Nucleolar protein 10

Overview
NameNucleolar protein 10
Smed IDSMED30013874
Length (bp)1972
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar protein 10 (SMED30013874) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar protein 10 (SMED30013874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar protein 10 (SMED30013874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar protein 10 (SMED30013874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013874SMESG000032335.1 SmedASXL_016751SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30013874SMESG000032335.1 dd_Smed_v4_10617_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar protein 10 vs. Ensembl Human
Match: NOL10 (nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:25862])

HSP 1 Score: 221.861 bits (564), Expect = 1.321e-62
Identity = 129/419 (30.79%), Postives = 214/419 (51.07%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D RT   +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + ++++   + K+W     + GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINSVHGLFATGTIEGRVECWDPRTRNRVGLLDCALNSVTADSEINSLPTISALKFNGALTMAVGTTTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLILSADSRIVKMW---NKNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. Ensembl Human
Match: NOL10 (nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:25862])

HSP 1 Score: 179.489 bits (454), Expect = 8.965e-48
Identity = 115/417 (27.58%), Postives = 186/417 (44.60%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D RT   +  +D     ++   + + +P +  + F   L + VGT  G                                                    +GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINSVHGLFATGTIEGRVECWDPRTRNRVGLLDCALNSVTADSEINSLPTISALKFNGALTMAVGTTTG----------------------------------------------------QGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 363          
BLAST of Nucleolar protein 10 vs. Ensembl Human
Match: NOL10 (nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:25862])

HSP 1 Score: 179.874 bits (455), Expect = 1.004e-47
Identity = 117/419 (27.92%), Postives = 200/419 (47.73%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++         V  FE+                    +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D RT   +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + ++++   + K+W     + GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILAT------VVTFEI--------------------LSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINSVHGLFATGTIEGRVECWDPRTRNRVGLLDCALNSVTADSEINSLPTISALKFNGALTMAVGTTTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLILSADSRIVKMWN---KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 387          
BLAST of Nucleolar protein 10 vs. Ensembl Human
Match: NOL10 (nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:25862])

HSP 1 Score: 84.3445 bits (207), Expect = 1.526e-17
Identity = 59/238 (24.79%), Postives = 106/238 (44.54%), Query Frame = 3
Query:  522 VILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIP 1229
            V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D RT   +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + ++++   + K+W     + GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP
Sbjct:    2 VFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINSVHGLFATGTIEGRVECWDPRTRNRVGLLDCALNSVTADSEINSLPTISALKFNGALTMAVGTTTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLILSADSRIVKMWN---KNSGKIFTSLEPEHDLNDVCLYPNSGMLLTANETPKMGIYYIP 233          
BLAST of Nucleolar protein 10 vs. Ensembl Celegans
Match: nol-10 (NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:Q19974])

HSP 1 Score: 247.669 bits (631), Expect = 5.849e-72
Identity = 137/414 (33.09%), Postives = 235/414 (56.76%), Query Frame = 3
Query:  210 NGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIF---HEEKVIASVKS-VFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            N +KIY LS G ++PE++  R ++ L+ +   +  ++ +I D  MPDV+  ++++PDGK+++  G Y P +RC++L  LS+KFER  D    K+  +  DYSK VILE E+ +  H+  G   ++R     +D+  S   + L+L  +K  V  F++E+G   +    +A  + +     ++   L+  G TNG++  +D R   +   +D   + ++ ++ ++    V  +AF DPL IGVGT  G   +YD+R   RP   +D + E PI  + F    +  V+AS+ S + K+W     ++G  +A  +    +ND  + P SG+FF A+  PK+  YFIP++  AP WC  L NL   +E +  ++YD + F+T++++D+L L G IGT+ LRAYMHG+++    Y +A+
Sbjct:    7 NDVKIYNLSAGKSLPEWMSSRTRRKLEQRNTDVRQRIQLIQDFEMPDVSNTVNITPDGKYVWASGNYKPWLRCYDLNNLSLKFERGLDADVIKLIPLSDDYSKVVILEEERWIEMHAMLGRYFRMRMPCQGRDMALSEESSDLYLVGSKSEVYRFNLEQGCWLTPFESTAPLNCVQVCTEHQ---LICCGTTNGVVEAWDHRDKSLCGTLDA-GSSVNSHIGENQKVAVTSVAFSDPLHIGVGTSTGQILIYDLRAR-RPLLIKDHNNELPINKLDFIKRDDGDVVASMDSRMMKLWHE---EDGSPMAAIENTCPLNDFCRFPNSGMFFFANEAPKMLQYFIPQLGPAPKWCSYLENLTEEMEETETTVYDNYRFVTKKQLDDLGLSGLIGTNVLRAYMHGYFIDARLYNKAQ 412          
BLAST of Nucleolar protein 10 vs. Ensembl Fly
Match: l(2)34Fd (gene:FBgn0261535 transcript:FBtr0080639)

HSP 1 Score: 219.935 bits (559), Expect = 6.284e-62
Identity = 137/420 (32.62%), Postives = 219/420 (52.14%), Query Frame = 3
Query:  204 ESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVR-KAP-ISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFH--EEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETS-SQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNV 1445
            E N +KIY LS G +VP++L  RR+++   K      Q+++I D  MP V T I +SPD +++   G Y PRV+CFE+  LS+KFER  D   T    I  DYSK V L+ ++ +  H+A G   ++R     +D+ Y      +F+      +   ++ERG FL        + S +N    N +  LL  G   G +  +D RT +  S +DV  K P + E+      P V  + F++ L +GVGT  G   +YDIR   +P   ++     PIK + F+  +  V +  ++  K+W+      GK IA  ++    ND    P +G+FF A    K+ TY++P +  AP WC  L NL   +E+   +++YD + F+T +E+ EL +   +G++ L+ YMHG+++    Y +AK V
Sbjct:    5 EVNDVKIYNLSAGKSVPDWLTDRRKRSQLMKKVDSRRQIELIQDFDMPGVCTSIRMSPDQQYILATGTYKPRVKCFEVSNLSIKFERCFDAEVTTFEVISDDYSKMVFLQCDRYVEIHAAHGRHYRLRIPRFGRDMKYHKPSCDMFIVGVGRDIFRLNLERGQFL---QPFETDGSCLNACEVNPEHHLLVAGTKEGTVEAWDPRTKQRCSTLDVAMKLPGVKEF------PSVTALKFRNGLHMGVGTASGHVLIYDIR-AKQPLLVKNHLNRLPIKRLAFNPAQNAVYSLDEATLKLWDE---QTGKQIAYVESTSSFNDFCTIPDTGMFFVAQEDVKMMTYYVPAMGPAPRWCSFLDNLTEEIESEVVENVYDDYQFVTAKELAELGMEHLVGSNLLKGYMHGYFMDARLYNKAKAV 411          
BLAST of Nucleolar protein 10 vs. Ensembl Zebrafish
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:393206])

HSP 1 Score: 238.424 bits (607), Expect = 1.627e-68
Identity = 141/423 (33.33%), Postives = 224/423 (52.96%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G FL+S   D+A  +  +    N    L   G   G +  +D R    ++ +D   + I++  +   +P V  + F D L + VGT  G   +YD+R +SRP   +D  Y  PIKS+ FH   + V+++   + K+W     D GK+ ++ +    IND+   P SG+ F A+  PK+NT++IP +  AP WC  L NL   +E + +S +YD + F+TR++++ L L   IG+  LRAYMHGF++    Y + K + 
Sbjct:    1 MQVSSVNNVKIYNLSHGKSLPEWLSDRKKRVLQKKDVDIQRRIELIQDFEMPTVCTSIRVSRDGQYILAAGTYKPRVRCYDTYQLSLKFERCLDSDVVTFDILSDDYSKLVFLHIDRYVEFHSQHGHYYKTRIPKFGRDFSYHSPSCDLYFVGASSEVFRLNLEQGRFLNSLQTDAAEMNVCDI---NPVHQLFAAGTLEGRVDCWDPRVRTRVAVLDCALSSITDNTEVEGLPSVSALKFNDSLGLAVGTSTGQILVYDLR-SSRPLLVKDHYYGLPIKSLHFHNSLDLVLSADSKIIKMWNK---DNGKVFSSIEPQANINDVCLYPASGMLFTANEDPKMNTFYIPALGPAPRWCSFLDNLTEELEENPESTIYDDYKFVTRKDLESLGLAHLIGSPLLRAYMHGFFMDIRLYHKVKTMV 416          
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Match: tnfrsf10b (tumor necrosis factor receptor superfamily member 10b [Source:Xenbase;Acc:XB-GENE-941760])

HSP 1 Score: 254.603 bits (649), Expect = 1.351e-74
Identity = 146/419 (34.84%), Postives = 225/419 (53.70%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D    K   + +DYSK V L+ ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G          ++S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDAEVVKFDILSEDYSKIVFLQSDRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTDASQINVCDINPAHHLFAAGTTEGKVECWDPRTRNRVGLLDCALSSVTADMEVEGLPSVSALKFHGPLHMAVGTSTGQVVLYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMW---NKDNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Match: tnfrsf10b (tumor necrosis factor receptor superfamily member 10b [Source:Xenbase;Acc:XB-GENE-941760])

HSP 1 Score: 236.498 bits (602), Expect = 8.646e-68
Identity = 137/400 (34.25%), Postives = 213/400 (53.25%), Query Frame = 3
Query:  249 VPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            V ++L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D    K   + +DYSK V L+ ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G          ++S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:   23 VYQWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDAEVVKFDILSEDYSKIVFLQSDRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTDASQINVCDINPAHHLFAAGTTEGKVECWDPRTRNRVGLLDCALSSVTADMEVEGLPSVSALKFHGPLHMAVGTSTGQVVLYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMWNK---DNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 416          
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Match: tnfrsf10b (tumor necrosis factor receptor superfamily member 10b [Source:Xenbase;Acc:XB-GENE-941760])

HSP 1 Score: 234.958 bits (598), Expect = 1.728e-67
Identity = 141/419 (33.65%), Postives = 218/419 (52.03%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D+    I H             ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G          ++S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDK--CNIKH-------------DRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTDASQINVCDINPAHHLFAAGTTEGKVECWDPRTRNRVGLLDCALSSVTADMEVEGLPSVSALKFHGPLHMAVGTSTGQVVLYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMW---NKDNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 398          
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Match: tnfrsf10b (tumor necrosis factor receptor superfamily member 10b [Source:Xenbase;Acc:XB-GENE-941760])

HSP 1 Score: 214.542 bits (545), Expect = 3.696e-60
Identity = 136/419 (32.46%), Postives = 210/419 (50.12%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D    K   + +DYSK V L+ ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G          ++S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG                        WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDAEVVKFDILSEDYSKIVFLQSDRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTDASQINVCDINPAHHLFAAGTTEGKVECWDPRTRNRVGLLDCALSSVTADMEVEGLPSVSALKFHGPLHMAVGTSTGQVVLYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMWNK---DNGKIFTSIEPEADVNDVCLYPNSG----------------------GQWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 391          
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Match: tnfrsf10b (tumor necrosis factor receptor superfamily member 10b [Source:Xenbase;Acc:XB-GENE-941760])

HSP 1 Score: 199.904 bits (507), Expect = 6.653e-55
Identity = 128/420 (30.48%), Postives = 205/420 (48.81%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEV-CKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D+    I H             ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G                         L     +   +  +D RT   +  +D   + ++  +    +  +   + F  PLK+          LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDK--CNIKH-------------DRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQGRYL--------------------NSLQTDASSEAYLECWDPRTRNRVGLLDCALSSVTCMIAAIPLASINVGIFFNLPLKVV---------LYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMWN---KDNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 372          
BLAST of Nucleolar protein 10 vs. Ensembl Mouse
Match: Nol10 (nucleolar protein 10 [Source:MGI Symbol;Acc:MGI:2684913])

HSP 1 Score: 223.402 bits (568), Expect = 2.658e-63
Identity = 130/419 (31.03%), Postives = 214/419 (51.07%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D R  + +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + V+++   + K+W     D GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKNVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINAVHGLFATGTIEGRVECWDPRVRKRVGVLDCALNSVTADSEINSLPTISALKFNGALSMAVGTSTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLVLSADSRIVKMW---NKDSGKIFTSLEPEHDLNDVCLYPSSGMLLTANESPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Match: sp|Q6NVM6|NOL10_XENTR (Nucleolar protein 10 OS=Xenopus tropicalis OX=8364 GN=nol10 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 6.590e-74
Identity = 146/419 (34.84%), Postives = 225/419 (53.70%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PRVRC++  QLS+KFER  D    K   + +DYSK V L+ ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G          ++S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP  ++D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + +S +YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRVRCYDTYQLSLKFERCLDAEVVKFDILSEDYSKIVFLQSDRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTDASQINVCDINPAHHLFAAGTTEGKVECWDPRTRNRVGLLDCALSSVTADMEVEGLPSVSALKFHGPLHMAVGTSTGQVVLYDLRSN-RPLIAKDHQYGLPIKSIQFHSALDLVISADSRIIKMW---NKDNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKELDELGLSHLIGSPLLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Match: sp|Q7T0Q5|NOL10_XENLA (Nucleolar protein 10 OS=Xenopus laevis OX=8355 GN=nol10 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 8.774e-73
Identity = 144/419 (34.37%), Postives = 223/419 (53.22%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQ-SMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V+T I +S DG+++   G Y PR+RC++  QLS+KFER  D    K   + +DYSK V L+ ++ +  HS  G   ++R     +D  Y      L+       V   ++E+G           +S IN    N    L   G T G +  +D RT   +  +D   + ++  M+   +P V  + F  PL + VGT  G   LYD+R+N RP   +D  Y  PIKSI FH   + VI++   + K+W     D GKI  + +   ++ND+   P SG+ F A+  PK+N Y+IP +  AP WC  L NL   +E + + ++YD + F+TR+E+DEL L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSNVNDVKIYNLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVSTNIKVSRDGQYIMAAGTYKPRIRCYDTYQLSLKFERCLDSEVIKFDILSEDYSKIVFLQSDRYVELHSQHGRYYRLRIPKFGRDFAYHYPSCDLYFVGASSEVYRLNLEQG--RYLNSLQTEASQINVCDINPTHHLFAAGTTEGRVECWDPRTRSRVGLLDCALSSVTADMEVEGLPSVSALKFNGPLHMAVGTSTGQVLLYDLRSN-RPVIVKDHQYGLPIKSIQFHSALDLVISADSRIIKMW---NKDNGKIFTSIEPEADVNDVCLYPNSGMLFTANEAPKMNVYYIPALGPAPRWCSFLDNLTEELEENPENTVYDDYKFVTRKELDELGLSHLIGSPMLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Match: sp|Q802W4|NOL10_DANRE (Nucleolar protein 10 OS=Danio rerio OX=7955 GN=nol10 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 7.854e-68
Identity = 141/423 (33.33%), Postives = 224/423 (52.96%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G FL+S   D+A  +  +    N    L   G   G +  +D R    ++ +D   + I++  +   +P V  + F D L + VGT  G   +YD+R +SRP   +D  Y  PIKS+ FH   + V+++   + K+W     D GK+ ++ +    IND+   P SG+ F A+  PK+NT++IP +  AP WC  L NL   +E + +S +YD + F+TR++++ L L   IG+  LRAYMHGF++    Y + K + 
Sbjct:    1 MQVSSVNNVKIYNLSHGKSLPEWLSDRKKRVLQKKDVDIQRRIELIQDFEMPTVCTSIRVSRDGQYILAAGTYKPRVRCYDTYQLSLKFERCLDSDVVTFDILSDDYSKLVFLHIDRYVEFHSQHGHYYKTRIPKFGRDFSYHSPSCDLYFVGASSEVFRLNLEQGRFLNSLQTDAAEMNVCDI---NPVHQLFAAGTLEGRVDCWDPRVRTRVAALDCALSSITDNTEVEGLPSVSALKFNDSLGLAVGTSTGQILVYDLR-SSRPLLVKDHYYGLPIKSLHFHNSLDLVLSADSKIIKMWNK---DNGKVFSSIEPQANINDVCLYPASGMLFTANEDPKMNTFYIPALGPAPRWCSFLDNLTEELEENPESTIYDDYKFVTRKDLESLGLAHLIGSPLLRAYMHGFFMDIRLYHKVKTMV 416          
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Match: sp|Q5RJG1|NOL10_MOUSE (Nucleolar protein 10 OS=Mus musculus OX=10090 GN=Nol10 PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.859e-62
Identity = 130/419 (31.03%), Postives = 214/419 (51.07%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D R  + +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + V+++   + K+W     D GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKNVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINAVHGLFATGTIEGRVECWDPRVRKRVGVLDCALNSVTADSEINSLPTISALKFNGALSMAVGTSTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLVLSADSRIVKMW---NKDSGKIFTSLEPEHDLNDVCLYPSSGMLLTANESPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Match: sp|Q66H99|NOL10_RAT (Nucleolar protein 10 OS=Rattus norvegicus OX=10116 GN=Nol10 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 2.977e-62
Identity = 130/419 (31.03%), Postives = 214/419 (51.07%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAK 1439
            M+    N +KIY LS G ++PE+L  R+++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PRVRC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G          +++  N    N    L  TG   G +  +D R  + +  +D     ++   + + +P +  + F   L + VGT  G   LYD+R++ +P   +D  Y  PIKS+ F +  + V+++   + K+W     D GKI  + +   ++ND+   P SG+   A+  PK+  Y+IP +  AP WC  L NL   +E + +S +YD + F+T+++++ L L   IG+  LRAYMHGF++    Y + K
Sbjct:    1 MQVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCLDSEVVTFEILSDDYSKIVFLHNDRYIEFHSQSGFYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQG--RYLNPLQTDAAENNVCDINTVHGLFATGTIEGRVECWDPRVRKRVGVLDCALNSVTADSEINSLPTISALKFNGALSMAVGTSTGQVLLYDLRSD-KPLLVKDHQYGLPIKSVHFQDSLDLVLSADSRIVKMW---NKDSGKIFTSLEPEHDLNDVCLYPSSGMILTANESPKMGIYYIPVLGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTKKDLENLGLTHLIGSPFLRAYMHGFFMDIRLYHKVK 413          
BLAST of Nucleolar protein 10 vs. TrEMBL
Match: A0A0R3X562 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8571 PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 6.871e-92
Identity = 158/418 (37.80%), Postives = 244/418 (58.37%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXX--XXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCK-MAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTND-EINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKR 1433
            M  ++ NG+K+Y L+   ++PE+  +  ++ L AK     S +++IH+L MPD +T I+ +PD K+LFLLG Y PRVRC+EL  LSMKF+R  D LP+++  +  DYSKF +LE ++ +  H+AGG   + R      D+ Y+  K  L +P T   V   D+  G   +      S  S S + + Y  + D+L +G T G + G+D R+   +  +DV  +        ++V   C  +  KDPL   VGT +G+ H+YDIR  + P+ +RD +Y +PIK+I FH++KV+A V    KIW     D GK    ++T   +IN ++  P SGL   A+  PKV+ YFIP + +AP+WC  L  LI  VE    +MYD + F+TR+++ E  ++  IGT  LRAYMHG++VS++ + +
Sbjct:    1 MNVVKLNGVKVYNLTTDRSLPEWASRAEKRKLWAKDPGAESHIELIHELEMPDASTFITCTPDQKYLFLLGRYKPRVRCYELGNLSMKFDRCVDYLPSRMTCLSDDYSKFALLEEDRWIDVHAAGGHYFRFRVPRPGVDIHYTSSKCHLLIPSTGNSVYRMDLCEGRFVAPLISSSSNLSDSYSSSCYMSELDVLLSGTTRGTVQGWDLRSGEWVFNLDVCSSAPRPPELSAFVRFPCSNLTHKDPLNFAVGTAEGLLHVYDIRQTASPWHTRDSEYRWPIKTISFHDDKVLAVVARCLKIWNI---DTGKAFVGFETGPFDINWMYHFPNSGLIMLANESPKVSRYFIPLLGEAPYWCSYLDQLITEVEPDVMTMYDGYKFLTRQQLLECGMMDLIGTRFLRAYMHGYFVSSKLFAK 415          
BLAST of Nucleolar protein 10 vs. TrEMBL
Match: A0A068YCW7 (Nucleolar protein 10 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001033400 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.018e-91
Identity = 161/418 (38.52%), Postives = 242/418 (57.89%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXX--XXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDV-RKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTND-EINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKR 1433
            M  ++ NGIK+Y L+   ++PE+  +  ++ L AK     + +++IH+L MPD +T I+ SPD K+LFLLG Y PRVRC+EL  LSMKF+R  D LPT++  +  DYSKF +LE E+ +  H+AGG   + R      D+ Y+  K  L +P T   V   D+  G  ++      S  S S N + Y  + D+L +G T G+++G+D R+      +DV   AP    +          +  +DPL   VGT +G+ H+YDIR  + P+ +RD +Y  PIK+I FH++KV+A V    KIW     D GK    ++T   +IN ++  P SGL   A+  PKV+ YFIP + +AP WC  L  LI  VE    +MYD + F+TR+++ E  ++  +GT  LRAYMHG++VSN+ + +
Sbjct:    1 MNVVKLNGIKVYNLTTDRSLPEWASRVEKRKLLAKDPGAENHIELIHELEMPDASTFITCSPDQKYLFLLGRYKPRVRCYELGNLSMKFDRCVDYLPTRMTCLSDDYSKFALLEEERWIDVHAAGGHHFRFRVPRPGIDIHYTSSKCHLLIPSTGDAVYRMDLCEGRFAAPLLSPSSNLSISYNASCYMPELDVLLSGTTRGVVYGWDLRSGEWTFNLDVCSSAPRPSELNTFARFSCSNLTHRDPLNFAVGTAEGLVHIYDIRQTTSPWHTRDTEYRRPIKTISFHDDKVLAVVAHCLKIWNI---DTGKTFVGFETGPFDINWMYHFPKSGLIMLANESPKVSRYFIPLLGEAPHWCSYLDQLITEVEPDVMTMYDGYKFLTRQQLLECGMMDLVGTRFLRAYMHGYFVSNKLFMK 415          
BLAST of Nucleolar protein 10 vs. TrEMBL
Match: W6ULZ4 (Nucleolar protein OS=Echinococcus granulosus OX=6210 GN=EGR_02908 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.529e-91
Identity = 161/418 (38.52%), Postives = 242/418 (57.89%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXX--XXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDV-RKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTND-EINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKR 1433
            M  ++ NGIK+Y L+   ++PE+  +  ++ L AK     + +++IH+L MPD +T I+ SPD K+LFLLG Y PRVRC+EL  LSMKF+R  D LPT++  +  DYSKF +LE E+ +  H+AGG   + R      D+ Y+  K  L +P     V   D+  G  ++      S  S+S N + Y  + D+L +G T G+++G+D R+      +DV   AP    +K         +  +DPL   VGT +G+ H+YDIR  + P  +RD +Y  PIK+I FH++KV+A V    KIW     D GK    ++T   +IN ++  P SGL   A+  PKV+ YFIP + +AP WC  L  LI  VE    +MYD + F+TR+++ E  ++  +GT  LRAYMHG++VSN+ + +
Sbjct:    2 MNVVKLNGIKVYNLTTDRSLPEWASRAEKRKLLAKDPGAENHIELIHELEMPDASTFITCSPDQKYLFLLGRYKPRVRCYELGNLSMKFDRCVDYLPTRMTCLSDDYSKFALLEEERWIDVHAAGGHHFRFRVPRPGIDIHYTSSKCHLLIPSIGDAVYRMDLCEGRFAAPLLSSSSNLSNSYNASCYMPELDVLLSGTTRGVVYGWDLRSGEWTFNLDVCSSAPRPSELKTFARFSCSNLTHRDPLNFAVGTAEGLVHIYDIRQTTSPLHTRDTEYRRPIKTISFHDDKVLAVVAHCLKIWNI---DTGKTFVGFETGPFDINWMYHFPKSGLIMLANESPKVSRYFIPLLGEAPHWCSYLDQLITEVEPDVMTMYDGYKFLTRQQLLECGMMDLVGTRFLRAYMHGYFVSNKLFMK 416          
BLAST of Nucleolar protein 10 vs. TrEMBL
Match: A0A068WGH9 (Nucleolar protein 10 OS=Echinococcus granulosus OX=6210 GN=EgrG_001033400 PE=4 SV=1)

HSP 1 Score: 300.056 bits (767), Expect = 2.209e-90
Identity = 160/418 (38.28%), Postives = 242/418 (57.89%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXX--XXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDV-RKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTND-EINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKR 1433
            M  ++ NGIK+Y L+   ++PE+  +  ++ L AK     + +++IH+L MPD +T I+ SPD K+LFLLG Y PRVRC+EL  LSMKF+R  D LPT++  +  DYSKF +LE E+ +  H+AGG   + R      D+ Y+  K  L +P     V   D+  G  ++      S  S+S N + Y  + D+L +G T G+++G+D R+      +DV   AP    +K         +  +DPL   VGT +G+ H+YDIR  + P+ +RD +Y  PIK+I FH++KV+A V    KIW     D GK    ++T   +IN ++  P SGL   A+  PKV+ YFIP + +AP WC  L  LI  V     +MYD + F+TR+++ E  ++  +GT  LRAYMHG++VSN+ + +
Sbjct:    1 MNVVKLNGIKVYNLTTDRSLPEWASRAEKRKLLAKDPGAENHIELIHELEMPDASTFITCSPDQKYLFLLGRYKPRVRCYELGNLSMKFDRCVDYLPTRMTCLSDDYSKFALLEEERWIDVHAAGGHHFRFRVPRPGIDIHYTSSKCHLLIPSIGDAVYRMDLCEGRFAAPLLSSSSNLSNSYNASCYMPELDVLLSGTTRGVVYGWDLRSGEWTFNLDVCSSAPRPSELKTFARFSCSNLTHRDPLNFAVGTAEGLVHIYDIRQTTSPWHTRDTEYRRPIKTISFHDDKVLAVVAHCLKIWNI---DTGKTFVGFETGPFDINWMYHFPKSGLIMLANESPKVSRYFIPLLGEAPHWCSYLDQLITEVGPDVMTMYDGYKFLTRQQLLECGMMDLVGTRFLRAYMHGYFVSNKLFMK 415          
BLAST of Nucleolar protein 10 vs. TrEMBL
Match: A0A0R3U6I1 (Uncharacterized protein (Fragment) OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2383 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 8.703e-90
Identity = 156/440 (35.45%), Postives = 250/440 (56.82%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXX--XXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDV-RKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTND-EINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETY-----------KRAKNVAIAKNIR 1466
            M  ++ NGIK+Y L+   ++PE+  +  +++L  K     + +++IH+L MPD +T I+ SPD K+LFLLG Y PRVRC+EL+ LS+KF+R  D LPT++  + +DYSKF +LE E+ +  H+AGG   + R      D+ Y+P K  L +      +   D+  G  ++ +   + S +   N + +  + D+L +G T G + G+D R++     +D+   AP    M             KD L   VGT +G+ H++D+R   +P+ +RD +Y  PIK++ FHE+KV+A V    KIW     + G +   ++T   E+N ++  P SGL   A+  PKV+ YFIP + +AP+WC  L  LI  +E   ++MYD + F+TR+++ E  ++  +GT  LRAYMHG++VSN+ +            RAK VA  KN +
Sbjct:    1 MNVVKLNGIKVYNLTPERSLPEWASRAEKRSLLKKDPGAATHIELIHELEMPDASTYITCSPDQKYLFLLGRYKPRVRCYELKNLSLKFDRCVDYLPTRMTCLSEDYSKFALLEEERWVDVHAAGGHHFRFRVPRPGVDIHYAPSKCHLLITAAANAIFRMDLCEGRYATPLASPSLSDTDGFNASCFMPELDVLLSGSTAGYVQGWDLRSSEWTFNLDICSAAPRPSEMAVFSRAACTTFTHKDALNFAVGTSEGLVHIFDVRQTKQPWHTRDTEYRRPIKTVCFHEDKVLAIVAHCLKIW---NVETGSMFVGFETGPIELNWMYHFPNSGLIMIANESPKVSRYFIPLLGEAPYWCSSLDQLITELEPDVRTMYDGYKFLTRQQLLEFGMMDLVGTRFLRAYMHGYFVSNQLFLKIQEKLDSATSRAKLVASTKNTK 437          
BLAST of Nucleolar protein 10 vs. Ensembl Cavefish
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:103026756])

HSP 1 Score: 230.72 bits (587), Expect = 8.025e-66
Identity = 137/423 (32.39%), Postives = 223/423 (52.72%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEE--KVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+    N +KIY LS G ++PE+L  R+++ L+ +   +  ++++I D  MP   T I +S DG+++   G Y PR+RC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G FL+S   D+A  +  +    N    L   G   G +  +D R    ++ +D   + ++E  +   +P V  + F   L + VGT  G   L+D+R +S P   +D  Y  PI SI FHE+   V+++   + K+W     D GK+ ++ + +  I D+   PGSG+ F A+  PK+NT++IP +  AP WC  L NL   +E + +S +YD + F+TR++++ L L   IG+  LRAYMHGF++    Y + K ++
Sbjct:    1 MQVSSVNNVKIYNLSHGKSLPEWLSDRKRRALQKRDVDVLRRIELIQDFEMPTAATTIRVSRDGQYILAAGTYKPRIRCYDTYQLSLKFERCMDSDVVTFEILSDDYSKLVFLHVDRYVEFHSQHGHYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQGRFLNSLQTDAAEINVCDI---NPVHQLFAAGTVEGKVECWDPRVRSRVAVLDCALSSVTEGTEVEGLPSVSALKFNSSLGMAVGTTTGQVLLFDLR-SSHPLLVKDHYYGMPIHSINFHEQLDLVLSADSKIIKMWNK---DTGKMFSSIEPSSSITDVCVYPGSGMLFTANEDPKMNTFYIPALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKDLENLGLTHLIGSPLLRAYMHGFFMDIRLYHKVKTMS 416          
BLAST of Nucleolar protein 10 vs. Ensembl Cavefish
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:103026756])

HSP 1 Score: 173.326 bits (438), Expect = 1.580e-45
Identity = 122/432 (28.24%), Postives = 200/432 (46.30%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKA-----KAQMMTS-----QLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEE--KVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+    N +KIY LS G ++PE L      T+          ++ S     ++++I D  MP   T I +S DG+++   G Y PR+RC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G   + +   A          N     +   +  G +  +D R    ++ +D   + ++E  +   +P V  + F   L + VGT  G   L+D+R +S P   +D  Y  PI SI FHE+   V+++   + K+W     D GK+ ++ + +  I D+       L F    +    T     +  AP WC  L NL   +E + +S +YD + F+TR++++ L L   IG+  LRAYMHGF++    Y + K ++
Sbjct:    1 MQVSSVNNVKIYNLSHGKSLPECLINNSTNTINVFCFVYLTSLLCSTDVLRRIELIQDFEMPTAATTIRVSRDGQYILAAGTYKPRIRCYDTYQLSLKFERCMDSDVVTFEILSDDYSKLVFLHVDRYVEFHSQHGHYYKTRIPKFGRDFSYHYPSCDLYFVGASSEVYRLNLEQGRFLNSLQTDAAVKLSCTVFCN-----VCMVMCGGKVECWDPRVRSRVAVLDCALSSVTEGTEVEGLPSVSALKFNSSLGMAVGTTTGQVLLFDLR-SSHPLLVKDHYYGMPIHSINFHEQLDLVLSADSKIIKMWNK---DTGKMFSSIEPSSSITDVCLICTLTLSFCFFLLLSA-TVDSQALGPAPRWCSFLDNLTEELEENPESTVYDDYKFVTRKDLENLGLTHLIGSPLLRAYMHGFFMDIRLYHKVKTMS 422          
BLAST of Nucleolar protein 10 vs. Ensembl Sea Lamprey
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:393206])

HSP 1 Score: 210.69 bits (535), Expect = 1.022e-59
Identity = 131/424 (30.90%), Postives = 216/424 (50.94%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPE-YLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHE--EKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQS-MYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+    N +KIY L+ G ++PE +L  R+++ L  +   +  ++++I D  MP V   I +S DG++L   G Y PRVRC+++ QLSMKFER  D        +  DYSK V L+ ++ + FHS  GI  + R     +D  Y      L+L      V   ++E+G FL+S   D ++++       N +  L   G   G    +D R       +D   + I+     + +P +  + F   L + VGT  G   LYD+R ++RP   +D  +  PI++I F +  + V+ +   + K+W       GK   + +    IN++   P SG+ F A    K+NTY++P +  AP WC  L +L   +E + +S +YD + F+TR +++ L L   +G+  LRAYMHGF++    Y + K +A
Sbjct:    1 MQVSSINNVKIYNLNSGKSLPEQWLTDRKRRELLKQDVAVRKRINLIQDWEMPTVCNNIRVSRDGQYLLATGTYKPRVRCYDVNQLSMKFERCMDSEVVTFEILSDDYSKLVFLQCDRYVEFHSQNGIYYRTRIPKFGRDFAYHYPSCDLYLVGASSEVFRLNLEQGRFLNSFQTDGSSNNVCGI---NTEHQLFACGTAEGRAECWDPRDRTREGVLDCALSSITADKLVTGIPAISALKFHGALNMAVGTSTGQVLLYDLR-SARPLLVKDHRFGLPIRNIEFRDDLDLVVTADSRIVKMWNQ---HTGKNFTSLEPEYNINNMCLYPNSGMLFLACEASKMNTYYVPALGSAPRWCSFLDSLTEELEENPESTVYDDYKFLTRIDLEALGLTHLVGSPLLRAYMHGFFIDIRLYHKVKAMA 417          
BLAST of Nucleolar protein 10 vs. Ensembl Yeast
Match: ENP2 (Component of the SSU; required for pre-18S rRNA processing, biogenesis of the small ribosomal subunit; interacts with U3 snoRNA, Mpp10p and Bfr2p; contains WD repeats, and has homology to Spb1p [Source:SGD;Acc:S000003377])

HSP 1 Score: 189.119 bits (479), Expect = 5.909e-52
Identity = 116/434 (26.73%), Postives = 227/434 (52.30%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSK---GSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEI----DVRKAPISEYMKKSYVPEVCKMAFK-DPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIF-----HEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETS-SQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            +++  +N + +Y++S      ++P+++ K+R++ LK   +   +++++I D    + + KI +S DG++    G Y P++  ++   LS+KF+R+ D        +  D++K V L+ ++++ F + GG+    R     + ++Y+     L++  +   +   ++E+G FL        ++  +N  + NE   LL  G    ++  +D R+   +S++    ++   P           +V   +F+ D L    GT  G  ++YD+R  S P   +D  Y F IK II+      E K++   K + KIW+ +   +GK  A+ + + +IND+   PG+G+FF A+    ++TY+IP +  +P WC  L ++   +E   S ++Y  + FITR++V +LNL   +G+  LRAYMHGF+++ E Y +   +A
Sbjct:    3 LKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQ-NRVELIQDFEFSEASNKIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFL---NPFKLDTEGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPF----------QVTTTSFRNDGLTFACGTSNGYSYIYDLR-TSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIWDRL---DGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSITEELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIA 418          
BLAST of Nucleolar protein 10 vs. Ensembl Nematostella
Match: EDO37775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEV8])

HSP 1 Score: 234.572 bits (597), Expect = 5.776e-68
Identity = 138/423 (32.62%), Postives = 226/423 (53.43%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEE--KVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQ-SMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            M+  + N +KIY LS G ++PE+L +R+++TL+     +  ++++I D  MP  +T I +S D +++   G Y PRVRC++  QLS+KFER  D    K   + +DYSK V L  ++ + FH+  G   + R     +D+ Y      L++      V   ++E+G FL        ++  +N    N    L   G T G +  +D R+   +  +DV  + I +      VP V  + F+D L +GVGT  G   +YD+R +S+P   +D  Y  PI S+ + ++   V+++   + KIW   + + GK   + +    INDL   P SGL F A+  PK+  Y+IP +  AP WC  L NL   +E   Q ++YD + F+T+E+++ L L   + T+ LRAYMHGF++    Y++AK +A
Sbjct:    1 MQVSQPNNVKIYNLSAGKSLPEWLSERKRRTLQKNDIDIRRRIELIQDFEMPTASTNIQVSADNQYVMATGVYKPRVRCYDTTQLSLKFERCLDSDIVKFCILSEDYSKMVFLNSDRYVEFHAQYGRYYRTRIPKFGRDLAYHYPSCDLYMVGAGSEVYRLNLEQGKFL---NPLQTDALGMNVCDLNPVHQLFAAGTTEGRIECWDPRSRSRVGLLDVALSGIPQ-ESVDQVPAVTALRFRDGLTMGVGTSTGHVLMYDLR-SSQPLLVKDHQYGLPINSLAYQDQLGVVLSTDSKILKIW---DRETGKPFTSIEPQTNINDLCVFPDSGLLFMATESPKMLVYYIPTLGPAPRWCSFLDNLTEELEEDEQPTVYDDYKFVTKEDIEGLGLSHLMSTNLLRAYMHGFFMDMRLYQKAKTIA 415          
BLAST of Nucleolar protein 10 vs. Ensembl Medaka
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:101170969])

HSP 1 Score: 212.231 bits (539), Expect = 1.940e-59
Identity = 132/402 (32.84%), Postives = 208/402 (51.74%), Query Frame = 3
Query:  255 EYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIF--HEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQ-SMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            ++L  RR++ L+ K   +  ++++I D  MP V T I +S DG+++   G Y PR+RC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G FLSS   D+  ++  +    N    L   G ++G +  +D R    +  +D   +  S+      +P +  + F   L +GVGT  G   LYD+R +S P   +D  Y  PI S+ F  H + V++S   + KIW     D GKI ++      IND+   P SG+ F A+   K+NT++IP +  AP WC  L NL   +E S + ++YD + F+TR++++ L L   +G+S LRAYMHGF++    Y + K +A
Sbjct:   15 KWLSDRRKRQLQKKDVDVQRRIELIQDFEMPTVCTSIKVSRDGQYILATGTYKPRIRCYDTYQLSLKFERCLDSDVVAFDMLSDDYSKLVFLHCDRYVEFHSQHGQYYKTRIPKFGRDFSYHHPSCDLYFVGMSSEVYRLNLEQGRFLSSLQTDAVENNVCDI---NPVHHLFAAGTSDGKVECWDPRVRNRVGILDCALSSFSDGTDVQSLPSISALKFNGSLTMGVGTSTGQVLLYDLR-SSCPLLVKDHLYNLPITSLNFQTHLDLVLSSDSKIIKIWNK---DTGKIFSSIQPQTNINDVCIYPNSGMIFTANEDTKMNTFYIPALGPAPRWCSFLDNLTEELEESPEITVYDDYKFVTRKDLENLGLSHLVGSSLLRAYMHGFFMDMRLYHKVKTMA 409          
BLAST of Nucleolar protein 10 vs. Ensembl Medaka
Match: nol10 (nucleolar protein 10 [Source:NCBI gene;Acc:101170969])

HSP 1 Score: 198.364 bits (503), Expect = 1.445e-54
Identity = 125/373 (33.51%), Postives = 191/373 (51.21%), Query Frame = 3
Query:  342 MPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERG-FLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIF--HEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQ-SMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVA 1448
            MP V T I +S DG+++   G Y PR+RC++  QLS+KFER  D        +  DYSK V L  ++ + FHS  G   K R     +D  Y      L+       V   ++E+G FLSS   D+  ++  +    N    L   G ++G +  +D R    +  +D   +  S+      +P +  + F   L +GVGT  G   LYD+R +S P   +D  Y  PI S+ F  H + V++S   + KIW     D GKI ++      IND+   P SG+ F A+   K+NT++IP +  AP WC  L NL   +E S + ++YD + F+TR++++ L L   +G+S LRAYMHGF++    Y + K +A
Sbjct:    1 MPTVCTSIKVSRDGQYILATGTYKPRIRCYDTYQLSLKFERCLDSDVVAFDMLSDDYSKLVFLHCDRYVEFHSQHGQYYKTRIPKFGRDFSYHHPSCDLYFVGMSSEVYRLNLEQGRFLSSLQTDAVENNVCDI---NPVHHLFAAGTSDGKVECWDPRVRNRVGILDCALSSFSDGTDVQSLPSISALKFNGSLTMGVGTSTGQVLLYDLR-SSCPLLVKDHLYNLPITSLNFQTHLDLVLSSDSKIIKIWNK---DTGKIFSSIQPQTNINDVCIYPNSGMIFTANEDTKMNTFYIPALGPAPRWCSFLDNLTEELEESPEITVYDDYKFVTRKDLENLGLSHLVGSSLLRAYMHGFFMDMRLYHKVKTMA 366          
BLAST of Nucleolar protein 10 vs. Planmine SMEST
Match: SMESG000032335.1 (SMESG000032335.1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 488/534 (91.39%), Postives = 491/534 (91.95%), Query Frame = 3
Query:  186 NKMRTI---ESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVAIAKNIRKQELLNVKENHYQNNATYTXXXXXXXXXXXNVHLKAYSTDPLMAELFTSDAFIVDPNCRAYEQSMIDAXXXXXXXXXXXXXXXXXXXXXXMVDSGSDEEEALFD 1778
            NK R I   ESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPD                             E +      NADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLSSDIIDS NSSSINCAAYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIA+VKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVAIAKNIRKQELLNVKENHY+NNATYTDPIDDIPDPRINVHLKAYSTDPLMAELFTSDAFIVDPNCRAYEQSMIDAKRLSKKRNKKLLLREKAKKSKSMVDS SDEEEALFD
Sbjct:   25 NKHRAINDKESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPD-----------------------------EHI---LPENADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLSSDIIDSDNSSSINCAAYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIAAVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKNVAIAKNIRKQELLNVKENHYKNNATYTDPIDDIPDPRINVHLKAYSTDPLMAELFTSDAFIVDPNCRAYEQSMIDAKRLSKKRNKKLLLREKAKKSKSMVDSCSDEEEALFD 526          
BLAST of Nucleolar protein 10 vs. Planmine SMEST
Match: SMESG000060703.1 (SMESG000060703.1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 369/498 (74.10%), Postives = 424/498 (85.14%), Query Frame = 3
Query:  192 MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLSMPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKIAHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLFLPDTKGIVSLFDIERGFLXXXXXXXXXXXXXXXXXYNEKTDLLFTGLTNGLMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWEPIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIADAPWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRAYMHGFYVSNETYKRAKN-VAIAKNIRKQELLNVKENHYQNNATYTXXXXXXXXXXX-----NVHLKAYSTDPLMAELFTSDAFIVDPNCRAYEQSMID 1667
            MRTIE NGIKIYELSKGSA+PEYLGKRRQQ L+AK QM++SQL IIHDL+MPD+TT ISLSPDGKF+FLLGAYSPRVRC+ELEQLSMKFERN DELP+KIAH+ KDYSKFVILEGE+TL+FH+AGGI  KV C+NVIKD+IYSPFK+QLFLPD +GI+S+ D+ERG+LSS IIDS NS+ IN A +NE TD+ FTG  NGLMHG+DCR+A+IIS IDVRKAPISE+MKKSYVPEVCK+AFKDPLKIG+GTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFH++ VIA+VKSVFKIW+PIE +EGKIIATYDT  EINDL Q P SGLFFAASN+ ++ TYFIPKIADAP+WCQQLSNLIV+VET SQSMYDTHTFITREEVDELNLV +IGT ALRAYMHGFYVS ETY+RA+N + +A   R++ LLN    + Q +   T      P   +     NV LK    D   A+LFT DAFI+DP CRAYEQ++I+
Sbjct:    1 MRTIEINGIKIYELSKGSAIPEYLGKRRQQNLRAKHQMISSQLQIIHDLTMPDITTCISLSPDGKFMFLLGAYSPRVRCYELEQLSMKFERNCDELPSKIAHLGKDYSKFVILEGERTLAFHAAGGIHHKVPCENVIKDIIYSPFKSQLFLPDNQGIISVLDVERGYLSSKIIDSTNSTPINSAVFNEITDIFFTGHVNGLMHGYDCRSAKIISSIDVRKAPISEFMKKSYVPEVCKLAFKDPLKIGIGTDKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHDDLVIAAVKSVFKIWQPIEYEEGKIIATYDTLAEINDLCQYPKSGLFFAASNVSQIGTYFIPKIADAPFWCQQLSNLIVDVETDSQSMYDTHTFITREEVDELNLVDKIGTGALRAYMHGFYVSKETYQRARNALLVAARNREEVLLNDASKNQQQSMLATGNHVHDPLDDVPDPRINVQLKFLINDKRFADLFTCDAFILDPTCRAYEQAVIN 498          
The following BLAST results are available for this feature:
BLAST of Nucleolar protein 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NOL101.321e-6230.79nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
NOL108.965e-4827.58nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
NOL101.004e-4727.92nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
NOL101.526e-1724.79nucleolar protein 10 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nol-105.849e-7233.09NucleOLar protein [Source:UniProtKB/TrEMBL;Acc:Q1... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
l(2)34Fd6.284e-6232.62gene:FBgn0261535 transcript:FBtr0080639[more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nol101.627e-6833.33nucleolar protein 10 [Source:NCBI gene;Acc:393206][more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnfrsf10b1.351e-7434.84tumor necrosis factor receptor superfamily member ... [more]
tnfrsf10b8.646e-6834.25tumor necrosis factor receptor superfamily member ... [more]
tnfrsf10b1.728e-6733.65tumor necrosis factor receptor superfamily member ... [more]
tnfrsf10b3.696e-6032.46tumor necrosis factor receptor superfamily member ... [more]
tnfrsf10b6.653e-5530.48tumor necrosis factor receptor superfamily member ... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nol102.658e-6331.03nucleolar protein 10 [Source:MGI Symbol;Acc:MGI:26... [more]
back to top
BLAST of Nucleolar protein 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NVM6|NOL10_XENTR6.590e-7434.84Nucleolar protein 10 OS=Xenopus tropicalis OX=8364... [more]
sp|Q7T0Q5|NOL10_XENLA8.774e-7334.37Nucleolar protein 10 OS=Xenopus laevis OX=8355 GN=... [more]
sp|Q802W4|NOL10_DANRE7.854e-6833.33Nucleolar protein 10 OS=Danio rerio OX=7955 GN=nol... [more]
sp|Q5RJG1|NOL10_MOUSE1.859e-6231.03Nucleolar protein 10 OS=Mus musculus OX=10090 GN=N... [more]
sp|Q66H99|NOL10_RAT2.977e-6231.03Nucleolar protein 10 OS=Rattus norvegicus OX=10116... [more]
back to top
BLAST of Nucleolar protein 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3X5626.871e-9237.80Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A068YCW71.018e-9138.52Nucleolar protein 10 OS=Echinococcus multiloculari... [more]
W6ULZ44.529e-9138.52Nucleolar protein OS=Echinococcus granulosus OX=62... [more]
A0A068WGH92.209e-9038.28Nucleolar protein 10 OS=Echinococcus granulosus OX... [more]
A0A0R3U6I18.703e-9035.45Uncharacterized protein (Fragment) OS=Mesocestoide... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol108.025e-6632.39nucleolar protein 10 [Source:NCBI gene;Acc:1030267... [more]
nol101.580e-4528.24nucleolar protein 10 [Source:NCBI gene;Acc:1030267... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nol101.022e-5930.90nucleolar protein 10 [Source:NCBI gene;Acc:393206][more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ENP25.909e-5226.73Component of the SSU; required for pre-18S rRNA pr... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO377755.776e-6832.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleolar protein 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol101.940e-5932.84nucleolar protein 10 [Source:NCBI gene;Acc:1011709... [more]
nol101.445e-5433.51nucleolar protein 10 [Source:NCBI gene;Acc:1011709... [more]
back to top
BLAST of Nucleolar protein 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032335.10.000e+091.39SMESG000032335.1[more]
SMESG000060703.10.000e+074.10SMESG000060703.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013874 ID=SMED30013874|Name=Nucleolar protein 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1972bp
TTTCTTGATCAGTTTTTCCTTTAATATTTTTTATAATTCAAATTGAAAAG
ACGCTTTAAAATAAAAATCCTTTTAATTTTATCAATTGTTAAAAAAAGTA
AATGATTTAGTTTTATCAAATTTAAAGTTGTTTAAATATTTATTTATTTA
AGCATTAATTTTTAATTTTAATTAATTTTTATTACAATAAAATGCGTACT
ATAGAAAGTAATGGAATAAAAATCTACGAGTTGTCTAAAGGCAGCGCAGT
TCCAGAATACCTTGGAAAAAGAAGACAACAAACTTTAAAAGCTAAGGCTC
AAATGATGACATCGCAATTAGATATTATTCATGATTTATCAATGCCAGAT
GTAACTACAAAAATCAGTTTAAGTCCAGATGGAAAATTTTTATTTTTACT
AGGAGCATATTCCCCCAGAGTACGATGTTTTGAATTAGAACAACTTTCGA
TGAAATTCGAGAGAAATGCAGATGAATTGCCTACCAAAATTGCTCACATT
GAAAAAGATTACTCAAAGTTTGTAATCCTCGAAGGTGAAAAAACACTATC
ATTTCATTCAGCTGGTGGAATTAGTAAAAAAGTTCGATGTGATAACGTTA
TCAAAGATGTTATTTACTCACCATTTAAAAATCAATTATTTCTTCCAGAT
ACCAAGGGAATAGTATCTCTATTTGATATAGAAAGAGGATTTTTGTCAAG
TGATATTATTGATTCAGCTAATTCCTCTTCAATAAACTGTGCGGCGTACA
ATGAAAAAACTGACTTATTATTTACAGGTCTTACTAACGGGCTCATGCAT
GGATTTGATTGTAGGACAGCTAGAATAATATCGGAAATCGATGTCCGCAA
AGCCCCAATCTCTGAATACATGAAAAAGTCATACGTTCCCGAAGTTTGTA
AGATGGCCTTTAAAGACCCATTAAAAATTGGTGTTGGAACAGATAAAGGC
ATGTTTCATCTATATGATATTCGCAATAACAGCCGTCCATTTTCATCAAG
AGATTTAGACTATGAATTTCCAATAAAAAGCATAATTTTCCATGAAGAAA
AAGTTATTGCTTCAGTTAAAAGTGTTTTCAAAATCTGGGAGCCGATTGAA
GGAGACGAGGGTAAAATTATTGCAACCTATGATACTAATGATGAGATAAA
TGATCTATTCCAATGTCCTGGCAGTGGATTGTTTTTCGCCGCCTCGAACA
TACCTAAAGTAAACACGTATTTTATTCCGAAAATCGCTGACGCTCCTTGG
TGGTGTCAACAACTTAGCAATTTGATCGTTAACGTCGAAACCTCATCTCA
ATCCATGTACGATACTCACACGTTTATAACCAGAGAAGAAGTCGATGAAC
TGAATTTGGTTGGGGAAATCGGAACGAGTGCTCTCAGAGCTTACATGCAC
GGTTTCTATGTCAGTAATGAAACATATAAGCGAGCTAAAAACGTGGCAAT
AGCGAAAAATATTCGCAAACAAGAACTGTTGAATGTTAAAGAAAATCACT
ATCAAAACAATGCCACATACACAGATCCGATCGATGATATTCCCGATCCT
AGGATCAACGTCCATTTGAAAGCATATAGCACTGATCCACTGATGGCTGA
ACTGTTTACCAGTGACGCGTTCATTGTGGATCCCAACTGCAGAGCGTATG
AGCAGTCGATGATTGATGCAAAACGATTGTCTAAGAAAAGGAATAAGAAA
CTGTTATTGCGAGAAAAGGCAAAGAAATCTAAGTCGATGGTCGATTCGGG
TTCTGATGAGGAAGAAGCCTTATTTGATTGATTTTATAATATAATTTACA
TTCACAGATTTTTTATTATTTATTTTTAAATATTAGTATAATGTTATTAA
TTTGTGATAATTTTTAGTTTATTAATAAATTTCCTGTTGACCAAAACCAT
GGTGACTCGGGTAGCTAGGTTCTGTTTAATTCTTTCTTTTTAATACAAAA
ATATGAAGGAGGTTGAAATTCA
back to top

protein sequence of SMED30013874-orf-1

>SMED30013874-orf-1 ID=SMED30013874-orf-1|Name=SMED30013874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MRTIESNGIKIYELSKGSAVPEYLGKRRQQTLKAKAQMMTSQLDIIHDLS
MPDVTTKISLSPDGKFLFLLGAYSPRVRCFELEQLSMKFERNADELPTKI
AHIEKDYSKFVILEGEKTLSFHSAGGISKKVRCDNVIKDVIYSPFKNQLF
LPDTKGIVSLFDIERGFLSSDIIDSANSSSINCAAYNEKTDLLFTGLTNG
LMHGFDCRTARIISEIDVRKAPISEYMKKSYVPEVCKMAFKDPLKIGVGT
DKGMFHLYDIRNNSRPFSSRDLDYEFPIKSIIFHEEKVIASVKSVFKIWE
PIEGDEGKIIATYDTNDEINDLFQCPGSGLFFAASNIPKVNTYFIPKIAD
APWWCQQLSNLIVNVETSSQSMYDTHTFITREEVDELNLVGEIGTSALRA
YMHGFYVSNETYKRAKNVAIAKNIRKQELLNVKENHYQNNATYTDPIDDI
PDPRINVHLKAYSTDPLMAELFTSDAFIVDPNCRAYEQSMIDAKRLSKKR
NKKLLLREKAKKSKSMVDSGSDEEEALFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR040382NOL10/Enp2
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 8..347
e-value: 2.1E-12
score: 49.1
IPR040382Nucleolar protein 10/Enp2PANTHERPTHR14927UNCHARACTERIZEDcoord: 1..490
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 52..336