OFD1

Overview
NameOFD1 (AFB74720.1)
Smed IDSMED30013865
Length (bp)2784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of OFD1 (SMED30013865) t-SNE clustered cells

Violin plots show distribution of expression levels for OFD1 (SMED30013865) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of OFD1 (SMED30013865) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for OFD1 (SMED30013865) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013865

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013865SMESG000046592.1 SmedASXL_015827SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013865SMESG000046592.1 dd_Smed_v4_13339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013865SMESG000046592.1 dd_Smed_v4_13339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013865SMESG000046592.1 dd_Smed_v4_13339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013865SMESG000046592.1 dd_Smed_v6_13339_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013865SMESG000046592.1 dd_Smed_v4_13339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of OFD1 vs. Ensembl Human
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 136.732 bits (343), Expect = 3.772e-32
Identity = 145/545 (26.61%), Postives = 270/545 (49.54%), Query Frame = 3
Query:   72 YSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDK----SFILCLLKTISEYHTFKQS-EIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDL------ISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKM---------------GPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
            ++   V +    + KL +  K++G++D LKTQ+R  LI E+        L+  S      S  +   +S+S + ++L +  + ++ SVF PESG+  +K +T ++LL++++++  S  YK L S    +DK     F++  LK ++EYH  K+S  +E QT        L+EKLQ +D QF D   Q  +K + L E ++  ++R++E++LR EM  +++ FKD EI  IK  A++++ K L       E+  Q +  AL  RE+++ E   + ++ + +E Y QRQ +L+D+  ++ RE ++K+  E  E   ++ +E+HK     +  +   +K  E   + K+  E+  Y+L  +   + +   +   E K +E+  +L  E   +   KEEL +      E++L           + +QN+ L ++++E       +    +      + LLKQ++                P  E +V   EL +A      E    E  ++AL K+L +EI+    L  Q+   +  V+ L+ Q+++ K
Sbjct:    8 FTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSS--LLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVS---GSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQ-RIKFESL-EIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQRVEAFELNQKLQEEKHKSITEALRRQEQNIKSFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNHMLNEKVKEMSDYSLLKEEKLELLAQ--NKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVADLK 543          
BLAST of OFD1 vs. Ensembl Human
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 133.265 bits (334), Expect = 5.345e-31
Identity = 149/533 (27.95%), Postives = 267/533 (50.09%), Query Frame = 3
Query:   72 YSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDK----SFILCLLKTISEYHTFKQS-EIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNE--MDLISYP-------VLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
            ++   V +    + KL +  K++G++D LKTQ+R  LI E+        L+  S      S  +   +S+S + ++L +  + ++ SVF PESG+  +K +T ++LL++++++  S  YK L S    +DK     F++  LK ++EYH  K+S  +E QT        L+EKLQ +D QF D   Q  +K + L E ++  ++R++E++LR EM  +++ FKD EI  IK  A++++ K L       E+  Q +  AL  RE+++ E   + ++ + +E Y QRQ +L+D+  ++ RE ++K+  E  E     +K+ + I+ N++ E   K KE  + +  ++   +NS K  E  + V + KE+E            L+ E    + L   +TK+ ++ NE   ++  Y         L  QN  L  Q+EE + +  +              LL +   P  E +V   EL +A      E    E  ++AL K+L +EI+    L  Q+   +  V+ L+ Q+++ K
Sbjct:    8 FTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSS--LLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVS---GSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQ-RIKFESL-EIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQRVEAFELYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIA-INSKK-EELNQSVNRVKELE------------LELESVKAQSLA--ITKQNHMLNEKVKEMSDYSLLKEEKLELLAQNKLLKQQLEESRNENLR--------------LLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVADLK 503          
BLAST of OFD1 vs. Ensembl Human
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 77.411 bits (189), Expect = 8.618e-14
Identity = 106/405 (26.17%), Postives = 195/405 (48.15%), Query Frame = 3
Query:  480 LLKTISEYHTFKQS-EIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDL------ISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKM---------------GPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
             LK ++EYH  K+S  +E QT        L+EKLQ +D QF D   Q  +K + L E ++  ++R++E++LR EM  +++ FKD EI  IK  A++++ K L       E+  Q +  AL  RE+++ E   + ++ + +E Y QRQ +L+D+  ++ RE ++K+  E  E   ++ +E+HK     +  +   +K  E   + K+  E+  Y+L  +   + +   +   E K +E+  +L  E   +   KEEL +      E++L           + +QN+ L ++++E       +    +      + LLKQ++                P  E +V   EL +A      E    E  ++AL K+L +EI+    L  Q+   +  V+ L+ Q+++ K
Sbjct:    3 FLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQ-RIKFESL-EIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQRVEAFELNQKLQEEKHKSITEALRRQEQNIKSFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNHMLNEKVKEMSDYSLLKEEKLELLAQ--NKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVADLK 403          
BLAST of OFD1 vs. Ensembl Human
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 70.8626 bits (172), Expect = 2.534e-12
Identity = 74/226 (32.74%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  474 LCLLKTISEYHTFKQS-EIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQV--EERNSK-----LKELEMGINMK---ITQEVNSYK 1118
            LC+ K ++EYH  K+S  +E QT        L+EKLQ +D QF D   Q  +K + L E ++  ++R++E++LR EM  +++ FKD EI  IK  A++++ K L       E+  Q +  AL  RE+++ E   + ++ + +E Y QRQ +L+D+  ++ RE ++K+  E  E     +K+ + I+ N++  +ER +K     L+E  + IN K   + Q VN  K
Sbjct:    4 LCIFKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQR-IKFESL-EIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQRVEAFELYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVK 227          
BLAST of OFD1 vs. Ensembl Zebrafish
Match: ofd1 (OFD1 centriole and centriolar satellite protein [Source:NCBI gene;Acc:327216])

HSP 1 Score: 114.775 bits (286), Expect = 1.602e-25
Identity = 125/515 (24.27%), Postives = 256/515 (49.71%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQ-SEIEIQTDKPEKFI-PLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYK--LNEE-----KRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFN-EMDLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKM---------------GPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQL 1574
             + KL +  K +G++D LKTQ+R  LI E+ A   +   ++ S    + +  +   + +S + ++L    + +T SVF PE G+  DK  ++ ++L+++++  +   YK L S++ +    F+  LL  ++++  ++  S+   QT         L EK+Q +D ++E  + +G        E ++  ++++++++ + E+  ++Q F D EI  +K+  +E   K +    + ME+ Y+ +  AL  RE+ + E  Q+ ++ +E++ Y QRQ +LR++ +++ RE+++++  E  ++   + +E+ K   + +  R   +K +E     K+  E+  Y+  L EE     ++L +  + +     +LQ+E   ++++    E+   E+  +Q L   E       +LKQQ   L +Q+E  +   + +    +    RIS LLKQ++                P+ E  +L  EL R     K E+  LE QK  L  +L  E++   +L  QL
Sbjct:   14 MRQKLYQTFKSRGLLDTLKTQLRNQLIQELQA--PVRRGESASRRSADHTDSVLVSACNSVVVDHLRSAGYEYTLSVFQPECGLSKDKVLSSRDVLQIMKISPHMPLYKSLVSNIQSGQSGFLKSLLMELTDHSVYRDCSDNSTQTTSIAAHKESLVEKMQLIDEEYEVLRHRGDRWAS--VEAKLAEYRKEIQEQAQIELNAKLQHFMDVEIAKVKQEEKERSRKEILELRRDMEKTYELKSEALISREKNAIERLQKHQEIEEKDIYAQRQAVLREIESVRSREMELRQRMEAFDKSCALHEEKVKTMEDLLRRRELSVKTMEDSFEQKLKSELLKYQLELKEENMKRTEKLTENEERIRAEATRLQKEAAVIEAKTQDYERTSSEV--KQLLMELESSRSQASLLKQQKELLREQLENMRDYPELKKHTLELQT-RIS-LLKQQLEEKQQHNQRLTQELSAPSHEHLMLQAELRRLEAEHKLEKEELETQKNVLHTQLQHEVQQCALLKTQL 520          
BLAST of OFD1 vs. Ensembl Xenopus
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 107.071 bits (266), Expect = 4.123e-23
Identity = 170/698 (24.36%), Postives = 323/698 (46.28%), Query Frame = 3
Query:  162 TQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFED----RQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEV--NSYKLNEE-----KRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVE----KLKEELTKRQYLFNEMDLISYPVLKQQNNSLLDQI-----------EEFKXXXXXXXXXXXXDK-HRISCLLKQK-MGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKDLSYRNKCGFISSRSQNYGPYSNRNP-PTNRDSS-----------PHSPTDR-----RRRLSNFESATNE----FLHEVDEYNLPMDVE-DLTTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSK--SFKNGIEEGRRLKKTKSNELPIFFDSNSRTASFPMDN 2099
            TQ+R  LI E+  K   FN +     +  +S  + + +S+S + ++L K  + ++ SVF PE G++ +K +T  + L +L+++ NS+ YK L +       S +  L+K                 D+                QFED    R+K  +L      E +I  ++R+ME++LR EM  ++Q FKD EI  IK    E+  + +    + +E+ YQ +L  L  RE+ + E  Q+ ++ + +E Y QRQ +L+D+  ++ RE  +++  E  ER  ++  E+++     + +R  ++K +E   + K+  E+  +  +LNEE     K++ +  +  +V   KL+EE   ++ +K   E    ++KE   +   L  +M L++     +QN+ L D++           E+ K Q + +    Q D+ H+ + +L+++ + P+ E  VL  EL+R     K ++   + QKE LE +L  E+K    L  QL   +D  + L+ ++   + L ++ +   ++  ++ Y     RNP P+  D S           P    D+      R    F  A       + H     +   D + +   + K ++  L++E E + +AY +++NR++   +  G     +H   VSK  S  + + + +R  K       I  D + +  +F  DN
Sbjct:   30 TQLRNQLIHEL--KYPTFNGEPVCYLEALESDSLLHRASNSMVADHLRKCGYEYSLSVFYPECGLEKEKMFTVHDFLHLLKINPNSQLYKSLVT-------SIVALLVKCFFLIFFIFLLIKLKFIDE----------------QFEDIYPKRKKFESL------ESKISDYRREMEEQLRTEMAQKLQHFKDVEIAKIKLEETEKSQREMSDFRRELEKTYQTKLEGLVSREKNAIERLQRQQEIEAKEIYSQRQSLLKDIDIVRARESDLRQRMEAFERTQKLEAEKNRSIDEFLRKRELEVKNIEDTFDQKLKNELLRHQIELNEEYIKRTKKVSEDERRNKVEASKLREEAVVINMKKHESEQAMTRIKELEIEVDSLRAQMSLVT-----RQNHHLTDKLKETVDYPLVHEEKLKLQGEVKILKQQLDEIHKDNQILRERNLHPSPEYLVLQEELKRMESARKMDQEEFKSQKEILETQLHSEVKRSAELKAQLLNNEDSAQKLNSKV---EHLEFQLRQAQLALENEVY-----RNPKPSLVDRSVLDFTADKIVPPDIYVDKAVLKSHRSYDTFVEACGRSSPMYCHTTRPRSSSPDSDFEFVANTKARIKELEKEAEYLEEAYRKYQNRISEGATIEG-----IHLTTVSKESSLLSTVPKTKRSVK-------ILTDVSHQKVAFLEDN 671          
BLAST of OFD1 vs. Ensembl Xenopus
Match: OFD1 (OFD1 centriole and centriolar satellite protein [Source:HGNC Symbol;Acc:HGNC:2567])

HSP 1 Score: 75.0998 bits (183), Expect = 2.956e-13
Identity = 131/554 (23.65%), Postives = 261/554 (47.11%), Query Frame = 3
Query:  564 LSEKLQKLDLQFED----RQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKE-----VEVFEMKLQEEKKYLDSEK---CTVEKLKEE--LTKRQ--YLFNEM-DLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQK-MGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKDLSYRNKCGFISSRSQNYGPYSNRNP-PTNRDSS-----------PHSPTDR-----RRRLSNFESATNE----FLHEVDEYNLPMDVE-DLTTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSK--SFKNGIEEGRRLKKTKSNELPIFFDSNSRTASFPMDN 2099
            + EKL+ +D QFED    R+K  +L      E +I  ++R+ME++LR EM  ++Q FKD EI  IK    E+  + +    + +E+ YQ +L  L  RE+ + E  Q+ ++ + +E Y QRQ +L+D+  ++ RE  +++  E  ER  ++  E+++     + +R  ++K +E   + K+  E+  +++   +  +++ K+       V  MK  E ++ +   K     V+ L+ +  L  RQ  +L +++ + + YP++ ++   L  +++  K            + H+ + +L+++ + P+ E  VL  EL+R     K ++   + QKE LE +L  E+K    L  QL   +D  + L+ ++   + L ++ +   ++  ++ Y     RNP P+  D S           P    D+      R    F  A       + H     +   D + +   + K ++  L++E E + +AY +++NR++   +  G     +H   VSK  S  + + + +R  K       I  D + +  +F  DN
Sbjct:   15 VVEKLKFIDEQFEDIYPKRKKFESL------ESKISDYRREMEEQLRTEMAQKLQHFKDVEIAKIKLEETEKSQREMSDFRRELEKTYQTKLEGLVSREKNAIERLQRQQEIEAKEIYSQRQSLLKDIDIVRARESDLRQRMEAFERTQKLEAEKNRSIDEFLRKRELEVKNIEDTFDQKLKNELLRHQIELNEEYIKRTKKNHNQHAVVINMKKHESEQAMTRIKELEIEVDSLRAQMSLVTRQNHHLTDKLKETVDYPLVHEEKLKLQGEVKILK--------QQLDEIHKDNQILRERNLHPSPEYLVLQEELKRMESARKMDQEEFKSQKEILETQLHSEVKRSAELKAQLLNNEDSAQKLNSKV---EHLEFQLRQAQLALENEVY-----RNPKPSLVDRSVLDFTADKIVPPDIYVDKAVLKSHRSYDTFVEACGRSSPMYCHTTRPRSSSPDSDFEFVANTKARIKELEKEAEYLEEAYRKYQNRISEGATIEG-----IHLTTVSKESSLLSTVPKTKRSVK-------ILTDVSHQKVAFLEDN 534          
BLAST of OFD1 vs. Ensembl Mouse
Match: Ofd1 (OFD1, centriole and centriolar satellite protein [Source:MGI Symbol;Acc:MGI:1350328])

HSP 1 Score: 132.494 bits (332), Expect = 6.902e-31
Identity = 162/653 (24.81%), Postives = 321/653 (49.16%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFD---IFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTD-KSFILCLLKTISEYHTFKQS---EIEIQTDKPEKFIPLSEKLQKLDLQFED----RQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDL------ISYPVLKQQNNSLLDQIEE------FKXXXXXXXXXXXXDKHRIS-------CLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKDL-----------SYRN-KCGFISSRSQNYGPYSNRNPPTNRDSSP---HSPTDRRRRLSN-FESATNEFLHEVDEYNLP-MDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNR 1922
             + KL +  K++GV+D L+TQ+R  LI E+     +  + +     P  S +   +   +S+S + ++L +  + ++ SVF PESG+  +K +T ++LL++++++ +S  YK L S     + K F++  LK ++EY+  K+S   E +  T  P + + L+EK Q +D QF D    R K  +L+T      ++  ++++++ +L+ EM ++++ F++ EI  +K     ++ K L       E   Q +  AL  +E+ S E  ++ ++ + +E Y QRQ +L D++ ++ RE ++K+  E  E   ++ +E+ K +   +E R   LK +E   + K+  E+  Y+L  +   + +  ++   E K +E+  +L  E   +   KEEL+K      E++L        +  + +QN+ L +++ E       K++  +  + N+  K ++         LL +   P  E  +   EL++     + E    E  ++ALEK+L  EI++   L  Q+++    V+ L+ Q++E K              YRN K   I S S      S +  P + D S    + P ++ + ++    S    +++   E + P  D E + +  K K+  L++E E++ KA+  +  R
Sbjct:   20 LRKKLYQTFKDRGVLDTLQTQLRNQLIHEL-----MHPVLSGEVKPPSISVEGSALLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKIFTMQDLLQLIRINPSSSLYKSLISGFDKENKKGFLMSFLKELAEYYQAKESCDAETQTSTTFPSQ-VSLAEKFQLIDAQFADGFPHRSKLESLET------KLNEYKKEVQHQLQVEMCHKLKYFREAEITKVKMEERRKYEKELAEFQNEFERTCQAKNEALISQEKNSLERIKKHREMESKEIYAQRQLLLNDIALLRGREAELKERIETFELTQKLQEEKIKSEAEALERREQNLKNIEDTYDQKLKTELLKYQLELKDDYITRTNKLLEEERKNKEKTIHLQEELTVINSKKEELSKSVKHMKEVELELESVKAQFLAISKQNHLLNEKVREMSDYSQLKEEKVELQAQNKLLKLQLEETRNENLRLLDRITQPPPELVIFQKELQKTEKAMELEHKDFETHRQALEKQLQSEIENSAQLRTQIAEYDASVKRLTVQVAELKSQLKQTQIALENEVYRNPKHSLIHSLSGLL--LSGKMAPHSEDKSGDFLNVPLEQNKVIAGAVMSRVPPYVNTATEASSPESDFEFIASSTKAKVRELEQEAERLEKAFRTYYQR 658          
BLAST of OFD1 vs. UniProt/SwissProt
Match: sp|O75665|OFD1_HUMAN (Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.811e-31
Identity = 145/545 (26.61%), Postives = 270/545 (49.54%), Query Frame = 3
Query:   72 YSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDK----SFILCLLKTISEYHTFKQS-EIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDL------ISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKM---------------GPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
            ++   V +    + KL +  K++G++D LKTQ+R  LI E+        L+  S      S  +   +S+S + ++L +  + ++ SVF PESG+  +K +T ++LL++++++  S  YK L S    +DK     F++  LK ++EYH  K+S  +E QT        L+EKLQ +D QF D   Q  +K + L E ++  ++R++E++LR EM  +++ FKD EI  IK  A++++ K L       E+  Q +  AL  RE+++ E   + ++ + +E Y QRQ +L+D+  ++ RE ++K+  E  E   ++ +E+HK     +  +   +K  E   + K+  E+  Y+L  +   + +   +   E K +E+  +L  E   +   KEEL +      E++L           + +QN+ L ++++E       +    +      + LLKQ++                P  E +V   EL +A      E    E  ++AL K+L +EI+    L  Q+   +  V+ L+ Q+++ K
Sbjct:    8 FTVADVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLIHELMHPVLSGELQPRSISVEGSS--LLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKVFTMQDLLQLIKINPTSSLYKSLVS---GSDKENQKGFLMHFLKELAEYHQAKESCNMETQTSSTFNRDSLAEKLQLIDDQFADAYPQ-RIKFESL-EIKLNEYKREIEEQLRAEMCQKLKFFKDTEIAKIKMEAKKKYEKELTMFQNDFEKACQAKSEALVLREKSTLERIHKHQEIETKEIYAQRQLLLKDMDLLRGREAELKQRVEAFELNQKLQEEKHKSITEALRRQEQNIKSFEETYDRKLKNELLKYQLELKDDYIIRTNRLIEDERKNKEKAVHLQEELIAINSKKEELNQSVNRVKELELELESVKAQSLAITKQNHMLNEKVKEMSDYSLLKEEKLELLAQ--NKLLKQQLEESRNENLRLLNRLAQPAPELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQILGYKASVKSLTTQVADLK 543          
BLAST of OFD1 vs. UniProt/SwissProt
Match: sp|Q80Z25|OFD1_MOUSE (Oral-facial-digital syndrome 1 protein homolog OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 5.161e-30
Identity = 162/653 (24.81%), Postives = 321/653 (49.16%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFD---IFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTD-KSFILCLLKTISEYHTFKQS---EIEIQTDKPEKFIPLSEKLQKLDLQFED----RQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDL------ISYPVLKQQNNSLLDQIEE------FKXXXXXXXXXXXXDKHRIS-------CLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKDL-----------SYRN-KCGFISSRSQNYGPYSNRNPPTNRDSSP---HSPTDRRRRLSN-FESATNEFLHEVDEYNLP-MDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNR 1922
             + KL +  K++GV+D L+TQ+R  LI E+     +  + +     P  S +   +   +S+S + ++L +  + ++ SVF PESG+  +K +T ++LL++++++ +S  YK L S     + K F++  LK ++EY+  K+S   E +  T  P + + L+EK Q +D QF D    R K  +L+T      ++  ++++++ +L+ EM ++++ F++ EI  +K     ++ K L       E   Q +  AL  +E+ S E  ++ ++ + +E Y QRQ +L D++ ++ RE ++K+  E  E   ++ +E+ K +   +E R   LK +E   + K+  E+  Y+L  +   + +  ++   E K +E+  +L  E   +   KEEL+K      E++L        +  + +QN+ L +++ E       K++  +  + N+  K ++         LL +   P  E  +   EL++     + E    E  ++ALEK+L  EI++   L  Q+++    V+ L+ Q++E K              YRN K   I S S      S +  P + D S    + P ++ + ++    S    +++   E + P  D E + +  K K+  L++E E++ KA+  +  R
Sbjct:   18 LRKKLYQTFKDRGVLDTLQTQLRNQLIHEL-----MHPVLSGEVKPPSISVEGSALLIGASNSLVADHLQRCGYEYSLSVFFPESGLAKEKIFTMQDLLQLIRINPSSSLYKSLISGFDKENKKGFLMSFLKELAEYYQAKESCDAETQTSTTFPSQ-VSLAEKFQLIDAQFADGFPHRSKLESLET------KLNEYKKEVQHQLQVEMCHKLKYFREAEITKVKMEERRKYEKELAEFQNEFERTCQAKNEALISQEKNSLERIKKHREMESKEIYAQRQLLLNDIALLRGREAELKERIETFELTQKLQEEKIKSEAEALERREQNLKNIEDTYDQKLKTELLKYQLELKDDYITRTNKLLEEERKNKEKTIHLQEELTVINSKKEELSKSVKHMKEVELELESVKAQFLAISKQNHLLNEKVREMSDYSQLKEEKVELQAQNKLLKLQLEETRNENLRLLDRITQPPPELVIFQKELQKTEKAMELEHKDFETHRQALEKQLQSEIENSAQLRTQIAEYDASVKRLTVQVAELKSQLKQTQIALENEVYRNPKHSLIHSLSGLL--LSGKMAPHSEDKSGDFLNVPLEQNKVIAGAVMSRVPPYVNTATEASSPESDFEFIASSTKAKVRELEQEAERLEKAFRTYYQR 656          
BLAST of OFD1 vs. UniProt/SwissProt
Match: sp|Q7SZK7|OFD1_DANRE (Oral-facial-digital syndrome 1 protein homolog OS=Danio rerio OX=7955 GN=ofd1 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 8.058e-25
Identity = 124/515 (24.08%), Postives = 254/515 (49.32%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQ-SEIEIQTDKPEKFI-PLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKL-------NEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFN-EMDLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKM---------------GPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQL 1574
             + KL +  K +G++D LKTQ+R  LI E+ A   +   ++ S    + +  +   + +S + ++L    + +T SVF PE G+  DK  ++ ++L+++++  +   YK L S++ +    F+  LL  ++++  ++  S+   QT         L EK+Q +D ++E  + +G        E ++  ++++++++ + E+  ++Q F D EI  +K+  +E   K +    + ME+ Y+ +  AL  RE+ + E  Q+ ++ +E++ Y QRQ +LR++ +++ RE+++++  E  ++   + +E+ K   + +  R   +K +E     K+  E+  Y+L          ++L +  + +     +LQ+E   +D++    E+   E+  +Q L   E       +LKQQ   L +Q+E  +   + +    +    RIS LLKQ++                P+ E  +L  EL R     K E+  LE QK  L  +L  E++   +L  QL
Sbjct:   14 MRQKLYQTFKSRGLLDTLKTQLRNQLIQELQA--PVRRGESASRRSADHTDSVLVSACNSVVVDHLRSAGYEYTLSVFQPECGLSKDKVLSSRDVLQIMKISPHMPLYKSLVSNIQSGQSGFLKSLLMELTDHSVYRDCSDNSTQTTSIAAHKESLVEKMQLIDEEYEVLRHRGDRWAS--VEAKLAEYRKEIQEQAQIELNAKLQHFMDVEIAKVKQEEKERSRKEILELRRDMEKTYELKSEALISREKNAIERLQKHQEIEEKDIYAQRQAVLREIESVRSREMELRQRMEAFDKSCALHEEKVKTMEDLLRRRELSVKTMEDSFEQKLKSELLKYQLELKEENMKRPEKLTENEERIRAEAARLQKEAAVVDAKTEDYERKSSEV--KQLLMELESSRSQASLLKQQKELLREQLENMRDYPELKKHTLELQT-RIS-LLKQQLEEKQQHNQRLTQELSAPSHEHLMLQAELRRLEAEHKLEKEELETQKNVLHTQLQHEVQQCALLKTQL 520          
BLAST of OFD1 vs. TrEMBL
Match: H6WA38 (OFD1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 5.800e-128
Identity = 193/197 (97.97%), Postives = 196/197 (99.49%), Query Frame = 3
Query:  132 KEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRF 722
            KEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENE++ +
Sbjct:    1 KEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEVEYY 197          
BLAST of OFD1 vs. TrEMBL
Match: A0A2C9KXQ8 (LisH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068128 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.704e-51
Identity = 191/721 (26.49%), Postives = 367/721 (50.90%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFN-LKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLL-NTDKSFILCLLKTISEYHTFKQSEIEIQTD--KPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEM--------------------------DLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISE------------NKDLSYRNKCG-----FISSRSQNYGPYSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNL--------------PMDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSKSFKNGIEEGRRLKKTKSNELPIFFDSNSRTAS 2084
             +N+L   ++ +G VD +K+Q+R +L++E+  ++++   L     + PE+   + + +S+S +  +L    + +T SVF+PESG+  DK + A +LL++L +   S  Y++L ++   ++ + F+   +  +S  H    + +  QTD  K     PL EKL  +D  +  R++      +   E+R+++FQR +E R   +++ E+ R K+ EI +IK + +E   K L+   + ME  Y++R  AL  RER + E  QQ  + QERE Y QRQ IL ++  +++RE+++K+E E  +RE  + +E+ K K  ++  R  ++K+ E     ++  E+  +KL+++ R +++ + VEV E  L+E+++ L  EK  ++++K+EL  +    NE+                          D+  Y  LK+Q     +++E  + +L +  S+N++++ R   LL++   P+ E  +L  +LERA++  ++E+ V  +QK+ LE RL EE+   + L  +  +Q   ++ ++R+I +            N ++  + K G      + SR  +    S+R+   + +   H P    +R S F++   E  H VD                   +D  D+   AK++L +LD+E   + KAY +F  R+ N    I    ++   +   +S   G ++G  +  T   + PI FD N R+++
Sbjct:   13 LRNRLYHSLRNRGFVDSIKSQLRNSLVTEL--QQTVHGPLTLKDLNIPEEG-SLLHRASNSLVANHLSACQYEYTLSVFLPESGLSQDKKFEALDLLKLLNISPLSRLYQRLIAETHKDSKRGFLWQGVSEVSSLHANSINTVGCQTDLIKVGPITPLDEKLSDVDEMYASRREDYLRTGRAGAEERLLSFQRQLEDRYNTQLKMELARMKESEIATIKLSEKENSRKTLEQAKRDMERIYKDRYDALVIRERNTMERLQQQTEMQEREIYAQRQSILEEIEAVRQREVEVKREAEVNKREKRLSEERVKDKETELRRREMEIKQRESSFEQRLQNEMAQFKLDQQARFIERVQNVEVREQTLKEQERILSEEKFRLQQIKDELRDKTQRVNELETKLSECKYSEVNANKNNEYLNAKLRDMSDYSTLKEQVVLYRNELETLRTRLAEVLSMNERERGRQEELLRELRRPSPESLMLQRDLERAKESLRQEQIVFNQQKQVLEARLKEELDCNKDLMARFEEQTLQMKEMNREIVDLRQHLHMTTKALNNEVYRKAKEGLEQSQLVESRLSHKVHDSSRH-SVDLNFDDHEP----QRPSRFDADPKEIYHGVDFETFSQVRDGLYFEDDISSIDSADVIAQAKYRLKSLDQEAHNLEKAYHDFHCRITN----IHAIPLDQPAQSPPRSRVVGQQQGAIV--TSPAQSPIPFD-NPRSST 718          
BLAST of OFD1 vs. TrEMBL
Match: A0A2C9KXP3 (LisH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068128 PE=4 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 2.401e-51
Identity = 191/721 (26.49%), Postives = 367/721 (50.90%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFN-LKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLL-NTDKSFILCLLKTISEYHTFKQSEIEIQTD--KPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEM--------------------------DLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISE------------NKDLSYRNKCG-----FISSRSQNYGPYSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNL--------------PMDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSKSFKNGIEEGRRLKKTKSNELPIFFDSNSRTAS 2084
             +N+L   ++ +G VD +K+Q+R +L++E+  ++++   L     + PE+   + + +S+S +  +L    + +T SVF+PESG+  DK + A +LL++L +   S  Y++L ++   ++ + F+   +  +S  H    + +  QTD  K     PL EKL  +D  +  R++      +   E+R+++FQR +E R   +++ E+ R K+ EI +IK + +E   K L+   + ME  Y++R  AL  RER + E  QQ  + QERE Y QRQ IL ++  +++RE+++K+E E  +RE  + +E+ K K  ++  R  ++K+ E     ++  E+  +KL+++ R +++ + VEV E  L+E+++ L  EK  ++++K+EL  +    NE+                          D+  Y  LK+Q     +++E  + +L +  S+N++++ R   LL++   P+ E  +L  +LERA++  ++E+ V  +QK+ LE RL EE+   + L  +  +Q   ++ ++R+I +            N ++  + K G      + SR  +    S+R+   + +   H P    +R S F++   E  H VD                   +D  D+   AK++L +LD+E   + KAY +F  R+ N    I    ++   +   +S   G ++G  +  T   + PI FD N R+++
Sbjct:   13 LRNRLYHSLRNRGFVDSIKSQLRNSLVTEL--QQTVHGPLTLKDLNIPEEG-SLLHRASNSLVANHLSACQYEYTLSVFLPESGLSQDKKFEALDLLKLLNISPLSRLYQRLIAETHKDSKRGFLWQGVSEVSSLHANSINTVGCQTDLIKVGPITPLDEKLSDVDEMYASRREDYLRTGRAGAEERLLSFQRQLEDRYNTQLKMELARMKESEIATIKLSEKENSRKTLEQAKRDMERIYKDRYDALVIRERNTMERLQQQTEMQEREIYAQRQSILEEIEAVRQREVEVKREAEVNKREKRLSEERVKDKETELRRREMEIKQRESSFEQRLQNEMAQFKLDQQARFIERVQNVEVREQTLKEQERILSEEKFRLQQIKDELRDKTQRVNELETKLSECKYSEVNANKNNEYLNAKLRDMSDYSTLKEQVVLYRNELETLRTRLAEVLSMNERERGRQEELLRELRRPSPESLMLQRDLERAKESLRQEQIVFNQQKQVLEARLKEELDCNKDLMARFEEQTLQMKEMNREIVDLRQHLHMTTKALNNEVYRKAKEGLEQSQLVESRLSHKVHDSSRH-SVDLNFDDHEP----QRPSRFDADPKEIYHGVDFETFSQVRDGLYFEDDISSIDSADVIAQAKYRLKSLDQEAHNLEKAYHDFHCRITN----IHAIPLDQPAQSPPRSRVVGQQQGAIV--TSPAQSPIPFD-NPRSST 718          
BLAST of OFD1 vs. TrEMBL
Match: A0A3S1C016 (LisH domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_012949 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 4.857e-51
Identity = 179/686 (26.09%), Postives = 346/686 (50.44%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAK-ESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLL-NTDKSFILCLLKTISEYHTFKQSEIEIQTD--KPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEM--------------------------DLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKD---LSYR------------NKCGFISSRSQNYG---PYSNRNPPTNRDSSPHSPTDRRRRLSNFESA-------------TNEFLHEVDEYNLPM----------------DVEDLTTDAKHKLMNLDEETEQINKAYFEFKNRMAN 1931
             +N+L   ++ +G+VD +K+Q+R +L++E+         LK+     PE+   + + +S+S +  +L    + ++ SVF+PE G+  DK +   +LL++L +   S  Y++L S    ++ K F+  LL  +S  H    + +  QTD  K     PL EKL  +D  +  R+++     +   E+R+++FQR +E R   +++ E+ R +D EI +IK N +E   KA +   + +E  Y+++  AL +RER + E  QQ  + QERE Y QRQ IL ++  +++RE ++K+E E  ERE ++ + + K K + +  R  ++K+ E     ++  E+  +KL+++ R +++ + VEV E  L+E+++ +  EK +++++K++L ++ +  NE+                          D+  Y  LK+Q     +++E  + +L +  S+N++++ R   LL++   P+ E  +L  +LER ++  ++E+++  +QK+ LE RL EE+   R L  +  +Q   +  ++R++ + +    ++ R            N  G ++   Q+ G   P  +R  P     SP S   ++R  +    A             T E  H+VD   + +                D  D+   AK++L +LD+E   + KAY +F  R+ N
Sbjct:   16 LRNRLYHTLRNRGLVDSIKSQLRNSLVTELQQNVRGPLTLKDLQT--PEEG-SLLHRASNSLVANHLRACQYEYSLSVFLPECGLSQDKKFETSDLLKLLNISSQSRLYQRLASHTQQDSKKGFLWQLLSEVSSLHANSINTVGCQTDLIKMGPITPLDEKLSDVDEFYSSRREEFLRTGRAGAEERLLSFQRQLEDRYNTQLKMELARMRDAEISTIKMNEKENARKATEQARRELERVYKDKYDALVNRERNASERLQQQTEIQERETYAQRQTILEEIEAVRQREAEVKREAEVNEREKKLTERRVKDKEDDLRRRELEVKQKENSFEQRLQNEMAQFKLDQQARYIERVQNVEVREATLKEQERIVSDEKASLQQVKDQLREKTHRVNELETQISEVRYSEVNANKNNEYLNAKLRDMSDYKTLKEQVILYRNELETVRTRLAEVLSMNERERGRQEELLRELRRPSPESLMLHRDLERCKEELRQEQTLFSQQKQLLEARLKEELDRNRDLVQRFEEQNLQMREMNREVVDLRQSLHMTTRALNNEVYGKQDDNDEGDLNESRQSAGTGTPGRSRGKP-----SPASGHFKQRSSAGVRKAGRNVGPGLRLDFDTKEVYHDVDSDFVSVSQGRDGLFYEDDISSADSADIIAQAKYRLRSLDKEAHNLEKAYHDFHCRVTN 693          
BLAST of OFD1 vs. TrEMBL
Match: A0A1S3JJQ6 (oral-facial-digital syndrome 1 protein homolog OS=Lingula unguis OX=7574 GN=LOC106173529 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.003e-43
Identity = 152/553 (27.49%), Postives = 292/553 (52.80%), Query Frame = 3
Query:   12 LYEFLLKFKMSENSCDSDFTY---STKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFD--IFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLL-NTDKSFILCLLKTISEYHTFKQSEIEIQT--DKPEKFIPLSEKLQKLDLQFE----DRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEEL-----------------------TKRQYLFNEMDL---ISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMG-----PNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEE 1541
            + E+  +F +      S   Y   ++ SV +    ++KL   ++ KGV+D LK+Q+R  L+ E+       +LK      P++  D  +   +++S + ++L + +++++  VF+PESG   DK +T ++LL++L +  +S+ YK L   +  ++ K F+  LL  ++  H     +   QT  D       LS +L K+D +F+    +  K   L T    E+RI++ QR +E+R ++E + E++RFK+ +    K   +E+  K ++   K ME+ Y+ +  AL +RERA+ E  Q+ ++ QE+E Y QRQ +L ++  ++ERE++++K+ E ++RE ++ +++ K     +++R   +  LE   + ++  +V  +K+ E+ RL+++ K +EV E +L +E K L  E+   + ++EEL                       T + Y   +  L   + Y  +K++N  +  ++E  K +  +    N++++ R   LLK  MG     P  E  +L  EL+RA+D  K+E++V E QK+  + R+ EE
Sbjct:   10 IAEYFCRFSLCGTVQGSLLVYNMSTSTSVLSADELKHKLYSSLRGKGVLDSLKSQLRNKLVHELQHSVLGSSLKTKP---PQQQADSSLSLTAANSLVADHLRRCHYNYSLGVFIPESGASQDKVFTTQDLLQLLHISPHSKLYKTLTESMPESSSKGFLWQLLTALAGSHAGLSQDTSTQTSRDGHGAMSILSTRLSKVDEEFDTLLHENSKSHALGT----EERILSIQRHLEERFKEETKLELERFKETQFTKFKLQEKEKARKEIEKARKEMEQTYRAKCDALSERERAATERLQRRQEQQEKELYQQRQSLLEEIDKVREREVEVRKDLEIMKRESQLHEDKMKSWEGVLKKREDSVHRLEEEFDQRLQIDVARFKIEEQGRLLERTKNLEVQEARLSDELKRLGEEREAQQSVREELRINKARVAELEAQIQALHHEKISTSKHYEVAQERLRETVDYRSIKEENAVMKRELETTKMRQAELLHENERERQRYESLLKD-MGERTKQPTPESLLLQRELQRAQDRLKQEQAVFEHQKQQSDARIKEE 554          
BLAST of OFD1 vs. Ensembl Cavefish
Match: ENSAMXT00000030176.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000109.1:886781:901818:-1 gene:ENSAMXG00000001654.2 transcript:ENSAMXT00000030176.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 2.974e-25
Identity = 77/310 (24.84%), Postives = 168/310 (54.19%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEI-AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHT---FKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHK 1022
             + +L +  K KG++D LKTQ+R  LI E+ +  E +    +   D    S  +   +S+S + ++L +  + +T SVF PE G+  DK ++  +LL++L++   S  Y  + S++ +  K  ++ LL  +  +      + ++ +  +  P+    L EKLQ +D ++E  +++G        E ++  F+++ME++ R E++ ++Q F++ E+  ++   +E   + +      +E+ Y+ +  AL  RE+ + E  Q+ ++ +E+E Y QRQ +L+++  ++ RE +++   E  E+  ++ +E+ K
Sbjct:   11 LRKRLYQTFKNKGLLDTLKTQLRNQLIQELQSPGEPVPRGLSAKGD----SVSVL--ASNSLVIDHLHRCGYEYTLSVFYPECGLSKDKVFSTRDLLQLLKISPQSPLYTSVVSNVQSGQKGLLMNLLSELIAHRAHLQLRDADTQTSSTPPDSTQSLVEKLQVVDEEYEVLRQKGNRWAS--VEAKLAEFRKEMEEQARAELKAKLQHFQEVEVSRVRMEEQERSRREVSEIRHRLEKNYELKAEALMSREKNAIERLQKQQEIEEKEVYAQRQALLKEIETVRNREAELRLRTEAFEKTCKLHEEKVK 312          
BLAST of OFD1 vs. Ensembl Cavefish
Match: ENSAMXT00000001699.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000109.1:886781:901818:-1 gene:ENSAMXG00000001654.2 transcript:ENSAMXT00000001699.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 3.277e-25
Identity = 77/310 (24.84%), Postives = 168/310 (54.19%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEI-AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHT---FKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHK 1022
             + +L +  K KG++D LKTQ+R  LI E+ +  E +    +   D    S  +   +S+S + ++L +  + +T SVF PE G+  DK ++  +LL++L++   S  Y  + S++ +  K  ++ LL  +  +      + ++ +  +  P+    L EKLQ +D ++E  +++G        E ++  F+++ME++ R E++ ++Q F++ E+  ++   +E   + +      +E+ Y+ +  AL  RE+ + E  Q+ ++ +E+E Y QRQ +L+++  ++ RE +++   E  E+  ++ +E+ K
Sbjct:   14 LRKRLYQTFKNKGLLDTLKTQLRNQLIQELQSPGEPVPRGLSAKGD----SVSVL--ASNSLVIDHLHRCGYEYTLSVFYPECGLSKDKVFSTRDLLQLLKISPQSPLYTSVVSNVQSGQKGLLMNLLSELIAHRAHLQLRDADTQTSSTPPDSTQSLVEKLQVVDEEYEVLRQKGNRWAS--VEAKLAEFRKEMEEQARAELKAKLQHFQEVEVSRVRMEEQERSRREVSEIRHRLEKNYELKAEALMSREKNAIERLQKQQEIEEKEVYAQRQALLKEIETVRNREAELRLRTEAFEKTCKLHEEKVK 315          
BLAST of OFD1 vs. Ensembl Nematostella
Match: EDO40814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S671])

HSP 1 Score: 70.0922 bits (170), Expect = 2.737e-14
Identity = 36/118 (30.51%), Postives = 68/118 (57.63%), Query Frame = 3
Query:  114 KLLKLMKEKGVVDKLKTQVRQNLISEI--AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTD 461
            KL    + +GV+D LK+Q+R  L+ E+   A  +I + K  + D+      ++Y +++S +  +L+  NF +T SVF+PE G   DK +++ ++  +L+++  S  Y  L S L+ T+
Sbjct:   14 KLFYTFRNRGVIDSLKSQLRNRLVLELQQTANINIASGKKKTTDQTS----LYYQAANSLVANHLENCNFEYTLSVFLPECGTSKDKLFSSHDICHLLKIEPGSPLYNSLVSTLMITN 127          
BLAST of OFD1 vs. Ensembl Medaka
Match: ofd1 (OFD1 centriole and centriolar satellite protein [Source:NCBI gene;Acc:101169988])

HSP 1 Score: 114.005 bits (284), Expect = 2.574e-25
Identity = 126/541 (23.29%), Postives = 266/541 (49.17%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEI-----AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHT-FKQSEIEIQTDKPEKFI-PLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEV-------EVFEMKLQEEKKYLD------SEKCT-VEKLKEELTKRQ----YLFNEMDLI--------SYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
             + +L +  K KG +D LK Q+R  LI E+       +E +  L       P K+  +   + +S + ++L  + + +T SVF PESG+  DK    ++LL++L+++  S+ YK +     N +K F+  LL  ++ ++    + + + QT     +   L EK++ +D ++E   K         ++ ++ A++R++E ++   M  ++  FK+ E+  ++   + +F+K   +  + +E  Y+ +  AL +RE+ + E  Q+ K+ +E++ Y QRQ  L+D+ +++ RE +++   E  E+  ++  E+ K     +  R   +K +E     K+  E++SY+L  ++  +++ +++        V   ++Q+E   L+      S  C  +++L+ +L   Q     L  + DL+         YP L+++   L +Q++  K+QL++    N++       L  +   P+ EQ  L  EL+R ++  + +    + Q+E L+ +L  E      L  QL   Q+  + ++  + E K
Sbjct:   15 LRKRLYQTFKSKGFLDSLKAQLRNQLIQELKHPPLTGQEPVPRLV------PLKTDTLLASACNSIVADHLQASGYEYTLSVFCPESGLNKDKVLKKDDLLQILKINPESKLYKSVACKE-NDNKGFLFNLLTHLTSHNAPSPRQDADAQTTTASNYGESLVEKMKTIDKEYEHFNKDQMFS----FQSKLAAYKREIETQMEASMNVKLHHFKEVEMAKVRLEEKSKFHKEFDNLKRELERNYEMKAKALMEREKNAIEGLQKHKEIEEKDMYMQRQSTLKDIESLRYRENELRMRMEAFEKTCQIHAEKVKTAEELLRRRELAVKTMEDTYEQKLKNELSSYQLELKEEFIKRTEKLTENENRNRVEAARIQQESAALNARSEEHSRTCAKLKQLQADLDTAQQQISLLTQQKDLLRERLESTSDYPSLRRERTELQEQMQLLKKQLEEVREENRR-------LHAEMATPSKEQLALQVELQRLQNARRLDEEDFDNQREVLQAQLQNESDRCAQLKAQLLDHQERAQWMNSHVEELK 537          
BLAST of OFD1 vs. Ensembl Medaka
Match: ofd1 (OFD1 centriole and centriolar satellite protein [Source:NCBI gene;Acc:101169988])

HSP 1 Score: 112.849 bits (281), Expect = 5.048e-25
Identity = 126/541 (23.29%), Postives = 266/541 (49.17%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEI-----AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHT-FKQSEIEIQTDKPEKFI-PLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEV-------EVFEMKLQEEKKYLD------SEKCT-VEKLKEELTKRQ----YLFNEMDLI--------SYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
             + +L +  K KG +D LK Q+R  LI E+       +E +  L       P K+  +   + +S + ++L  + + +T SVF PESG+  DK    ++LL++L+++  S+ YK +     N +K F+  LL  ++ ++    + + + QT     +   L EK++ +D ++E   K         ++ ++ A++R++E ++   M  ++  FK+ E+  ++   + +F+K   +  + +E  Y+ +  AL +RE+ + E  Q+ K+ +E++ Y QRQ  L+D+ +++ RE +++   E  E+  ++  E+ K     +  R   +K +E     K+  E++SY+L  ++  +++ +++        V   ++Q+E   L+      S  C  +++L+ +L   Q     L  + DL+         YP L+++   L +Q++  K+QL++    N++       L  +   P+ EQ  L  EL+R ++  + +    + Q+E L+ +L  E      L  QL   Q+  + ++  + E K
Sbjct:   15 LRKRLYQTFKSKGFLDSLKAQLRNQLIQELKHPPLTGQEPVPRLV------PLKTDTLLASACNSIVADHLQASGYEYTLSVFCPESGLNKDKVLKKDDLLQILKINPESKLYKSVACKE-NDNKGFLFNLLTHLTSHNAPSPRQDADAQTTTASNYGESLVEKMKTIDKEYEHFNKDQMFS----FQSKLAAYKREIETQMEASMNVKLHHFKEVEMAKVRLEEKSKFHKEFDNLKRELERNYEMKAKALMEREKNAIEGLQKHKEIEEKDMYMQRQSTLKDIESLRYRENELRMRMEAFEKTCQIHAEKVKTAEELLRRRELAVKTMEDTYEQKLKNELSSYQLELKEEFIKRTEKLTENENRNRVEAARIQQESAALNARSEEHSRTCAKLKQLQADLDTAQQQISLLTQQKDLLRERLESTSDYPSLRRERTELQEQMQLLKKQLEEVREENRR-------LHAEMATPSKEQLALQVELQRLQNARRLDEEDFDNQREVLQAQLQNESDRCAQLKAQLLDHQERAQWMNSHVEELK 537          
BLAST of OFD1 vs. Ensembl Medaka
Match: ofd1 (OFD1 centriole and centriolar satellite protein [Source:NCBI gene;Acc:101169988])

HSP 1 Score: 90.5077 bits (223), Expect = 4.564e-18
Identity = 126/580 (21.72%), Postives = 266/580 (45.86%), Query Frame = 3
Query:  105 FQNKLLKLMKEKGVVDKLKTQVRQNLISEI-----AAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHT-FKQSEIEIQTDKPEKFI-PLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEI---------------------------------------QRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEV-------EVFEMKLQEEKKYLD------SEKCT-VEKLKEELTKRQ----YLFNEMDLI--------SYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENK 1628
             + +L +  K KG +D LK Q+R  LI E+       +E +  L       P K+  +   + +S + ++L  + + +T SVF PESG+  DK    ++LL++L+++  S+ YK +     N +K F+  LL  ++ ++    + + + QT     +   L EK++ +D ++E   K         ++ ++ A++R++E ++   M  ++                                         FK+ E+  ++   + +F+K   +  + +E  Y+ +  AL +RE+ + E  Q+ K+ +E++ Y QRQ  L+D+ +++ RE +++   E  E+  ++  E+ K     +  R   +K +E     K+  E++SY+L  ++  +++ +++        V   ++Q+E   L+      S  C  +++L+ +L   Q     L  + DL+         YP L+++   L +Q++  K+QL++    N++       L  +   P+ EQ  L  EL+R ++  + +    + Q+E L+ +L  E      L  QL   Q+  + ++  + E K
Sbjct:   15 LRKRLYQTFKSKGFLDSLKAQLRNQLIQELKHPPLTGQEPVPRLV------PLKTDTLLASACNSIVADHLQASGYEYTLSVFCPESGLNKDKVLKKDDLLQILKINPESKLYKSVACKE-NDNKGFLFNLLTHLTSHNAPSPRQDADAQTTTASNYGESLVEKMKTIDKEYEHFNKDQMFS----FQSKLAAYKREIETQMEASMNVKVFILTHAYMHAGLCTQSIVSDFIFVAPPIPELYVFFFFKLHHFKEVEMAKVRLEEKSKFHKEFDNLKRELERNYEMKAKALMEREKNAIEGLQKHKEIEEKDMYMQRQSTLKDIESLRYRENELRMRMEAFEKTCQIHAEKVKTAEELLRRRELAVKTMEDTYEQKLKNELSSYQLELKEEFIKRTEKLTENENRNRVEAARIQQESAALNARSEEHSRTCAKLKQLQADLDTAQQQISLLTQQKDLLRERLESTSDYPSLRRERTELQEQMQLLKKQLEEVREENRR-------LHAEMATPSKEQLALQVELQRLQNARRLDEEDFDNQREVLQAQLQNESDRCAQLKAQLLDHQERAQWMNSHVEELK 576          
BLAST of OFD1 vs. Planmine SMEST
Match: SMESG000046592.1 (SMESG000046592.1)

HSP 1 Score: 1649.03 bits (4269), Expect = 0.000e+0
Identity = 888/896 (99.11%), Postives = 891/896 (99.44%), Query Frame = 3
Query:   39 MSENSCDSDFTYSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDLISYPVLKQQNNSLLDQIEEFKXXXXXXXXXXXXDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQQDLVEMLSRQISENKDLSYRNKCGFISSRSQNYGPYSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNLPMDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSKSFKNGIEEGRRLKKTKSNELPIFFDSNSRTASFPMDNEELLPKILETDISNNHEMNIAKTNYYEREITMRNDENYETESDNPVEVSHIPNIYNYTNETNNVNPDVPNIVENDNKSVSNLDSEPNPDSDVINLDQDWRNTNYDAKNQKFVVSNERDKVDNSATKMRXXXXXXXXXXXIDPVXXXXXXXXXXXXXTEMFPGNTDNPGINPAKVPRXXXXXXXXXXXXXXXXXXXXXXXXXXPIQSESE 2726
            MSENS DSDFTYSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDLISYPVLKQQNNSLLDQIEEFKQQLQQQNSINQQDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQ DLVEMLSRQISENKDLSYRNKCGFISSRSQNYGPYSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNLPMDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNR+ANSFSKIGEFHVELHPELVSKSFKNGIEEGRRLK TKSNELPIFFDSNSRT SFPMDNEELLPKILETDIS+NHEMNIAKTNYYEREITMRNDENYETESDNPVEVS IPNIYNYTNETNNVNPDVPNIVENDNKSVSNLDSEPNPDSDVINLDQDWRNTNYDAKNQKFVVSNERDKVDNSATKMRNEG+DDGENDEIDPVMKKYMELLKKKKETEMFPGNTDNPGINPAKVPRISESEQESEIIKSISENSNMSNKKESPIQSESE
Sbjct:    1 MSENSYDSDFTYSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLISEIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVFVPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLKTISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQLYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKSKLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLSNIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINMKITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKEELTKRQYLFNEMDLISYPVLKQQNNSLLDQIEEFKQQLQQQNSINQQDKHRISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLEEIKSKRILTDQLSQQHDLVEMLSRQISENKDLSYRNKCGFISSRSQNYGPYSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNLPMDVEDLTTDAKHKLMNLDEETEQINKAYFEFKNRIANSFSKIGEFHVELHPELVSKSFKNGIEEGRRLKNTKSNELPIFFDSNSRTGSFPMDNEELLPKILETDISDNHEMNIAKTNYYEREITMRNDENYETESDNPVEVSPIPNIYNYTNETNNVNPDVPNIVENDNKSVSNLDSEPNPDSDVINLDQDWRNTNYDAKNQKFVVSNERDKVDNSATKMRNEGEDDGENDEIDPVMKKYMELLKKKKETEMFPGNTDNPGINPAKVPRISESEQESEIIKSISENSNMSNKKESPIQSESE 896          
The following BLAST results are available for this feature:
BLAST of OFD1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
OFD13.772e-3226.61OFD1 centriole and centriolar satellite protein [S... [more]
OFD15.345e-3127.95OFD1 centriole and centriolar satellite protein [S... [more]
OFD18.618e-1426.17OFD1 centriole and centriolar satellite protein [S... [more]
OFD12.534e-1232.74OFD1 centriole and centriolar satellite protein [S... [more]
back to top
BLAST of OFD1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OFD1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OFD1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ofd11.602e-2524.27OFD1 centriole and centriolar satellite protein [S... [more]
back to top
BLAST of OFD1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OFD14.123e-2324.36OFD1 centriole and centriolar satellite protein [S... [more]
OFD12.956e-1323.65OFD1 centriole and centriolar satellite protein [S... [more]
back to top
BLAST of OFD1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ofd16.902e-3124.81OFD1, centriole and centriolar satellite protein [... [more]
back to top
BLAST of OFD1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|O75665|OFD1_HUMAN1.811e-3126.61Oral-facial-digital syndrome 1 protein OS=Homo sap... [more]
sp|Q80Z25|OFD1_MOUSE5.161e-3024.81Oral-facial-digital syndrome 1 protein homolog OS=... [more]
sp|Q7SZK7|OFD1_DANRE8.058e-2524.08Oral-facial-digital syndrome 1 protein homolog OS=... [more]
back to top
BLAST of OFD1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA385.800e-12897.97OFD1 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A2C9KXQ81.704e-5126.49LisH domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9KXP32.401e-5126.49LisH domain-containing protein OS=Biomphalaria gla... [more]
A0A3S1C0164.857e-5126.09LisH domain-containing protein OS=Elysia chlorotic... [more]
A0A1S3JJQ61.003e-4327.49oral-facial-digital syndrome 1 protein homolog OS=... [more]
back to top
BLAST of OFD1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000030176.12.974e-2524.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000001699.23.277e-2524.84pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of OFD1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OFD1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OFD1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO408142.737e-1430.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of OFD1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ofd12.574e-2523.29OFD1 centriole and centriolar satellite protein [S... [more]
ofd15.048e-2523.29OFD1 centriole and centriolar satellite protein [S... [more]
ofd14.564e-1821.72OFD1 centriole and centriolar satellite protein [S... [more]
back to top
BLAST of OFD1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000046592.10.000e+099.11SMESG000046592.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013865
GenBankAFB74720.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013865 ID=SMED30013865|Name=OFD1|organism=Schmidtea mediterranea sexual|type=transcript|length=2784bp
CTATATAAATCTTATATGAATTTCTATTAAAATTTAAAATGAGTGAAAAT
TCCTGTGACAGCGATTTTACTTATTCAACTAAATCAGTAAAAACGGATTT
AAATTTTCAAAATAAACTTTTGAAGTTGATGAAAGAAAAAGGTGTTGTTG
ATAAATTGAAAACACAAGTTAGACAAAATCTCATATCGGAAATAGCGGCA
AAAGAATCCATTTTCAATTTAAAGAATAATTCCAACGATAAACCAGAAAA
GTCTTTTGATATATTTTACCATTCTTCGTCCAGTGCGATTTATGAATATT
TAGATAAAAATAATTTTCATTTCACTAAAAGTGTCTTTGTACCAGAGTCT
GGAATAAAAAATGATAAGTTTTATACTGCCGAAGAATTATTGCGGGTTTT
GCAATTGGACAAAAATTCGGAATTTTACAAAAAATTGCAATCCGATTTAT
TAAATACAGACAAGAGTTTTATTTTATGTTTATTGAAAACGATTTCTGAG
TATCATACTTTCAAGCAAAGTGAAATTGAAATACAAACCGACAAGCCGGA
AAAGTTTATCCCATTAAGTGAGAAATTGCAAAAACTCGATTTACAATTCG
AAGATCGACAAAAACAAGGAACTCTTAAAACTCAACAACTTTATGAAGAT
CGAATTGTTGCTTTTCAACGGGACATGGAAAAAAGATTACGCCAAGAAAT
GGAAAATGAGATTCAAAGATTCAAGGATCACGAAATATTATCCATTAAAC
GAAATGCCGAAGAAGAATTCAATAAAGCTCTTAAAAGCAAATTGAAGATT
ATGGAAGAAGAATATCAAAATAGGCTGGCCGCTCTCAAAGACAGAGAACG
AGCATCTCAAGAAAACCATCAGCAATTTAAAGACAGTCAAGAAAGAGAGA
ATTATTTTCAAAGACAGCAAATATTGAGAGATTTATCAAATATACAAGAA
CGTGAATTGCAGATGAAAAAGGAAAAAGAACATTTGGAACGTGAATTTGA
AATGATGAAAGAACAGCACAAAATAAAATTGAATCAAGTAGAGGAGAGAA
ATTCTAAACTGAAAGAATTGGAAATGGGAATTAATATGAAAATCACTCAA
GAAGTCAACAGCTATAAACTCAATGAAGAAAAGCGCTTAGTTCAAAAATG
GAAGGAAGTCGAAGTTTTCGAAATGAAACTTCAAGAAGAAAAAAAGTATC
TGGATTCTGAAAAGTGCACAGTGGAAAAATTAAAAGAAGAATTAACAAAA
AGACAATACTTATTCAATGAAATGGACCTAATTTCTTACCCAGTTCTGAA
ACAGCAAAATAATTCATTGCTCGATCAAATAGAAGAATTTAAACAGCAAC
TTCAACAACAAAATAGTATCAATCAACAAGACAAACACAGAATATCATGT
TTGTTAAAACAAAAAATGGGTCCAAATTTTGAACAATCAGTTCTTTCAAA
TGAATTAGAGCGTGCTAGAGATATTTTCAAAAGAGAACGATCTGTACTTG
AAGAACAGAAAGAAGCACTTGAGAAAAGATTGTTAGAAGAGATAAAAAGC
AAACGTATTCTAACAGATCAGCTCTCTCAGCAGCAAGATCTAGTTGAAAT
GTTATCACGTCAAATTTCAGAGAACAAAGATCTATCTTACAGAAACAAAT
GCGGCTTCATTTCTAGCCGAAGTCAAAACTATGGTCCATACTCCAATCGT
AATCCTCCTACAAACCGAGACTCATCTCCACATTCTCCTACTGACCGTCG
TAGAAGGCTGTCAAATTTTGAGTCAGCAACAAACGAATTCCTTCATGAAG
TTGATGAATACAACCTTCCAATGGATGTTGAAGATTTAACAACCGATGCC
AAGCATAAGCTTATGAATCTAGATGAAGAAACTGAGCAAATTAATAAAGC
TTATTTTGAATTCAAGAATCGAATGGCCAATTCGTTTTCTAAAATCGGAG
AATTTCATGTCGAATTGCATCCGGAATTAGTTTCCAAATCTTTCAAAAAT
GGTATAGAGGAAGGCCGCAGATTGAAAAAAACAAAATCTAATGAACTGCC
AATTTTCTTTGATTCTAACTCTCGTACGGCCTCGTTTCCCATGGATAATG
AAGAACTTTTACCAAAAATTCTAGAAACTGATATTTCAAATAATCATGAA
ATGAATATAGCTAAGACAAATTATTATGAAAGAGAAATTACTATGAGAAA
TGATGAAAACTATGAAACGGAATCTGATAATCCTGTTGAAGTGTCCCATA
TTCCGAATATTTATAATTATACCAATGAAACAAATAATGTAAATCCTGAT
GTACCCAATATCGTAGAAAATGATAATAAATCAGTTTCAAATCTTGATTC
TGAACCAAATCCTGATTCTGACGTAATCAATTTAGATCAAGATTGGCGCA
ATACTAATTATGACGCAAAAAATCAAAAATTTGTGGTATCAAACGAACGT
GACAAAGTCGACAATTCAGCAACTAAGATGAGAAATGAAGGTGATGATGA
TGGGGAAAATGATGAAATTGATCCAGTTATGAAGAAATATATGGAATTAT
TAAAGAAGAAAAAGGAAACTGAAATGTTTCCTGGAAACACGGATAATCCT
GGCATTAATCCTGCAAAAGTTCCTCGAATATCTGAAAGTGAACAAGAATC
AGAAATAATTAAATCTATATCTGAAAATTCAAACATGTCAAATAAAAAGG
AAAGTCCAATACAAAGTGAATCAGAATCTTTTTGGTGAATTAAAAGCAAA
TTGTTGATAATTTTTTAATTATGTAATAAATGAG
back to top

protein sequence of SMED30013865-orf-1

>SMED30013865-orf-1 ID=SMED30013865-orf-1|Name=SMED30013865-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=900bp
MSENSCDSDFTYSTKSVKTDLNFQNKLLKLMKEKGVVDKLKTQVRQNLIS
EIAAKESIFNLKNNSNDKPEKSFDIFYHSSSSAIYEYLDKNNFHFTKSVF
VPESGIKNDKFYTAEELLRVLQLDKNSEFYKKLQSDLLNTDKSFILCLLK
TISEYHTFKQSEIEIQTDKPEKFIPLSEKLQKLDLQFEDRQKQGTLKTQQ
LYEDRIVAFQRDMEKRLRQEMENEIQRFKDHEILSIKRNAEEEFNKALKS
KLKIMEEEYQNRLAALKDRERASQENHQQFKDSQERENYFQRQQILRDLS
NIQERELQMKKEKEHLEREFEMMKEQHKIKLNQVEERNSKLKELEMGINM
KITQEVNSYKLNEEKRLVQKWKEVEVFEMKLQEEKKYLDSEKCTVEKLKE
ELTKRQYLFNEMDLISYPVLKQQNNSLLDQIEEFKQQLQQQNSINQQDKH
RISCLLKQKMGPNFEQSVLSNELERARDIFKRERSVLEEQKEALEKRLLE
EIKSKRILTDQLSQQQDLVEMLSRQISENKDLSYRNKCGFISSRSQNYGP
YSNRNPPTNRDSSPHSPTDRRRRLSNFESATNEFLHEVDEYNLPMDVEDL
TTDAKHKLMNLDEETEQINKAYFEFKNRMANSFSKIGEFHVELHPELVSK
SFKNGIEEGRRLKKTKSNELPIFFDSNSRTASFPMDNEELLPKILETDIS
NNHEMNIAKTNYYEREITMRNDENYETESDNPVEVSHIPNIYNYTNETNN
VNPDVPNIVENDNKSVSNLDSEPNPDSDVINLDQDWRNTNYDAKNQKFVV
SNERDKVDNSATKMRNEGDDDGENDEIDPVMKKYMELLKKKKETEMFPGN
TDNPGINPAKVPRISESEQESEIIKSISENSNMSNKKESPIQSESESFW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006594LisH
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0042802identical protein binding
GO:0043014alpha-tubulin binding
GO:0043015gamma-tubulin binding
Vocabulary: biological process
TermDefinition
GO:0000086G2/M transition of mitotic cell cycle
GO:0030030cell projection organization
GO:0060271cilium morphogenesis
GO:0060287epithelial cilium movement involved in determination of left/right asymmetry
GO:0097711ciliary basal body docking
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005929cilium
GO:0016020membrane
GO:0034451centriolar satellite
GO:0036064ciliary basal body
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 218..238
NoneNo IPR availableCOILSCoilCoilcoord: 306..351
NoneNo IPR availableCOILSCoilCoilcoord: 424..451
NoneNo IPR availableCOILSCoilCoilcoord: 245..283
NoneNo IPR availableCOILSCoilCoilcoord: 477..511
NoneNo IPR availableCOILSCoilCoilcoord: 388..408
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 552..578
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 808..834
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 552..570
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 881..906
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 849..906
NoneNo IPR availablePANTHERPTHR15431FGFR1 ONCOGENE PARTNER/LISH DOMAIN-CONTAINING PROTEINcoord: 29..641
NoneNo IPR availablePANTHERPTHR15431:SF14ORAL-FACIAL-DIGITAL SYNDROME 1 PROTEINcoord: 29..641
IPR006594LIS1 homology motifPFAMPF16045LisH_2coord: 89..113
e-value: 1.8E-8
score: 33.2
IPR006594LIS1 homology motifPROSITEPS50896LISHcoord: 83..115
score: 7.913