Spds-1

Overview
NameSpds-1
Smed IDSMED30013882
Length (bp)976
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spds-1 (SMED30013882) t-SNE clustered cells

Violin plots show distribution of expression levels for Spds-1 (SMED30013882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spds-1 (SMED30013882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spds-1 (SMED30013882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013882SMESG000023363.1 dd_Smed_v4_3295_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013882SMESG000023363.1 dd_Smed_v4_3295_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013882SMESG000023363.1 dd_Smed_v4_3295_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013882SMESG000023363.1 dd_Smed_v4_3295_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013882SMESG000023363.1 dd_Smed_v4_3295_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spds-1 vs. Ensembl Human
Match: KBTBD2 (kelch repeat and BTB domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21751])

HSP 1 Score: 67.781 bits (164), Expect = 4.030e-12
Identity = 56/227 (24.67%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   +N++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   +A  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   24 FYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTGNL-AMNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYHQDAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. Ensembl Human
Match: KBTBD2 (kelch repeat and BTB domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21751])

HSP 1 Score: 67.781 bits (164), Expect = 6.868e-12
Identity = 56/227 (24.67%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   +N++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   +A  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   24 FYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTGNL-AMNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYHQDAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. Ensembl Human
Match: KLHL20 (kelch like family member 20 [Source:HGNC Symbol;Acc:HGNC:25056])

HSP 1 Score: 66.2402 bits (160), Expect = 2.313e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   69 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQIT-VEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 166          
BLAST of Spds-1 vs. Ensembl Human
Match: KLHL3 (kelch like family member 3 [Source:HGNC Symbol;Acc:HGNC:6354])

HSP 1 Score: 61.2326 bits (147), Expect = 6.474e-10
Identity = 27/88 (30.68%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            K    D+ ++ ++ E   H+++L+ CSP F AM  GD +E    +IE+KD D   +   ++ IY    + V E + +++LP A+  Q+
Sbjct:    6 KQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIE-VTEENVQVLLPAASLLQL 92          
BLAST of Spds-1 vs. Ensembl Human
Match: KLHL3 (kelch like family member 3 [Source:HGNC Symbol;Acc:HGNC:6354])

HSP 1 Score: 61.2326 bits (147), Expect = 8.080e-10
Identity = 27/88 (30.68%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            K    D+ ++ ++ E   H+++L+ CSP F AM  GD +E    +IE+KD D   +   ++ IY    + V E + +++LP A+  Q+
Sbjct:   46 KQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIE-VTEENVQVLLPAASLLQL 132          
BLAST of Spds-1 vs. Ensembl Celegans
Match: bath-30 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:Q8MXH8])

HSP 1 Score: 68.9366 bits (167), Expect = 4.938e-13
Identity = 46/135 (34.07%), Postives = 70/135 (51.85%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCE--MLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIM 594
            K  +SDI ++V  + F+  K  L+  S  F+++ LG F E    E+ + D D D+ + FLE +Y   F  +N+   + IL LA+ YQ   LV EL    CE  ++ T        LQM   FNL  +KQ C+ ++
Sbjct:  153 KKEYSDIVVLVDGQRFYLLKKFLAFHSTFFESLFLGGFYEAKLTEVPLYDIDVDDFQKFLEVLYG--FPVINDNTVEGILLLADMYQT-PLVSEL----CEDFLIQTTGKTYKKKLQMAIKFNLENLKQFCISMI 280          
BLAST of Spds-1 vs. Ensembl Celegans
Match: bath-13 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:O76568])

HSP 1 Score: 67.781 bits (164), Expect = 1.101e-12
Identity = 42/128 (32.81%), Postives = 71/128 (55.47%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCI-DYLQMVRNFNLPKIKQTCL 585
            FSD+ L V +KEF   K  L+  S  F+++LLG FAE  + E+ ++D DP + +  LE +Y      +++     IL LA+ Y +   +++ E    E L   S+K + D L++ + + L K+K+ CL
Sbjct:  151 FSDVVLAVGDKEFFVLKQFLAYHSSYFKSLLLGKFAESDQKEVTLQDIDPTDFQNLLEVLYGEP--AIDDETIDGILHLAHMYDMSVPLRKCE----EFLINESEKSMKDQLKIAKQYQLEKLKKACL 272          
BLAST of Spds-1 vs. Ensembl Celegans
Match: bath-29 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:H2KZR7])

HSP 1 Score: 67.3958 bits (163), Expect = 1.720e-12
Identity = 45/132 (34.09%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCE--MLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIM 594
            +SDI ++V  + F+  K  L+  S  F+++ LG F E    E+ + D D D+ + FLE +Y   F  +N+   + IL LA+ YQ   LV EL    CE  ++ T        LQM   FNL  +KQ C+ ++
Sbjct:  156 YSDIVVLVNGQRFYLLKKFLAFHSTFFESLFLGGFYEAKLAEVPLYDIDVDDFQKFLEVLYG--FPVINDNTVEGILLLADMYQT-PLVSEL----CEDFLIQTTGKTYRKKLQMAIKFNLENLKQFCISMI 280          
BLAST of Spds-1 vs. Ensembl Celegans
Match: bath-1 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:Q9N5Q0])

HSP 1 Score: 65.855 bits (159), Expect = 4.895e-12
Identity = 40/131 (30.53%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCI-DYLQMVRNFNLPKIKQTCL 585
            ++ FSD+ L V++K+F   +  L++ S  F+++LLG FAE  K+EI+ +  +  + + FLE +Y      +++ D + IL LA+ Y V   +++ E +  E    +S+K + D L++ + + L  +K++CL
Sbjct:  142 EEQFSDVVLAVEDKKFFVLRKFLASHSSYFKSLLLGTFAEADKSEIKHEAINSIDFQNFLEVLYGEP--VIDDDDVEGILHLAHMYDVPVAIRKCEEFLIE----KSEKSMRDQLEIAKKYQLDNLKKSCL 266          
BLAST of Spds-1 vs. Ensembl Celegans
Match: bath-33 (BTB and MATH domain containing [Source:UniProtKB/TrEMBL;Acc:O17193])

HSP 1 Score: 64.6994 bits (156), Expect = 9.274e-12
Identity = 34/126 (26.98%), Postives = 67/126 (53.17%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTC 582
            FSD+ L+VK   FH  K+ L+  S  F+A+ +G+F E + +E+ +   DP++ + FLE +Y    + + +   + +L +A+ Y    + +  EN+      ++       LQ+   +NL  +K++C
Sbjct:  148 FSDVVLVVKETRFHVAKLFLAAQSGYFKALPIGNFKEGNSSEVTLSSIDPNDFQNFLEVLYGHQ-EAITDESVEGVLLIADMYNAKLVTQNCENFLFRGAGSKM-MLKKQLQLAYRYNLENLKRSC 271          
BLAST of Spds-1 vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0332133)

HSP 1 Score: 55.4546 bits (132), Expect = 3.529e-8
Identity = 30/103 (29.13%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L V  ++   H+++LS CS  F AM  G+  E  + E+ ++D D + ME  ++  Y      V E++ + +LP A   Q    + E+++  CE L  + D
Sbjct:   73 DVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTAHI-IVEESNVQTLLPAACLLQ----LVEIQDICCEFLKRQLD 170          
BLAST of Spds-1 vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0075505)

HSP 1 Score: 55.0694 bits (131), Expect = 3.867e-8
Identity = 30/103 (29.13%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L V  ++   H+++LS CS  F AM  G+  E  + E+ ++D D + ME  ++  Y      V E++ + +LP A   Q    + E+++  CE L  + D
Sbjct:   73 DVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTAHI-IVEESNVQTLLPAACLLQ----LVEIQDICCEFLKRQLD 170          
BLAST of Spds-1 vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081042)

HSP 1 Score: 55.0694 bits (131), Expect = 4.053e-8
Identity = 29/103 (28.16%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+  + E H H+++L++CSP F AM    F E  +  I ++  D   +E  ++ +Y  + + VNE + +++L  AN  Q    + ++ +  C+ L T+ D
Sbjct:  158 DVILVADDVEIHAHRMVLASCSPYFYAMFT-SFEESRQARITLQSVDARALELLIDYVYTATVE-VNEDNVQVLLTAANLLQ----LTDVRDACCDFLQTQLD 254          
BLAST of Spds-1 vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081043)

HSP 1 Score: 55.4546 bits (132), Expect = 4.142e-8
Identity = 29/103 (28.16%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+  + E H H+++L++CSP F AM    F E  +  I ++  D   +E  ++ +Y  + + VNE + +++L  AN  Q    + ++ +  C+ L T+ D
Sbjct:  158 DVILVADDVEIHAHRMVLASCSPYFYAMFT-SFEESRQARITLQSVDARALELLIDYVYTATVE-VNEDNVQVLLTAANLLQ----LTDVRDACCDFLQTQLD 254          
BLAST of Spds-1 vs. Ensembl Fly
Match: CG17068 (gene:FBgn0031098 transcript:FBtr0077341)

HSP 1 Score: 53.9138 bits (128), Expect = 1.238e-7
Identity = 38/147 (25.85%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  181 GKFLV-KDPFSDIKLIVKN----KEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGT 606
            G++L+  + ++D + +V +    +    HK++L+  SPVF+ M  G+  +K+ + I + D  P+  EA LE IY       +   A  +  +A  Y + H+V    ++    LS + + C  Y +  + F+ P++ Q+ +D++A  T
Sbjct:   16 GQYLLHSEKWADCRFLVGSSPTQRLIAGHKLLLAMASPVFERMFYGNLPDKT-DPIVIPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTHFLWADLSPK-NACRAY-EFAKLFDEPRLMQSSMDLIAANT 159          
BLAST of Spds-1 vs. Ensembl Zebrafish
Match: klhl40a (kelch-like family member 40a [Source:NCBI gene;Acc:553257])

HSP 1 Score: 68.9366 bits (167), Expect = 2.017e-12
Identity = 44/146 (30.14%), Postives = 70/146 (47.95%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNE 642
            F D  L +K+KEF CH+++L+  SP F+AM L D  E  K EI +KD +P  M   L  IY      + E + + I   AN YQ+  +     +Y  + L   +  C+   ++    + P++     D +      RYL  I+D +
Sbjct:   33 FVDCILKIKDKEFPCHRLVLAATSPYFKAMFLSDLEESKKREIVLKDIEPGVMGMILRYIYTSDIN-LTEQNVQDIFMAANMYQIPSIFSVCVSYLQQKLVLSN--CLAIFRLGLLLDCPRLAMEARDFIC----DRYLLIIRDQD 171          
BLAST of Spds-1 vs. Ensembl Zebrafish
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 67.3958 bits (163), Expect = 5.130e-12
Identity = 39/117 (33.33%), Postives = 61/117 (52.14%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKC----IDYLQMVR 549
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y  S   V E + + +LP A   Q    + E++   CE L  + D      I  LQ VR
Sbjct:   51 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYT-SQVTVEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLDPSNCLGIRVLQHVR 162          
BLAST of Spds-1 vs. Ensembl Zebrafish
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 66.2402 bits (160), Expect = 1.436e-11
Identity = 34/103 (33.01%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y  S   V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   51 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYT-SQVTVEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 148          
BLAST of Spds-1 vs. Ensembl Zebrafish
Match: klhl17 (kelch-like family member 17 [Source:ZFIN;Acc:ZDB-GENE-030131-8131])

HSP 1 Score: 63.1586 bits (152), Expect = 1.587e-10
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            DI L V NKE   HK++L++CSP F AM   + +E  +  + + D DP  +E  ++  Y      V E + + +LP A+  Q+
Sbjct:   69 DIVLHVANKEIKAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALEQLVQYAYTAEI-VVGEGNVQTLLPAASLLQL 150          
BLAST of Spds-1 vs. Ensembl Zebrafish
Match: klhl17 (kelch-like family member 17 [Source:ZFIN;Acc:ZDB-GENE-030131-8131])

HSP 1 Score: 63.1586 bits (152), Expect = 1.587e-10
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            DI L V NKE   HK++L++CSP F AM   + +E  +  + + D DP  +E  ++  Y      V E + + +LP A+  Q+
Sbjct:   69 DIVLHVANKEIKAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALEQLVQYAYTAEI-VVGEGNVQTLLPAASLLQL 150          
BLAST of Spds-1 vs. Ensembl Xenopus
Match: klhl40 (kelch like family member 40 [Source:NCBI gene;Acc:548534])

HSP 1 Score: 69.707 bits (169), Expect = 1.340e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  199 DPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            D F D  L ++ KEF CH+++L+ CSP F+AM L +  E  K EI+++D DPD M   L  IY    + + E + + I  +AN +Q+
Sbjct:   30 DNFIDCVLKIQGKEFPCHRLVLAACSPYFRAMFLSNLEEGKKKEIDLEDVDPDVMGKILHYIYTSEIE-ITEKNVQDIFSVANMFQI 115          
BLAST of Spds-1 vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 66.2402 bits (160), Expect = 3.583e-12
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q+     E++   CE L  + D
Sbjct:   69 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFSYTSQIT-VEEGNVQTLLPAACLLQLA----EIQEACCEFLKRQLD 166          
BLAST of Spds-1 vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 67.0106 bits (162), Expect = 9.781e-12
Identity = 38/117 (32.48%), Postives = 60/117 (51.28%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKC----IDYLQMVR 549
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E++   CE L  + D      I  LQ VR
Sbjct:   51 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFSYTSQIT-VEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLDPSNCLGIRVLQHVR 162          
BLAST of Spds-1 vs. Ensembl Xenopus
Match: klhl30 (kelch like family member 30 [Source:NCBI gene;Acc:100124817])

HSP 1 Score: 65.855 bits (159), Expect = 2.226e-11
Identity = 32/130 (24.62%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIM 594
             SD+ L+V+ +EF CH+ +L+ CS  F AM  GDF E    ++E+K+ DP+ ME  ++  Y      +N+++ + ++  +N      + K    Y  + +   +  C+   +       P++    L  +
Sbjct:   55 LSDVVLVVQGREFPCHRAVLALCSQYFHAMFTGDFQESIAAQVEIKEVDPEVMETLIDFSYTGRLT-INQSNVESLIRTSNLLSFPAVRKVCSRYLQQQMD--ATNCLGIWEFGETHGCPEVAAKALSFL 181          
BLAST of Spds-1 vs. Ensembl Xenopus
Match: usb1 (U6 snRNA biogenesis phosphodiesterase 1 [Source:Xenbase;Acc:XB-GENE-948670])

HSP 1 Score: 65.855 bits (159), Expect = 2.591e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   62 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFSYTSQIT-VEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 159          
BLAST of Spds-1 vs. Ensembl Mouse
Match: Kbtbd2 (kelch repeat and BTB (POZ) domain containing 2 [Source:MGI Symbol;Acc:MGI:2384811])

HSP 1 Score: 70.0922 bits (170), Expect = 9.084e-13
Identity = 58/227 (25.55%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   VN++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   EA  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   24 FYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAAALQMIIAYAYTGNL-AVNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYRQEAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. Ensembl Mouse
Match: Kbtbd2 (kelch repeat and BTB (POZ) domain containing 2 [Source:MGI Symbol;Acc:MGI:2384811])

HSP 1 Score: 70.0922 bits (170), Expect = 9.084e-13
Identity = 58/227 (25.55%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   VN++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   EA  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   24 FYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAAALQMIIAYAYTGNL-AVNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYRQEAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. Ensembl Mouse
Match: Klhl20 (kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855])

HSP 1 Score: 66.2402 bits (160), Expect = 1.405e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   64 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQIT-VEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 161          
BLAST of Spds-1 vs. Ensembl Mouse
Match: Klhl20 (kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855])

HSP 1 Score: 66.2402 bits (160), Expect = 1.405e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   64 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQIT-VEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 161          
BLAST of Spds-1 vs. Ensembl Mouse
Match: Klhl6 (kelch-like 6 [Source:MGI Symbol;Acc:MGI:2686922])

HSP 1 Score: 63.5438 bits (153), Expect = 1.015e-10
Identity = 49/200 (24.50%), Postives = 87/200 (43.50%), Query Frame = 1
Query:   91 IKMKAVKKDVCIQFGVEEIPEEEAVPTARDGKFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRN 690
            +K    +  + +Q G+E + EE A+              +D+ L V  +EF CH+++L+  S  F+AM   D  EK +  I +K  D + M   L   Y  S   + + + + +L  AN +Q   LV    ++  E L+   + CI  L++    +L  +K      + +         I ++E   E   D L H +R+
Sbjct:   45 VKFDDTRLSLILQNGLETLREENAL--------------TDVILCVDVQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETMHTLLVYTYT-SKALITKQNVQRVLEAANLFQFLQLVDACASFLTEALN--PENCIGILRLADTHSLDSLKMQVQSYIIQN-----FVQILNSEEFLELPVDTLYHILRS 222          
BLAST of Spds-1 vs. UniProt/SwissProt
Match: sp|Q5U504|KLH40_XENLA (Kelch-like protein 40 OS=Xenopus laevis OX=8355 GN=klhl40 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.892e-12
Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            F D  L ++ KEF CH+++L++CSP F+AM L D  E  K EI+++D DPD M   L  IY    + + E + + I  +AN +Q+
Sbjct:   32 FIDCVLKIQGKEFPCHRLVLASCSPYFRAMFLSDLEESKKKEIDLEDVDPDVMGKILHYIYTSEIE-ITEKNVQDIFSVANMFQI 115          
BLAST of Spds-1 vs. UniProt/SwissProt
Match: sp|Q5EB39|KLH40_XENTR (Kelch-like protein 40 OS=Xenopus tropicalis OX=8364 GN=klhl40 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 7.100e-12
Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = 1
Query:  199 DPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            D F D  L ++ KEF CH+++L+ CSP F+AM L +  E  K EI+++D DPD M   L  IY    + + E + + I  +AN +Q+
Sbjct:   30 DNFIDCVLKIQGKEFPCHRLVLAACSPYFRAMFLSNLEEGKKKEIDLEDVDPDVMGKILHYIYTSEIE-ITEKNVQDIFSVANMFQI 115          
BLAST of Spds-1 vs. UniProt/SwissProt
Match: sp|B3DIV9|KL40A_DANRE (Kelch-like protein 40a OS=Danio rerio OX=7955 GN=klhl40a PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.523e-11
Identity = 44/146 (30.14%), Postives = 70/146 (47.95%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNE 642
            F D  L +K+KEF CH+++L+  SP F+AM L D  E  K EI +KD +P  M   L  IY      + E + + I   AN YQ+  +     +Y  + L   +  C+   ++    + P++     D +      RYL  I+D +
Sbjct:   33 FVDCILKIKDKEFPCHRLVLAATSPYFKAMFLSDLEESKKREIVLKDIEPGVMGMILRYIYTSDIN-LTEQNVQDIFMAANMYQIPSIFSVCVSYLQQKLVLSN--CLAIFRLGLLLDCPRLAMEARDFIC----DRYLLIIRDQD 171          
BLAST of Spds-1 vs. UniProt/SwissProt
Match: sp|Q5RDY3|KBTB2_PONAB (Kelch repeat and BTB domain-containing protein 2 OS=Pongo abelii OX=9601 GN=KBTBD2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.094e-11
Identity = 56/228 (24.56%), Postives = 106/228 (46.49%), Query Frame = 1
Query:  184 KFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            +F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   +N++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   +A  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   23 QFYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTGNL-AMNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYHQDAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. UniProt/SwissProt
Match: sp|Q8IY47|KBTB2_HUMAN (Kelch repeat and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KBTBD2 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 3.298e-11
Identity = 56/227 (24.67%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIK 867
            F  +  F+DI LIV+  EF CHK++L+ CS  F+AM +   +E  +  + +++ D   ++  +   Y  +   +N++  + +   A F QV  +++    Y  + ++  ++ C+  L     F+  ++KQ+     A+       TA+   +A  +   DLL        DIL +  L+       VEK+ET       V   A L L+ N E  ++ +  + S I+
Sbjct:   24 FYEQQLFTDIVLIVEGTEFPCHKMVLATCSSYFRAMFMSGLSESKQTHVHLRNVDAATLQIIITYAYTGNL-AMNDSTVEQLYETACFLQVEDVLQRCREYLIKKIN--AENCVRLLSFADLFSCEELKQS-----AKRMVEHKFTAVYHQDAFMQLSHDLLI-------DILSSDNLN-------VEKEET-------VREAAMLWLEYNTESRSQYLSSVLSQIR 221          
BLAST of Spds-1 vs. TrEMBL
Match: A0A0X3PP33 (BTB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR85097 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.111e-22
Identity = 61/204 (29.90%), Postives = 103/204 (50.49%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVN-EADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLK 813
            FSD+ L+V+N+  HCH+ +LS  SPVF+ M    F E SKN++ +   DP+ +   L  +Y P  + ++  A A+ +LPL + YQ+  LV   E      L+         L +   + L ++KQ  +D  +R    R      + +   +    +   R++ LE  +  I+ S +  C ++E +  RVPVN C +H  PL++K
Sbjct:   48 FSDMVLVVQNERLHCHRAILSLYSPVFKTMFQSKFEETSKNQVSMPQDDPELVRELLRHLYTPGGREMDIGAAAERLLPLIHRYQIDSLVSTAERTLTYSLT--DSLAPKMLSLADLYGLERLKQAAIDSCSRLDMPRLSAYFDEAQISSDLRAIVFAERIKLLEKYVTEIQNSFTRSCVRLESRLERVPVNHCQEHSQPLSMK 249          
BLAST of Spds-1 vs. TrEMBL
Match: C1LKZ0 (Speckle-type POZ protein-like OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 7.065e-21
Identity = 63/216 (29.17%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKL 852
            FSD  L+V+ +  HCH+ +LS  SPVF+AM      E  KNE+ +   + +++   L  +Y P    +    A+ +LP+ + YQ+  LV   E      L+  +     +L++   + L +++Q  LD  AR    R L A ++     E + ++L  R++ LE  L +I+ S ++ CS++E +  RVP N C  H  P +      V N    +L
Sbjct:   21 FSDAILVVQGRNLHCHRAILSIYSPVFKAMFQNRCIENQKNEVVIPVDEFEDIREMLRHMYTPGGCDMTAETAEKLLPILHRYQIDSLVSLAERTLTFRLNDATAPV--FLRIADLYGLSRLRQAALDSCARLDYGRMLKAFEEINISPELKNEVLERRIKVLEKCLIDIQQSFTHSCSRMESRAERVPSNHCSLHSRPFSTITFNPVVNSTTGQL 234          
BLAST of Spds-1 vs. TrEMBL
Match: C1L740 (Speckle-type POZ protein-like OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 8.262e-21
Identity = 63/216 (29.17%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKL 852
            FSD  L+V+ +  HCH+ +LS  SPVF+AM      E  KNE+ +   + +++   L  +Y P    +    A+ +LP+ + YQ+  LV   E      L+  +     +L++   + L +++Q  LD  AR    R L A ++     E + ++L  R++ LE  L +I+ S ++ CS++E +  RVP N C  H  P +      V N    +L
Sbjct:   51 FSDAILVVQGRNLHCHRAILSIYSPVFKAMFQNRCIENQKNEVVIPVDEFEDIREMLRHMYTPGGCDMTAETAEKLLPILHRYQIDSLVSLAERTLTFRLNDATAPV--FLRIADLYGLSRLRQAALDSCARLDYGRMLKAFEEINISPELKNEVLERRIKVLEKCLIDIQQSFTHSCSRMESRAERVPSNHCSLHSRPFSTITFNPVVNSTTGQL 264          
BLAST of Spds-1 vs. TrEMBL
Match: C1LKY9 (Speckle-type POZ protein-like OS=Schistosoma japonicum OX=6182 GN=EWB00_008034 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.370e-20
Identity = 63/216 (29.17%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKL 852
            FSD  L+V+ +  HCH+ +LS  SPVF+AM      E  KNE+ +   + +++   L  +Y P    +    A+ +LP+ + YQ+  LV   E      L+  +     +L++   + L +++Q  LD  AR    R L A ++     E + ++L  R++ LE  L +I+ S ++ CS++E +  RVP N C  H  P +      V N    +L
Sbjct:   51 FSDAILVVQGRNLHCHRAILSIYSPVFKAMFQNRCIENQKNEVVIPVDEFEDIREMLRHMYTPGGCDMTAETAEKLLPILHRYQIDSLVSLAERTLTFRLNDATAPV--FLRIADLYGLSRLRQAALDSCARLDYGRMLKAFEEINISPELKNEVLERRIKVLEKCLIDIQQSFTHSCSRMESRAERVPSNHCSLHSRPFSTITFNPVVNSTTGQL 264          
BLAST of Spds-1 vs. TrEMBL
Match: Q5DG89 (SJCHGC09428 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 1.397e-20
Identity = 63/216 (29.17%), Postives = 107/216 (49.54%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKL 852
            FSD  L+V+ +  HCH+ +LS  SPVF+AM      E  KNE+ +   + +++   L  +Y P    +    A+ +LP+ + YQ+  LV   E      L+  +     +L++   + L +++Q  LD  AR    R L A ++     E + ++L  R++ LE  L +I+ S ++ CS++E +  RVP N C  H  P +      V N    +L
Sbjct:   51 FSDAILVVQGRNLHCHRAILSIYSPVFKAMFQNRCIENQKNEVVIPVDEFEDIREMLRHMYTPGGCDMTAETAEKLLPILHRYQIDSLVSLAERTLTFRLNDATAPV--FLRIADLYGLSRLRQAALDSCARLDYGRMLKAFEEINISPELKNEVLERRIKVLEKCLIDIQQSFTHSCSRMESRAERVPSNHCSLHSRPFSTITFNPVVNSTTGQL 264          
BLAST of Spds-1 vs. Ensembl Cavefish
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:103022090])

HSP 1 Score: 66.2402 bits (160), Expect = 1.206e-11
Identity = 34/103 (33.01%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y  S   V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   51 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYT-SQVTVEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 148          
BLAST of Spds-1 vs. Ensembl Cavefish
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:103022090])

HSP 1 Score: 66.2402 bits (160), Expect = 1.225e-11
Identity = 34/103 (33.01%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y  S   V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   60 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYT-SQVTVEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 157          
BLAST of Spds-1 vs. Ensembl Cavefish
Match: klhl40a (kelch-like protein 40a [Source:NCBI gene;Acc:103032700])

HSP 1 Score: 64.6994 bits (156), Expect = 4.102e-11
Identity = 35/97 (36.08%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  175 RDG--KFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            +DG  + L  D F D  L +K++EF CH+++L+  SP F+AM L D  E  K E+ ++D +P  M   L  IY      + E + + I  +AN YQ+
Sbjct:   21 QDGLCELLENDKFVDCVLKIKDREFPCHRLVLAASSPYFKAMFLSDMEESKKREVVLQDVEPSIMGMILRYIYTSDIN-LTEQNVQDIFMVANMYQI 116          
BLAST of Spds-1 vs. Ensembl Cavefish
Match: kbtbd2 (kelch repeat and BTB domain containing 2 [Source:NCBI gene;Acc:103038199])

HSP 1 Score: 63.5438 bits (153), Expect = 9.832e-11
Identity = 35/143 (24.48%), Postives = 76/143 (53.15%), Query Frame = 1
Query:  154 EEAVPTARDGKFLVKDPF-SDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQT 579
            E AV      KF  +    +DI L+V++ EF CHK++L+ CS  F+AM +   +E  ++ + +++ DP  ++  +   Y  +   ++++  + +   A F QV  ++ +  +Y  + ++  +D C+  L +   F+  ++KQ+
Sbjct:   14 EYAVSVLEQLKFFYEQKLLTDITLLVEDNEFPCHKMILATCSSYFRAMFMSGLSESKQSHVHLRNVDPVTLQTIITYAYTGNLA-ISDSTVEPLYETACFLQVEDVLLQCRDYLVKKIT--ADNCVRMLSIGDMFSCNELKQS 153          
BLAST of Spds-1 vs. Ensembl Cavefish
Match: klhl17 (kelch like family member 17 [Source:NCBI gene;Acc:103036751])

HSP 1 Score: 62.7734 bits (151), Expect = 1.620e-10
Identity = 28/83 (33.73%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            DI L V NKE   HK++L++CSP F AM   + +E  +  + + D DP  +E  ++  Y      V E + + +LP A+  Q+
Sbjct:   42 DIVLHVANKEIKAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDPQALEQLVQYAYTAEI-VVGEGNVQTLLPAASLLQL 123          
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 65.4698 bits (158), Expect = 4.423e-12
Identity = 32/103 (31.07%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L V +++ + H+++LS CSP F AM  G+ AE  + E+ ++D D   ME  ++  Y      V E + + +LP A   Q    + E+++  CE L  + D
Sbjct:   62 DVVLAVGSRKIYAHRVVLSACSPYFHAMFTGELAESRQTEVSIRDVDETAMELLIDFAYTAQIT-VEECNVQALLPAACLLQ----LAEIQDTCCEFLKRQLD 159          
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Match: klhl26 (kelch-like family member 26 [Source:NCBI gene;Acc:558035])

HSP 1 Score: 60.8474 bits (146), Expect = 1.183e-10
Identity = 35/127 (27.56%), Postives = 62/127 (48.82%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIY----NPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQT 579
            D+ L+V+N  F  H+ +L+ CS  F+AM  G   E S+ EIE++      ++  L+  Y        +CV +     +L  A F Q+  +V   E++    +S   + C+   QM   F+L  +K++
Sbjct:   61 DVTLLVENASFRVHRAVLAACSDYFRAMFTGGMREASQREIELQGLSARGLQHILDFAYCGEVTLDLECVED-----VLGAAVFLQMAPVVGLCEDFLKSAMSV--ETCLGVGQMATAFSLASLKES 180          
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Match: klhl2 (kelch-like family member 2 [Source:ZFIN;Acc:ZDB-GENE-090312-193])

HSP 1 Score: 57.7658 bits (138), Expect = 1.184e-9
Identity = 28/101 (27.72%), Postives = 53/101 (52.48%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTR 513
            D+ L+    E   HK+ L++CSP F AM   + AE    ++E+K+ D   +   ++ +Y    + V E + +++LP A+  Q    + E+ +  CE L ++
Sbjct:   21 DVVLVADGTEVAAHKLALASCSPYFHAMFTSEMAESKAQKVEIKEVDGRALALLVDYVYTAEIQ-VTEDNVQILLPAASLLQ----LPEVRDACCEFLQSQ 116          
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002701.1 (pep scaffold:Pmarinus_7.0:GL481646:340:4542:-1 gene:ENSPMAG00000002468.1 transcript:ENSPMAT00000002701.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 2.354e-9
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  148 PEEEAVPTARDGKFLVKDP-FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            P  E V  A + +F +KD  F+D+ + V+  EF CH+ +LS CS  F+AM   D  E     +E+       ME  L+ +Y    +   + + + +   A+ +QV
Sbjct:   52 PHAEGVLAALN-EFRLKDRIFTDVMVAVEGCEFPCHRAVLSACSAYFRAMFCNDHRESRATIVEINGIQASAMEQLLQYMYTGRARITTD-NVQYLFETASLFQV 154          
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007942.1 (pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 gene:ENSPMAG00000007181.1 transcript:ENSPMAT00000007942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 5.499e-9
Identity = 32/128 (25.00%), Postives = 66/128 (51.56%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIM 594
            D  + VK++EF+ HK +L +CSP F+A+  G +++  + +  +   +P+ ME  +E  Y  +   V  A+ + +L  A+ + V  +V+    +  E +S   D C++  +    + L  ++Q+    M
Sbjct:   24 DAVIRVKDREFNAHKNILCSCSPYFRALFTGSWSDAGRRKFTIPGVEPEAMELIIEYAYMRTLP-VTCANVERLLVAADQFNVMGIVRLCCAFLREHISF--DSCVEVYRFSGFYALHDLQQSAFAFM 148          
BLAST of Spds-1 vs. Ensembl Nematostella
Match: EDO36075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJN5])

HSP 1 Score: 68.9366 bits (167), Expect = 1.668e-13
Identity = 41/132 (31.06%), Postives = 65/132 (49.24%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMAR 600
            +SD+ L+V+ + FH H+ +L+ CSPVF+AM    F E S  EI +     D +  FL  +Y    +     D   +L LA  YQ+  L    E    +  S+     +D + + + FNL K+   CL  ++R
Sbjct:   10 YSDLVLVVEEERFHVHRAILAMCSPVFRAMFQSKFKEASLEEIPLPGKKADRIYDFLCMLYPFPIQIAEHHDVSSLLELAREYQIPKLTARCEERLLQKQSS-----VDLILLAQEFNLTKLLDKCLVSLSR 136          
BLAST of Spds-1 vs. Ensembl Nematostella
Match: EDO30051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1W2])

HSP 1 Score: 63.5438 bits (153), Expect = 1.127e-11
Identity = 56/201 (27.86%), Postives = 89/201 (44.28%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMA-------RGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRV 768
            F V    SD  L+V+ K F+ HK  LS  SPVF+ M    F E++  EI +       ++  L  IY P+ K V E +   +L LA  YQ+  L +  E Y  +   T   + ID+L +   F + ++ + C++I         R      L    + + L E   +LL  +V  LE    +I   +   C    ++ +RV
Sbjct:   10 FSVPWHLSDAVLVVEEKHFNVHKSTLSMWSPVFEKM----FRERNDQEICLPGKKSKEIKEMLLVIY-PTSKKVTEENCYYLLTLAQEYQMEQLTERCEKYLIQREKT-PFQAIDFLVLAHGFKMSELCKQCIEIAKHISLNELRKHEKYSLVEDGNGKQLAERRVELLEGKVATLEQKPNSIRKEIKETCEWAIREISRV 204          
BLAST of Spds-1 vs. Ensembl Nematostella
Match: EDO44601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV90])

HSP 1 Score: 58.9214 bits (141), Expect = 1.540e-10
Identity = 34/113 (30.09%), Postives = 57/113 (50.44%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVR 549
            D+ L V N+ F  HK++L+  S  F+AM    F E SKN++ + D DP  + A +   YN   + +N  +   +  +AN + V  ++   ENY    LS  +  C+ +  +V 
Sbjct:   34 DVTLKVTNQSFPGHKLVLAANSTYFRAMFGEGFVESSKNDVVLHDLDPKGVNAVISYFYNSKIE-INADNFGAVFAVANMWDVKFVLTACENYLRVHLS--ASNCLGFQILVH 143          
BLAST of Spds-1 vs. Ensembl Nematostella
Match: EDO47648 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLR1])

HSP 1 Score: 58.5362 bits (140), Expect = 1.609e-9
Identity = 49/179 (27.37%), Postives = 82/179 (45.81%), Query Frame = 1
Query:  205 FSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYN-PSFKCVNEADAKLILPLANFYQ---VGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGT-NSRY--LTAIKDNEALK----EFETDLLRHRVRNLEDILK 708
            FSD+ L+++  +FH H+  LS  SPVF+ M    F EK+  EI +       +E  L  +Y     + + E +   +L LA  YQ   V  L  E  NY     + +   C+ + ++  +F L        ++MAR    SRY  L  ++D E  +    E +  +   +++ LE  L+
Sbjct:  429 FSDVVLVIEGTKFHVHRSTLSIWSPVFERMFTSGFTEKTAEEIPLPGKRAAEIEVLLRVMYTFGKAQPITEGNYTFLLELAEEYQMDRVKELCAEFLNY-----NLQESNCLKFYRVAEHFKLK-------EVMARSLEESRYQSLANLQDCEDFEKLGPEIQLKVYGEKIKELERTLQ 595          
BLAST of Spds-1 vs. Ensembl Nematostella
Match: EDO47170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV8])

HSP 1 Score: 57.7658 bits (138), Expect = 2.261e-9
Identity = 30/103 (29.13%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ + V +   H H+++L+ CSP F+AM   + AE  + EI ++D D   M   +   Y  S   + E + + +LP A   Q    + E++   CE L  + D
Sbjct:   27 DVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITFAYTASIT-IEETNVQTLLPAACLLQ----LTEIQEICCEFLKRQLD 124          
BLAST of Spds-1 vs. Ensembl Medaka
Match: klhl40a (kelch-like protein 40a [Source:NCBI gene;Acc:101164434])

HSP 1 Score: 70.0922 bits (170), Expect = 5.664e-13
Identity = 44/155 (28.39%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  187 FLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALK 651
             L  D F D  L + +KEF CH+++L+  SP F+AM L D  E  K EI ++D +PD M   L  +Y      + E + + I  +AN YQ+  +     +Y  E L      C+   ++    + P++  T  + +      RY   ++D + L+
Sbjct:   67 LLENDKFVDCVLKISDKEFPCHRLVLAASSPFFKAMFLSDLEESKKREIVLRDVNPDVMGMILRYLYTSDIS-LTEQNVQDIFMVANMYQIPSIFSVCVSYLQEKLVL--GNCLAIFRLGLLLDCPRLTLTAREFICE----RYQLVVRDQDFLQ 214          
BLAST of Spds-1 vs. Ensembl Medaka
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:101170463])

HSP 1 Score: 65.855 bits (159), Expect = 1.369e-11
Identity = 34/103 (33.01%), Postives = 56/103 (54.37%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSD 519
            D+ L+V  K+ + H+++LS CSP F+AM  G+ AE  + E+ ++D D   ME  ++  Y  S   V E + + +LP A   Q    + E++   CE L  + D
Sbjct:   69 DVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYT-SQVIVEEGNVQTLLPAACLLQ----LAEIQEACCEFLKRQLD 166          
BLAST of Spds-1 vs. Ensembl Medaka
Match: klhl40b (kelch-like protein 40b [Source:NCBI gene;Acc:101166589])

HSP 1 Score: 61.6178 bits (148), Expect = 3.494e-10
Identity = 35/97 (36.08%), Postives = 53/97 (54.64%), Query Frame = 1
Query:  175 RDGKF--LVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            +DG F  L  D   D  L +K+KEF CH+++L  CS  F+++ L D  E  K EI ++D +P  M   L+ +Y      V E + + I  +AN YQ+
Sbjct:   20 QDGLFDLLENDKLVDCVLKIKDKEFPCHRLVLCACSSYFRSIFLSDLEESKKREIVLEDVEPGVMGLILKYLYTSKIN-VTEQNVQDIFAVANIYQI 115          
BLAST of Spds-1 vs. Ensembl Medaka
Match: klhl3 (kelch like family member 3 [Source:NCBI gene;Acc:101162932])

HSP 1 Score: 60.4622 bits (145), Expect = 8.396e-10
Identity = 25/88 (28.41%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            K    D++L+  + E   H+++L++CSP F AM  GD +E   +++E+++ D   +   ++ IY    + V+E + +++LP A+  Q+
Sbjct:   63 KKTLCDVQLVAGSVEVPAHRVVLASCSPYFCAMFTGDMSESRAHQVEIREVDGHTLRKLVDYIYTAEIE-VSEDNVQVLLPAASLLQL 149          
BLAST of Spds-1 vs. Ensembl Medaka
Match: klhl17 (kelch like family member 17 [Source:NCBI gene;Acc:101175399])

HSP 1 Score: 59.6918 bits (143), Expect = 1.560e-9
Identity = 27/83 (32.53%), Postives = 44/83 (53.01%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            DI L V NKE   HK++L++CSP F AM   + +E  +  + + D D   +E  ++  Y      V E + + +LP A+  Q+
Sbjct:   42 DIVLHVSNKEIKAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDSQALEQLVQYAYTAEI-VVGEGNVQTLLPAASLLQL 123          
BLAST of Spds-1 vs. Planmine SMEST
Match: SMESG000023363.1 (SMESG000023363.1)

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 276/277 (99.64%), Postives = 276/277 (99.64%), Query Frame = 1
Query:   97 MKAVKKDVCIQFGVEEIPEEEAVPTARDGKFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQKLKSHIKNVCTTEKIRTTINYNNRDSA 927
            MKAVKKDVCIQFGVEEIPEEEAVPTARDGKFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFC DHPAPLTLKENGEVCNECVQKLKSHIKNVCTTEKIRTTINYNNRDSA
Sbjct:    1 MKAVKKDVCIQFGVEEIPEEEAVPTARDGKFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLEDILKNIELSLSNPCSKVEKKETRVPVNFCADHPAPLTLKENGEVCNECVQKLKSHIKNVCTTEKIRTTINYNNRDSA 277          
BLAST of Spds-1 vs. Planmine SMEST
Match: SMESG000078106.1 (SMESG000078106.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.297e-11
Identity = 29/86 (33.72%), Postives = 48/86 (55.81%), Query Frame = 1
Query:  211 DIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQVGHL 468
            D+ LIV  K+   H+I+LS CSP F+AM  G+ +E  + E+ ++D D   +EA +E  Y      + E + + +LP A   Q+  +
Sbjct:   57 DVALIVGQKKILAHRIVLSACSPYFKAMFTGELSESQQTEVTLRDIDESAVEALVEFCYTSQI-VIEEWNVQCLLPAACLLQLSEI 141          
BLAST of Spds-1 vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 54.299 bits (129), Expect = 5.797e-8
Identity = 27/88 (30.68%), Postives = 44/88 (50.00%), Query Frame = 1
Query:  196 KDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            +  F D+ LIV   +F  HKI+L+   P F  M + D  E S+  I++   DP+++EA +   Y      +   + + I   ANF Q+
Sbjct:   56 QGKFCDVTLIVDGHQFSAHKIVLAASIPYFNGMFMNDMVESSEKNIKLHGLDPNSLEALINFAYRGEVY-ITPNNVQSIFMGANFLQI 142          
BLAST of Spds-1 vs. Planmine SMEST
Match: SMESG000005263.1 (SMESG000005263.1)

HSP 1 Score: 54.299 bits (129), Expect = 7.127e-8
Identity = 36/149 (24.16%), Postives = 72/149 (48.32%), Query Frame = 1
Query:  157 EAVPTARD-GKFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKL--ILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMVRNFNLPKIKQTCLDIM 594
            E +  A D  +  ++   SD+ LIV+N  F  H+++L+  S  F+A+L     E  ++EIE+K+ + +  E  L  IY  +    +  D  +  +L L + Y +  + K++  +    L+   D  +  L +   +N+ ++   CL  +
Sbjct:   18 ELIAVANDIARMYLQPELSDLVLIVQNHRFPVHRVVLAARSQYFRALLYSGLKESYQSEIEIKNANHEAFEHILRYIYKGTINVSDMMDDLVMELLSLVHQYGLVSIEKQISTHLSHNLAL--DNVVSVLNVAVLYNIQELLDRCLRFL 164          
BLAST of Spds-1 vs. Planmine SMEST
Match: SMESG000078467.1 (SMESG000078467.1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.834e-6
Identity = 31/92 (33.70%), Postives = 50/92 (54.35%), Query Frame = 1
Query:  184 KFLVKDPFSDIKLIVKNKEFHCHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPSFKCVNEADAKLILPLANFYQV 459
            +F +++   D+ L V++KEF  HKI+L+  S  F AM     AE  ++ IE+K    D +   LE +Y  +    NE + + +LP AN  Q+
Sbjct:   33 EFRLQNRLCDVVLKVQDKEFPAHKIVLAAASDFFSAMFSCGMAESEQSVIELKSISIDIINDILEYVYTGNIVVTNE-NVQELLPAANLTQL 123          
The following BLAST results are available for this feature:
BLAST of Spds-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KBTBD24.030e-1224.67kelch repeat and BTB domain containing 2 [Source:H... [more]
KBTBD26.868e-1224.67kelch repeat and BTB domain containing 2 [Source:H... [more]
KLHL202.313e-1132.04kelch like family member 20 [Source:HGNC Symbol;Ac... [more]
KLHL36.474e-1030.68kelch like family member 3 [Source:HGNC Symbol;Acc... [more]
KLHL38.080e-1030.68kelch like family member 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Spds-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bath-304.938e-1334.07BTB and MATH domain containing [Source:UniProtKB/... [more]
bath-131.101e-1232.81BTB and MATH domain containing [Source:UniProtKB/... [more]
bath-291.720e-1234.09BTB and MATH domain containing [Source:UniProtKB/... [more]
bath-14.895e-1230.53BTB and MATH domain containing [Source:UniProtKB/... [more]
bath-339.274e-1226.98BTB and MATH domain containing [Source:UniProtKB/... [more]
back to top
BLAST of Spds-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbo3.529e-829.13gene:FBgn0040230 transcript:FBtr0332133[more]
dbo3.867e-829.13gene:FBgn0040230 transcript:FBtr0075505[more]
kel4.053e-828.16gene:FBgn0001301 transcript:FBtr0081042[more]
kel4.142e-828.16gene:FBgn0001301 transcript:FBtr0081043[more]
CG170681.238e-725.85gene:FBgn0031098 transcript:FBtr0077341[more]
back to top
BLAST of Spds-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl40a2.017e-1230.14kelch-like family member 40a [Source:NCBI gene;Acc... [more]
klhl205.130e-1233.33kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
klhl201.436e-1133.01kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
klhl171.587e-1033.73kelch-like family member 17 [Source:ZFIN;Acc:ZDB-G... [more]
klhl171.587e-1033.73kelch-like family member 17 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Spds-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl401.340e-1239.08kelch like family member 40 [Source:NCBI gene;Acc:... [more]
usb13.583e-1232.04U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
usb19.781e-1232.48U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
klhl302.226e-1124.62kelch like family member 30 [Source:NCBI gene;Acc:... [more]
usb12.591e-1132.04U6 snRNA biogenesis phosphodiesterase 1 [Source:Xe... [more]
back to top
BLAST of Spds-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kbtbd29.084e-1325.55kelch repeat and BTB (POZ) domain containing 2 [So... [more]
Kbtbd29.084e-1325.55kelch repeat and BTB (POZ) domain containing 2 [So... [more]
Klhl201.405e-1132.04kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855][more]
Klhl201.405e-1132.04kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855][more]
Klhl61.015e-1024.50kelch-like 6 [Source:MGI Symbol;Acc:MGI:2686922][more]
back to top
BLAST of Spds-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U504|KLH40_XENLA1.892e-1240.00Kelch-like protein 40 OS=Xenopus laevis OX=8355 GN... [more]
sp|Q5EB39|KLH40_XENTR7.100e-1239.08Kelch-like protein 40 OS=Xenopus tropicalis OX=836... [more]
sp|B3DIV9|KL40A_DANRE1.523e-1130.14Kelch-like protein 40a OS=Danio rerio OX=7955 GN=k... [more]
sp|Q5RDY3|KBTB2_PONAB2.094e-1124.56Kelch repeat and BTB domain-containing protein 2 O... [more]
sp|Q8IY47|KBTB2_HUMAN3.298e-1124.67Kelch repeat and BTB domain-containing protein 2 O... [more]
back to top
BLAST of Spds-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PP333.111e-2229.90BTB domain-containing protein OS=Schistocephalus s... [more]
C1LKZ07.065e-2129.17Speckle-type POZ protein-like OS=Schistosoma japon... [more]
C1L7408.262e-2129.17Speckle-type POZ protein-like OS=Schistosoma japon... [more]
C1LKY91.370e-2029.17Speckle-type POZ protein-like OS=Schistosoma japon... [more]
Q5DG891.397e-2029.17SJCHGC09428 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of Spds-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl201.206e-1133.01kelch like family member 20 [Source:NCBI gene;Acc:... [more]
klhl201.225e-1133.01kelch like family member 20 [Source:NCBI gene;Acc:... [more]
klhl40a4.102e-1136.08kelch-like protein 40a [Source:NCBI gene;Acc:10303... [more]
kbtbd29.832e-1124.48kelch repeat and BTB domain containing 2 [Source:N... [more]
klhl171.620e-1033.73kelch like family member 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Spds-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl204.423e-1231.07kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
klhl261.183e-1027.56kelch-like family member 26 [Source:NCBI gene;Acc:... [more]
klhl21.184e-927.72kelch-like family member 2 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000002701.12.354e-929.52pep scaffold:Pmarinus_7.0:GL481646:340:4542:-1 gen... [more]
ENSPMAT00000007942.15.499e-925.00pep scaffold:Pmarinus_7.0:GL477137:5731:11302:-1 g... [more]
back to top
BLAST of Spds-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spds-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360751.668e-1331.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300511.127e-1127.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446011.540e-1030.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476481.609e-927.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471702.261e-929.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spds-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl40a5.664e-1328.39kelch-like protein 40a [Source:NCBI gene;Acc:10116... [more]
klhl201.369e-1133.01kelch like family member 20 [Source:NCBI gene;Acc:... [more]
klhl40b3.494e-1036.08kelch-like protein 40b [Source:NCBI gene;Acc:10116... [more]
klhl38.396e-1028.41kelch like family member 3 [Source:NCBI gene;Acc:1... [more]
klhl171.560e-932.53kelch like family member 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Spds-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023363.10.000e+099.64SMESG000023363.1[more]
SMESG000078106.11.297e-1133.72SMESG000078106.1[more]
SMESG000077860.15.797e-830.68SMESG000077860.1[more]
SMESG000005263.17.127e-824.16SMESG000005263.1[more]
SMESG000078467.12.834e-633.70SMESG000078467.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013882 ID=SMED30013882|Name=Spds-1|organism=Schmidtea mediterranea sexual|type=transcript|length=976bp
CGGTAAGATGCACATAGTGAACACACTTTTTAACAATGATTATAACAATA
ACTGAGAAATAGTTTTACTTTTTTATTTTAAAAATATCACATCAAGATGA
AAGCAGTTAAGAAAGATGTCTGTATTCAATTCGGGGTTGAAGAAATTCCA
GAGGAAGAGGCTGTGCCCACCGCGAGAGATGGCAAATTTCTGGTGAAAGA
TCCTTTCAGTGATATAAAATTAATTGTGAAGAATAAAGAATTTCATTGTC
ATAAAATAATGTTGAGTAATTGTTCACCTGTCTTTCAAGCGATGTTGTTG
GGCGATTTTGCAGAAAAGTCAAAGAATGAGATTGAAGTAAAAGATTTTGA
TCCAGACAATATGGAAGCTTTTCTTGAGGCTATTTATAATCCATCGTTCA
AATGTGTCAATGAAGCTGATGCAAAACTCATCCTTCCATTAGCCAATTTT
TATCAAGTAGGTCATTTAGTGAAAGAACTGGAGAATTATTTCTGTGAAAT
GTTATCCACACGGTCGGACAAATGCATTGATTACCTTCAAATGGTTCGAA
ATTTTAATTTACCGAAAATTAAGCAGACCTGCTTAGATATTATGGCGCGA
GGGACGAATAGTAGATATTTGACGGCAATCAAAGACAACGAGGCCTTGAA
GGAATTCGAAACTGATCTGTTAAGGCACCGGGTTAGAAATCTTGAAGATA
TTTTGAAAAACATTGAATTGAGCTTATCGAATCCTTGCAGTAAAGTTGAA
AAAAAAGAAACTCGAGTTCCAGTGAATTTTTGTGTCGATCATCCGGCTCC
GTTGACTCTCAAAGAAAATGGGGAGGTTTGCAACGAGTGTGTTCAAAAGT
TGAAATCACACATTAAAAATGTCTGTACGACTGAGAAAATTCGAACAACA
ATTAATTATAATAATAGAGATTCTGCATAATCGTTAAAAAAAATCTTTCC
TAAGAATTATTTCCATTTGAAACAAT
back to top

protein sequence of SMED30013882-orf-1

>SMED30013882-orf-1 ID=SMED30013882-orf-1|Name=SMED30013882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MKAVKKDVCIQFGVEEIPEEEAVPTARDGKFLVKDPFSDIKLIVKNKEFH
CHKIMLSNCSPVFQAMLLGDFAEKSKNEIEVKDFDPDNMEAFLEAIYNPS
FKCVNEADAKLILPLANFYQVGHLVKELENYFCEMLSTRSDKCIDYLQMV
RNFNLPKIKQTCLDIMARGTNSRYLTAIKDNEALKEFETDLLRHRVRNLE
DILKNIELSLSNPCSKVEKKETRVPVNFCVDHPAPLTLKENGEVCNECVQ
KLKSHIKNVCTTEKIRTTINYNNRDSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006596polyamine biosynthetic process
GO:0007275multicellular organism development
GO:0031397negative regulation of protein ubiquitination
GO:0048741skeletal muscle fiber development
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0031672A band
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR011333SKP1/BTB/POZ_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 38..136
e-value: 6.6E-21
score: 85.5
IPR000210BTB/POZ domainPFAMPF00651BTBcoord: 36..134
e-value: 3.1E-23
score: 82.1
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 38..98
score: 16.321
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 19..168
e-value: 7.0E-33
score: 115.7
NoneNo IPR availablePANTHERPTHR22743MEPRIN/TRAF-LIKE MATH FAMILY-C.ELEGANScoord: 31..220
NoneNo IPR availablePANTHERPTHR22743:SF160BTB AND MATH DOMAIN CONTAININGcoord: 31..220
NoneNo IPR availableCDDcd18186BTB_POZ_ZBTB_KLHL-likecoord: 37..119
e-value: 6.65469E-23
score: 87.6093
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 30..134