFS-ISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
             L+ +P+ +SVN   L +   ++  ++++ F H+  LE+L L+   +R I   AF  L  L+ L L +N L                                H + +L+                 F+ L+ L  L+L    ++ +P          LE S   L +     P S I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P         R I   +   +F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   +    I   +  H   L   + T++ +G + C +
Sbjct:   58 GLDEVPQSISVNTRYLNLQENSIQLIKSDTFKHLSHLEILQLSKNHIRQIEVGAFNGLPNLITLELFDNRLPLVPSQAFEYLSKLRELWLRNNPIETLPAYAFHRVPSLRRLDLGELRKLSFISEAAFEGLVNLRFLNLGMCGLKDVPNLTPLVRLEELELSGNQLGLVAQSLPLSLIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLQQLERVHLNHNPWVCNCDVLWLSWWLKETVPDNSTC-----------CARCHAPPGTKG----RYIGD-LDQRDFTCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWLTPNGTLMTHGAYKVRI---SVLHDGTLNFTNVTMQDTGPYTCMV 405          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.303e-14
Identity = 58/174 (33.33%), Postives = 87/174 (50.00%), Query Frame = 2
Query:  200 LEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            L+M   N+TSL A  F H   L +L L    ++ IS  AF  L  L  L L NN      I  +     Q L  L +L L+ N I+ +    F+ L  +L+ L  SN+     ++ D+ +  ++L +L IS N +  +++     FS +  LQ + LHGNP+ CDCK+  LV W
Sbjct:  160 LDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNK-----ITTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLT-NLRELYFSNNMVSV-LTKDAFNSNIKLTQLTISDNKIKVIEA---GTFSTLSGLQMIYLHGNPYHCDCKLNPLVQW 323          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 74.7146 bits (182), Expect = 2.741e-14
Identity = 80/300 (26.67%), Postives = 135/300 (45.00%), Query Frame = 2
Query:  230 LEANEFSHIYQLELLTLNS-CGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISI-PIKSHEFPCFPKCLS-KNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            + A  F+ I  L+ L L     ++ IS  AFE LS L  L L   +L        +     PL+ L  L+LS N I+++    F+ L  +L+ L I +S+    +  ++  +L  L+ L+++HN+L+ L      +FS +  L+ + LH NPW CDC I WL +W + +   +               A C  P         ++I++  + S  F C+P  +    SD  + EG    L C   S    + + W + NGT +   S  Y I+     H   L   + T++ +G++ C +
Sbjct:  118 ISAYTFTRIPSLQRLDLGELTKLQFISNEAFEGLSNLRYLNLGMCNL-------REVPKLSPLVRLEELELSGNRIEILRPGSFQGL-ANLRKLWIMHSEVRL-VERNAFDELQSLKELNLAHNSLMSLP---HDLFSPLQKLERVHLHHNPWTCDCDILWLSWWLRENVPNNATC-----------CARCALPADR------KAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRCRAPS--SASSVTWITPNGTSMTHGS--YKIRISVL-HDGTLNFTNVTVQDTGIYTCLV 383          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 70.4774 bits (171), Expect = 5.900e-13
Identity = 58/214 (27.10%), Postives = 102/214 (47.66%), Query Frame = 2
Query:  104 KSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPF----------------------SISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGN 679
            KS + + K+  C   S  L+ +P+++S   + L + Y +L  L  N+F+   QL  L L+   V  +   AF+ + +L  L LS+N      I+NL +  F+P+  L  LDLS+N +Q++    FR L K   + + SN+                          S++ ++ + L RL  L + HN   +++      F +++SL++L L GN
Sbjct:   39 KSCKCDVKIVYCE--SLGLKGLPRNISAGTLGLSLRYNSLQELNYNQFASFRQLTWLYLDHNYVHTVDAHAFQGIRRLKELILSSNR-----ISNLANGTFRPISNLRNLDLSYNQLQILDPDLFRGLRKLQSLHLRSNTIKTMPVRIFQDCRNLEFLDLGYNRLRSLARNAFAGLTRLTELHMEHNQFSKVNFAH---FPRLMSLRHLYLQGN 242          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: LRRTM4 (leucine rich repeat transmembrane neuronal 4 [Source:HGNC Symbol;Acc:HGNC:19411])

HSP 1 Score: 66.2402 bits (160), Expect = 1.168e-11
Identity = 57/199 (28.64%), Postives = 93/199 (46.73%), Query Frame = 2
Query:  149 STNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEK------------SLKVLIISNSKSP----------FSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGN 679
            S  L  IP +++   + L + Y +L SL  N FS + QL  L L+   ++ ++  AF    +L  LTLS+N L+      L +  F PL+ +  LD+SFN +QM+    FR L K            ++ V I  + +S             ++ ++ + L RL  L + HN   +L+      F ++ISL+ L L  N
Sbjct:   47 SMALREIPMNITTGSLGLSLRYNSLKSLPENHFSGLKQLTWLYLDHNHIQLVAEGAFVGARRLKELTLSSNKLI-----RLPNATFHPLVNMRSLDISFNQLQMLEAGQFRGLRKLQYLHMRSNQLRTVPVRIFQDCRSIELLDLGYNRLRVLARNAFTGLGRLTELHLEHNQFAKLNLAH---FPRLISLRTLYLQWN 237          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004387.1 (pep scaffold:Pmarinus_7.0:GL476584:2351:182737:1 gene:ENSPMAG00000004005.1 transcript:ENSPMAT00000004387.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 6.277e-11
Identity = 53/178 (29.78%), Postives = 80/178 (44.94%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKC 691
            L  +P  +      L +    +T LE   F  +  L  L L +  +  +    F+ L+QL  L LS N L       L + +F  L+ L  L L+ N ++ +PK  F  L  +LK L + N++   +I P     L +L  LD+  N   QL S    +F K+  L  L L+ NPW C
Sbjct:   15 LASVPAGIPTTTHYLNLNSNQITKLEPGVFDRLTALVKLYLYTNQLSALPVRMFDKLTQLTTLNLSENKLTA-----LPAGVFDRLVNLQRLYLNQNQLKSVPKRVFDRLV-NLKNLRLDNNQLQ-AIPPTLFDRLTQLTHLDLDRN---QLKSLPPGIFDKLEKLTRLELYNNPWDC 182          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO27257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9R6])

HSP 1 Score: 56.6102 bits (135), Expect = 3.594e-9
Identity = 47/168 (27.98%), Postives = 87/168 (51.79%), Query Frame = 2
Query:  230 LEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHS 733
            +E   F+ +  L  L +++ G++ I+   F  L  L  L +S N     +I +   E    L  L +L ++ N +  +P H  R + K LK L +S +   + +S  + ++  +L++L + HNN I+L    E  FS++  L+ L L GNP++CDC++     W +++
Sbjct:    1 IEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVSFN-----EIRHFDEESLACLPLLEVLHINNNSLTTVPLHALRKV-KFLKELDLSANLISY-VSSTAFANNSKLQKL-LLHNNTIRL--IHEDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNN 158          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 58.151 bits (139), Expect = 1.125e-8
Identity = 81/338 (23.96%), Postives = 132/338 (39.05%), Query Frame = 2
Query:  191 LIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNN--SLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPC-----FPKCLSKNSDFFVGEGENVSLPCSFQSLDQYT---RIKWSHNGTLLKSNSRNYVIKSDTK---RHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFR 1165
            L +L +    L+ ++   F H+  L++L L +  + HIS  +F  L  L  L LSNN  S  + ++N      F+ L  L  L L  N I  I    F  LE                           ++ L++S N +  +    E+ F  M  LQ L L+ +   CDCKI+W   W +           S  S  H   A C  P++++    ++S+   I    F C      P+            G+NV+L C  Q + + +   R++W     ++        +++D      + S L LI      +GL++C      N  G+ FS   R
Sbjct:  348 LRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNG----PFRGLTNLASLRLDGNRITAIAATAFLGLEN--------------------------IKYLNLSANIITSIQ---ENSFQGMDKLQKLWLNTSQLMCDCKIKWFGSWLR-----------SRPSTRHTVRARCLHPQTLY----MKSV-FNITPDAFVCDTSNPIPQISVHPPSQKAMRGDNVTLRCRVQVVQRNSSSVRLQWRLGYEVISERDITDFVRTDDDDIVTYNSDLFLISVDFSDAGLYQC---IASNKYGSQFSKKAR 633          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 52.7582 bits (125), Expect = 1.783e-7
Identity = 53/189 (28.04%), Postives = 94/189 (49.74%), Query Frame = 2
Query:  185 VNLIRLEMMYQNLTSLEANEFSHIYQLELLTLN---SCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLD---LSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHS 733
            V+L +L++ + +L +L    F  +  L  L L+   + G R I   AF  L  L  L +S   +       +    F  L+ L  LD   ++ N +  +P H  R + K LK L +S +   + +S  + ++  +L++L + HNN I+L    E  FS++  L+ L L GNP++CDC++     W +++
Sbjct:   66 VSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSR-IEEGAFNGLDNLRKLHVSATGM-----KKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKV-KFLKELDLSANLISY-VSSTAFANNSKLQKL-LLHNNTIRL--IHEDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNN 243          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 53.5286 bits (127), Expect = 2.048e-7
Identity = 59/220 (26.82%), Postives = 95/220 (43.18%), Query Frame = 2
Query:  173 KDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSL------VIHDINN------LQSEIFQPLI-----GLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSK-----SPFS------------------ISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWL 712
            K L++N  RLE++Y       A  F  +  L  L+L    +R I   AF   + L+ L +S N L       +  +++      L+S I + +       +TLLDL  N +++     F  L  SL+ L +  +K       F+                  I+ D L DL  +ERLD++ NN+ ++          M  L+ + L GNP  CDC++ WL
Sbjct:  123 KTLTLNSNRLEVVY-------AETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGL--SLRKLRLDGNKLDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHAIERLDLNENNISKIRI---GALRGMKKLRQISLSGNPLSCDCRLVWL 330          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: mxra5a (matrix remodeling associated 5 [Source:NCBI gene;Acc:101169838])

HSP 1 Score: 86.6557 bits (213), Expect = 5.154e-17
Identity = 71/234 (30.34%), Postives = 102/234 (43.59%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDS--------LSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAIL 832
            +L  +P  L V L R+ + +  L+ +       + QLELL L+   +R +S  AF  L  L +L +S N L       L+    Q L  L  L L  N ++ I    F+ L  SLK+L +  ++    + PD+        L  +  L  L +S N L  L +    +   M  L+NL LHGNPW CDC +RW   W   ST             S     +C SPR +H   L
Sbjct:   99 SLLSVPGGLPVELRRINLGFNRLSGIPDGSVGGLRQLELLMLHGNNIRSVSDGAFRDLGALQMLKMSYNEL-----QELRRNTLQGLRSLARLHLDHNRLEFIHPQAFQGL-TSLKLLQLEANRLQ-QLHPDTFCTFTARGLLHVSTLRHLYLSENGLRSLPA---RLLDTMPQLENLYLHGNPWTCDCSMRWFQDW--KSTFPGILKCKKVPPSSRL-CPICSSPRHLHGTEL 319          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 78.5666 bits (192), Expect = 9.908e-15
Identity = 78/274 (28.47%), Postives = 125/274 (45.62%), Query Frame = 2
Query:  302 ISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            IS  AFE L  L  L L    L   DI NL      PL+ L  L+LS N + ++    F+ L  SL+ L + +S+    I  ++  +L  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P  +      + I    +SH FPC+ P  +   +D  V EG    L C  ++    T + W + NGTL+   S    I   +  H   L   + T++ +G + C +
Sbjct:  180 ISEAAFEGLVNLRFLNLGMCGL--KDIPNLT-----PLVKLEELELSGNQLGIVRPGSFQGL-VSLRKLWLMHSRVSV-IERNAFDELKSLEELNLSHNSLHSLP---HDLFTPLHQLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTC-----------CARCHAPPGLKG----KYIGELDQSH-FPCYAPVIVEPPTDLNVTEGMAAELKC--RTGTSMTSVNWFTPNGTLMTHGSYRVRI---SVLHDGTLNFTNVTVQDTGQYTCMV 420          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: lrrc4ba (leucine rich repeat containing 4B [Source:NCBI gene;Acc:101164310])

HSP 1 Score: 76.2554 bits (186), Expect = 5.005e-14
Identity = 92/389 (23.65%), Postives = 154/389 (39.59%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAF------------------------EHLSQLVILTLSNN--------------SLVIHDINNLQS------EIFQPLIGLTLLDLSFNFIQMIPK----------------------HFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCF-PKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKW-SHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            NLE++P+ +SVN   L +   ++  ++++ F H+  LE+L L+   +R I   AF                        E+LS+L  L L NN              SL   D+  L+         F  L+ L  L+L    ++ IPK                        F+ L    K+ ++ +  S   I  ++  DL  LE L++SHN+L  L      +F+ +  L+ + L+ NPW C+C + WL +W + +   +               A CH+P      IL       +    F C+ P  +   +D  V EG    L C  ++    T + W + NGTL+   S    I   +  H   L   + T++ +G + C +
Sbjct:   59 NLEQVPESISVNTRYLNLQENSIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTQVPSYAFEYLSKLRELWLRNNPIEDLPGYAFNRVPSLRRLDLGELKKLDFISDAAFVGLVNLRYLNLGMCGLKDIPKLTALERLEELELSGNRLEIIRPGSFQGLGALRKLWLMHSQVS--VIERNAFDDLKNLEELNLSHNSLHSLP---HDLFTPLHQLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTC-----------CARCHAP-----PILKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKC--RTSTSTTSVNWITPNGTLMTHGSYRVRI---SVLHDGTLNFTNVTLRDTGQYTCMV 421          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000072.2 (pep primary_assembly:ASM223467v1:1:1576629:1604541:-1 gene:ENSORLG00000000055.2 transcript:ENSORLT00000000072.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 1.041e-13
Identity = 58/197 (29.44%), Postives = 93/197 (47.21%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW-YQHSTLG 742
             ++ +PK++     RL++   NLT +  ++ S +  L +L L    + +I   AF+ L +L  L L+ N L     + L   +FQ    L+ LDLS N IQ +P+  FR       + +  N  S   +   +   L  LE L +++NN+  +     S F+ M  L+   LH N  +CDC + WL  W  Q   LG
Sbjct:   62 GIQSVPKNIPRGTERLDLNGNNLTVITKSDLSGLRHLRVLHLMENQISNIERGAFDELKELERLRLNRNRL-----SQLPELLFQKNEALSRLDLSENRIQAVPRRAFRGAADLKNLQLDKNHIS--CVEEGAFRALRSLEVLTLNNNNISSIPV---SSFNHMPKLRTFRLHSNSLRCDCHLAWLSPWLRQRPALG 248          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: slit1a (slit guidance ligand 1 [Source:NCBI gene;Acc:101164917])

HSP 1 Score: 75.485 bits (184), Expect = 1.545e-13
Identity = 59/197 (29.95%), Postives = 94/197 (47.72%), Query Frame = 2
Query:  155 NLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWY-QHSTLG 742
             L+ +P+++  N  RLE+   NLT +  ++F+ +  + +L L    +  +   AF+ + +L  L L+ N L       L   +FQ    L+ LDLS NFIQ IP+  FR       + +  N  S   I   +   +  LE L +++NN+  +     S F+ M  L+   LH N   CDC + WL  W  Q  T+G
Sbjct:   53 GLKTMPRNIPRNTERLELNGNNLTRITKSDFTGLKYVRVLQLMENQITVVERGAFDDMKELERLRLNRNQL-----QQLPELLFQKNPALSRLDLSENFIQSIPRKAFRGATDIKNLQLDKNHIS--CIEDGAFRAMRGLEVLTLNNNNISSIPV---SSFNHMPKLRTFRLHSNNLNCDCHLAWLAQWLRQRPTIG 239          

HSP 2 Score: 53.1434 bits (126), Expect = 8.938e-7
Identity = 50/188 (26.60%), Postives = 82/188 (43.62%), Query Frame = 2
Query:  158 LERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW 721
            L +IP+ +  +   L +    +TSL+AN                        AF++L+QL  + LSNN      I  ++   F+    +  L L+ N I  +    FR LE  L++L++ N+K    +  DS + L  +  L +  N   QL +     F  + +L  L L  N + CDC++ WL  W
Sbjct:  533 LTKIPEHIPSSTSELRLNNNEITSLDAN-----------------------GAFKNLAQLKKINLSNNK-----ITEIEDGTFEGASAVIELHLTANQIDSVRSGMFRGLE-GLRMLMLRNNKI-SCVHNDSFTGLHNVRLLSLYDN---QLTTITPGAFDTLQTLSTLNLLANSFNCDCRLAWLGDW 687          

HSP 3 Score: 52.373 bits (124), Expect = 1.736e-6
Identity = 58/229 (25.33%), Postives = 99/229 (43.23%), Query Frame = 2
Query:  200 LEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPK 886
            ++   + LT++ AN   ++ ++ L      G++ +   AF    +L  + LSNN      I+ +  + FQ L  L  L L  N I  +PK  F  L     +L+ +N      I  ++  DL  L  L +  N +  L    +  F+ + ++Q L L  NP+ CDC ++WL  + + + +                 A C SPR + N  + +     IKS +F C  K
Sbjct:  295 VDCRGKGLTAIPANLPDNMAEIRL---EQNGIKSVPPGAFSSYKKLRRIDLSNNQ-----ISEIAPDAFQGLRSLNSLVLYGNKITDLPKGVFDGLYALQLLLLNANKI--HCIRANTFQDLQNLSLLSLYDNKIQTL---AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADYLRSNPI-------------ETSGARCASPRRLANKRIGQ-----IKSKKFRCSAK 492          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000075643.1 (SMESG000075643.1)

HSP 1 Score: 1089.72 bits (2817), Expect = 0.000e+0
Identity = 570/572 (99.65%), Postives = 571/572 (99.83%), Query Frame = 2
Query:   80 IRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWSSNNDKQYHFKGSFNMSTTKTIAXXXXXXXXXXXXXXXXXXXXYRYFYRFKPQKGVVVNQKYSVKSSEISRDRHNLIYNRLRENQNWNGESFEFWNLRSSDIDDDKTFSNSTVLKNPTILTSLSTDGFIVPCVSNDTSLTDSHIFVNPYIEAPATLITRTPSMTPCPIHEQFSSLDSSKPNSLNNSIYHPCPLHGDMLSVILQSPTPLS 1795
            +RGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDS FESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGSFPAESSPSSLSHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWSSNNDKQYHFKGSFNMSTTKTIALTLLGSITLLFILSLLVGLVYRYFYRFKPQKGVVVNQKYSVKSSEISRDRHNLIYNRLRENQNWNGESFEFWNLRSSDIDDDKTFSNSTVLKNPTILTSLSTDGFIVPCVSNDTSLTDSHIFVNPYIEAPATLITRTPSMTPCPIHEQFSSLDSSKPNSLNNSIYHPCPLHGDMLSVILQSPTPLS
Sbjct:   27 VRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSGFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGSFPAESSPSSLSHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWSSNNDKQYHFKGSFNMSTTKTIALTLLGSITLLFILSLLVGLVYRYFYRFKPQKGVVVNQKYSVKSSEISRDRHNLIYNRLRENQNWNGESFEFWNLRSSDIDDDKTFSNSTVLKNPTILTSLSTDGFIVPCVSNDTSLTDSHIFVNPYIEAPATLITRTPSMTPCPIHEQFSSLDSSKPNSLNNSIYHPCPLHGDMLSVILQSPTPLS 598          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000051096.1 (SMESG000051096.1)

HSP 1 Score: 197.978 bits (502), Expect = 3.515e-54
Identity = 116/368 (31.52%), Postives = 205/368 (55.71%), Query Frame = 2
Query:   62 IRKRLQIRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSE--IFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTL--LKSNSRNYVIKSDTKRHR-SVLTLIHFTIKLSGLWRCYILFDDNIIGTNF 1150
            ++    ++GCTV+L+S QS+ K A+CN P   L+ IP DL   L+ LE+ +Q+L ++   EF H+ +LE L++ S  V+ I   AF  LS L  L+L NNSL+I   N++     IF PL+ LT +DLS+N I  IP  FF ++ ++L+ L +S+SK+   +S +SL  +  L+ + + ++ +  +    E  F+ M  L+ +IL GN W CDC++RW + W   +               + +   C +P  + N  +       I S +F C P+ ++ NS   +  G+N+SL   F+++D+   I W + G +  +K N + ++I   + ++R S+LT+++ +    G+W+C++ F++  IG  +
Sbjct:   17 VKPCFSVKGCTVILRSQQSSLKKAVCNMPEQILKSIPTDLPEALVELEISFQDLQTIYNKEFIHLPKLEYLSIVSSNVQTIQEGAFIQLSNLKSLSLFNNSLIISTGNSMSMSKYIFFPLLSLTKVDLSYNSIGNIPDFFFNHVNQTLESLHLSHSKTEIILSGNSLMYMTNLKSIHLEYSQMTSISRDVEESFNIMSKLKEIILIGNLWNCDCQLRWFLLWIIKNN------NFRNQIKINRKGFSCTNPPEIRNYDIFGRDLNKILSMKFQCIPEPITSNSTVSIYAGQNISLTSIFRNVDEKQNIFWENKGNIFSMKINYKRFIITEISGKYRKSILTILNVSKLEEGIWKCFVDFENKQIGIEY 378          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 145.591 bits (366), Expect = 4.101e-36
Identity = 110/368 (29.89%), Postives = 180/368 (48.91%), Query Frame = 2
Query:   80 IRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW-YQHSTLGXXXXXXXXXXXXHFQSALCHSPRSM--HNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSN-SRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTNFSVLFRWS 1171
            + GC  ++ +++   K  IC+   T   RIP DL   +  LE+  QN+ SL A++   +  LE L L+S  +  I   AF ++ +L  L+L +N L++   N+  S     L  L +LDL  N +  +P  FF+ L K L  LI+S + + F + P+SL  L  LE LDIS ++L  LD    S  + M  L +    GN W CDC ++WL  W  +H  +  F   S  +  S      C SP     +N     +    IK  +  C PK  +KN    + +G+N++L C F++ D    ++WS NG  ++ +  +    ++   R  + L++    ++ +GLWRC ++ D       +S+  R S
Sbjct:   27 VVGCVTIMIAEKR--KQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGG-NSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPL-KFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNM-QLTDFYFFGNQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEA-DPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS 388          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.008e-30
Identity = 97/362 (26.80%), Postives = 176/362 (48.62%), Query Frame = 2
Query:   59 KIRKRLQIRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQH------STLGXXXXXXXXXXXXHFQSALCHS--PRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVI-KSDTKRHRSVLTLIHFTIKLSGLWRCYI 1117
            +++  L ++GC  ++K   S +K++IC +   N  RIP+     +  + +  QNL+ +++ +  ++  L  LTLNS  +  +S  AF H+ QL+ L LS N + + + N++ S     L  L  LDLS N +  +P ++F+ L K L++L +S +   F I  + L  L  L+ LD+++N+   L     S+  K + L    L  NPW CDC ++WL  W+          L      +    +   Q   C S  P S  N     + +  I  ++  C P+  +++  + + +  N++  C F +    T + WS NG +++++ R     +S   + ++ LTL +     SG WRC +
Sbjct:   23 QVQFGLSVQGCITIMKD--SKYKMSICTNYKANFTRIPERFPDQVAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLGE-NSMPSSSLIYLKKLHTLDLSENPLGFVPDYYFQLL-KQLRILNLSTANKGFYIETNGLYGLTNLQVLDLTNNHFTTLSEGL-SISLKAMQLNEFYLFNNPWNCDCNLQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPK-CESPFPLSERNIFSDSTNTDSIGINDLKCAPRIFTQDRVYEMTKDHNITFTCEFHANPGGT-VTWSKNGMIVQNHWRRVSWNRSQGIKFKAWLTLQNVEENDSGNWRCIL 377          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000006503.1 (SMESG000006503.1)

HSP 1 Score: 126.331 bits (316), Expect = 4.712e-30
Identity = 112/375 (29.87%), Postives = 184/375 (49.07%), Query Frame = 2
Query:  128 VAICND----PSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDCKIRWLVFW---------YQHSTLGXXXXXXXXXXXXHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSN-SRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIG---TNFSVLFRWSSNNDKQYHFK 1201
            V I ND    P +N   I KD+++    L++   N+  L  +       L  LTL+S  +  I+  AF++ S+L  L+L NN+L+I + N   S +F+ LI L  LDLS N I +IP+ FF  L ++L+ L +        I   + S+L  L+ L ++ NN + L +  E  F +M  L+ L+LH NPW CDC++RW   W         Y +ST+         + L +    LC +P  +    L     +P+   +F C PK L       V   ENV+L C F+S  + + +KW  NG L++ +  R  + +S  + + + LT+  F+ K      CY+    N +G   +N++++ +  S+ D    +K
Sbjct:   29 VCIENDLITFPKSNF--INKDIAI----LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISN-NTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEM-QLETLLLHDNPWACDCRMRWFKRWLITLNQNNDYLYSTI--------ENILLNIHPMLCETPDYLQRKKL---CDLPLS--KFECKPKTLRLGKTLVVKHLENVTLSCQFESFPK-SYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTI--FSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYK 378          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLIT11.671e-1632.16slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT12.258e-1632.32slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
IGSF102.852e-1632.14immunoglobulin superfamily member 10 [Source:HGNC ... [more]
LRRC44.686e-1624.25leucine rich repeat containing 4 [Source:HGNC Symb... [more]
LRRC4B7.162e-1627.81leucine rich repeat containing 4B [Source:HGNC Sym... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slt-14.454e-1129.17Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
pxn-11.542e-1029.90Peroxidasin homolog [Source:UniProtKB/Swiss-Prot;... [more]
lron-99.835e-1026.97ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-99.835e-1026.97ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-91.363e-926.97ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kek28.432e-1426.17gene:FBgn0015400 transcript:FBtr0080252[more]
sli1.207e-1228.87gene:FBgn0264089 transcript:FBtr0330733[more]
sli1.207e-1228.87gene:FBgn0264089 transcript:FBtr0330731[more]
sli1.240e-1228.87gene:FBgn0264089 transcript:FBtr0330734[more]
sli2.742e-1127.84gene:FBgn0264089 transcript:FBtr0330729[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igsf101.086e-1630.15immunoglobulin superfamily, member 10 [Source:ZFIN... [more]
lrrc4.22.624e-1526.74leucine rich repeat containing 4.2 [Source:ZFIN;Ac... [more]
slit36.956e-1532.12slit homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
lrrc4ba9.427e-1523.39leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba9.427e-1523.39leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps24.490e-1730.92ribosomal protein S2 [Source:Xenbase;Acc:XB-GENE-1... [more]
slit11.823e-1629.75slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.887e-1629.75slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.938e-1629.75slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
slit11.948e-1629.75slit guidance ligand 1 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Igsf102.439e-1732.66immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf102.439e-1732.66immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Igsf102.439e-1732.66immunoglobulin superfamily, member 10 [Source:MGI ... [more]
Slit12.489e-1732.32slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
Slit12.644e-1631.66slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6WRH9|IGS10_RAT4.019e-1831.79Immunoglobulin superfamily member 10 OS=Rattus nor... [more]
sp|Q3V1M1|IGS10_MOUSE1.706e-1632.66Immunoglobulin superfamily member 10 OS=Mus muscul... [more]
sp|Q80TR4|SLIT1_MOUSE1.741e-1632.32Slit homolog 1 protein OS=Mus musculus OX=10090 GN... [more]
sp|O88279|SLIT1_RAT9.447e-1628.31Slit homolog 1 protein OS=Rattus norvegicus OX=101... [more]
sp|O75093|SLIT1_HUMAN1.084e-1532.32Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EQX54.107e-3631.84Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J9I49.618e-3631.75Ig-like domain-containing protein OS=Schistocephal... [more]
A0A3P8EXC81.570e-3526.80Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A183A8771.688e-3526.80Ig-like domain-containing protein OS=Echinostoma c... [more]
A0A5J4NSQ51.728e-3530.13Ig-like domain-containing protein OS=Paragonimus w... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4.26.488e-1724.32leucine rich repeat containing 4.2 [Source:ZFIN;Ac... [more]
lrrc4bb1.805e-1522.85leucine rich repeat containing 4Bb [Source:ZFIN;Ac... [more]
slit32.042e-1531.25slit guidance ligand 3 [Source:NCBI gene;Acc:10303... [more]
lrrc4bb2.510e-1522.46leucine rich repeat containing 4Bb [Source:ZFIN;Ac... [more]
lrrc4bb2.653e-1522.85leucine rich repeat containing 4Bb [Source:ZFIN;Ac... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010345.11.303e-1433.33pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
lrrc4ba2.741e-1426.67leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
LRRTM45.900e-1327.10leucine rich repeat transmembrane neuronal 4 [Sour... [more]
LRRTM41.168e-1128.64leucine rich repeat transmembrane neuronal 4 [Sour... [more]
ENSPMAT00000004387.16.277e-1129.78pep scaffold:Pmarinus_7.0:GL476584:2351:182737:1 g... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO272573.594e-927.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481791.125e-823.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354071.783e-728.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471092.048e-726.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxra5a5.154e-1730.34matrix remodeling associated 5 [Source:NCBI gene;A... [more]
lrrc4bb9.908e-1528.47leucine-rich repeat-containing protein 4B [Source:... [more]
lrrc4ba5.005e-1423.65leucine rich repeat containing 4B [Source:NCBI gen... [more]
ENSORLT00000000072.21.041e-1329.44pep primary_assembly:ASM223467v1:1:1576629:1604541... [more]
slit1a1.545e-1329.95slit guidance ligand 1 [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075643.10.000e+099.65SMESG000075643.1[more]
SMESG000051096.13.515e-5431.52SMESG000051096.1[more]
SMESG000058478.14.101e-3629.89SMESG000058478.1[more]
SMESG000006317.11.008e-3026.80SMESG000006317.1[more]
SMESG000006503.14.712e-3029.87SMESG000006503.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013891 ID=SMED30013891|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2033bp
AAAGAGATTTCAAATTTGATTTTAAATAAATGTTTAGATTATGTTTGCGC
TCTAATGAAAAATTCGAAAACGTCTGCAAATCAGAGGATGCACAGTAATG
TTAAAAAGTGACCAGTCCAATTTTAAAGTCGCCATTTGCAACGATCCGAG
CACAAATCTAGAAAGGATTCCCAAGGATTTATCAGTGAATCTCATCCGAC
TAGAGATGATGTACCAAAATCTGACGAGTTTAGAGGCGAACGAATTCAGC
CACATTTATCAGCTTGAATTGTTGACATTAAATTCCTGCGGCGTTCGCCA
CATATCAACTACAGCGTTTGAACATCTTAGTCAGTTGGTCATTCTGACGC
TGTCAAACAATTCACTCGTTATCCACGACATTAACAATCTTCAATCGGAG
ATCTTTCAGCCTTTGATCGGTTTGACACTATTAGATTTATCCTTTAATTT
TATTCAGATGATTCCAAAACACTTTTTTAGATATTTAGAAAAATCTCTCA
AAGTTCTTATTATATCCAATTCAAAATCGCCGTTCTCAATCTCACCTGAC
AGTTTATCCGATCTCGTCCGCTTAGAAAGACTCGACATTTCACATAACAA
TCTCATTCAATTAGACTCATGTTTTGAAAGTGTTTTCAGCAAAATGATCT
CTCTTCAAAATCTTATTTTGCATGGAAATCCATGGAAATGCGATTGTAAA
ATTCGATGGCTTGTGTTTTGGTATCAACATAGTACACTAGGAAGTTTTCC
AGCTGAATCGTCACCATCGTCTTTATCACACTTCCAATCGGCTTTGTGCC
ATTCTCCTAGATCTATGCACAATGCCATTCTATTAAGATCGATATCAATT
CCAATTAAATCCCATGAATTTCCTTGTTTTCCAAAATGCTTGTCGAAAAA
CTCGGATTTCTTTGTCGGTGAGGGTGAAAATGTCAGTCTTCCTTGTTCCT
TTCAAAGTCTGGATCAGTACACGCGAATAAAATGGTCACACAATGGAACG
TTACTGAAATCTAATTCTCGAAATTATGTGATTAAGTCAGACACCAAACG
TCACAGATCGGTTTTGACTCTCATTCATTTCACGATAAAGCTATCAGGAT
TGTGGAGGTGCTACATCCTATTTGATGACAACATTATTGGAACGAACTTT
TCAGTTTTGTTTAGATGGTCATCAAATAATGACAAACAATACCATTTTAA
AGGTTCTTTCAATATGAGTACCACTAAAACGATAGCTCTAACTCTACTGG
GTAGCATTACCTTATTATTTATATTATCTCTATTAGTAGGATTAGTCTAT
CGTTACTTTTACCGTTTTAAACCTCAGAAAGGAGTAGTCGTGAACCAAAA
ATATTCAGTAAAATCTAGTGAGATTTCTAGAGACCGGCATAATTTAATTT
ATAATCGTCTTCGAGAAAATCAAAACTGGAACGGTGAAAGTTTTGAATTT
TGGAACTTGCGCTCATCAGATATTGACGATGACAAAACATTTTCGAATTC
AACTGTTTTAAAGAATCCTACCATTTTGACTTCTTTATCCACCGACGGGT
TTATCGTTCCTTGTGTTAGCAATGATACCAGTTTAACTGATTCACATATT
TTCGTTAATCCGTACATTGAAGCCCCTGCTACCTTGATAACAAGAACTCC
AAGCATGACTCCGTGTCCTATTCATGAGCAATTCTCAAGTCTTGATTCTT
CCAAACCTAATTCACTTAATAATTCCATATATCACCCTTGTCCATTACAC
GGTGACATGTTATCGGTCATCCTTCAATCTCCTACACCCTTATCTTGACT
GGATGTTTTACGGAAACTGTAATTTTTAAATATATCAACTTGGTCAGTGG
TCCTCTAGCAAAATACAATCTCGAAATTATTTCTGATTTAAATTTAAAAA
GAATTTATGTAAACAAATAAGAAATTTTAGAGGAACATTGATTTTTCTGT
GAATGCCACTAAAAATTAATTATGCATGACTGTTGGCCGTTTACTAGAAT
ATCGATTTGAACATTTTAGTCATAAAATAGTCG
back to top

protein sequence of SMED30013891-orf-1

>SMED30013891-orf-1 ID=SMED30013891-orf-1|Name=SMED30013891-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=567bp
MLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEF
SHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQS
EIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISP
DSLSDLVRLERLDISHNNLIQLDSCFESVFSKMISLQNLILHGNPWKCDC
KIRWLVFWYQHSTLGSFPAESSPSSLSHFQSALCHSPRSMHNAILLRSIS
IPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNG
TLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIGTN
FSVLFRWSSNNDKQYHFKGSFNMSTTKTIALTLLGSITLLFILSLLVGLV
YRYFYRFKPQKGVVVNQKYSVKSSEISRDRHNLIYNRLRENQNWNGESFE
FWNLRSSDIDDDKTFSNSTVLKNPTILTSLSTDGFIVPCVSNDTSLTDSH
IFVNPYIEAPATLITRTPSMTPCPIHEQFSSLDSSKPNSLNNSIYHPCPL
HGDMLSVILQSPTPLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C
IPR032675LRR_dom_sf
IPR013783Ig-like_fold
IPR001611Leu-rich_rpt
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004860protein kinase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0043197dendritic spine
GO:0044309neuron spine
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0060076excitatory synapse
Vocabulary: biological process
TermDefinition
GO:0006469negative regulation of protein kinase activity
GO:0019221cytokine-mediated signaling pathway
GO:0046426negative regulation of JAK-STAT cascade
GO:0050807regulation of synapse organization
GO:0050808synapse organization
GO:0097119postsynaptic density protein 95 clustering
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 194..261
e-value: 0.0057
score: 25.9
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 106..129
e-value: 2.3
score: 17.2
coord: 53..76
e-value: 60.0
score: 6.9
coord: 156..178
e-value: 6.6
score: 14.8
coord: 77..105
e-value: 27.0
score: 9.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 263..353
e-value: 2.3E-8
score: 36.1
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 108..169
e-value: 3.4E-10
score: 39.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 175..262
e-value: 9.6E-10
score: 39.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 8..174
e-value: 8.8E-28
score: 98.9
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 14..338
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 17..213
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 262..340
score: 9.083
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 262..344