homeobox protein meis-like protein

Overview
Namehomeobox protein meis-like protein (AKG62112.1)
Smed IDSMED30013860
Length (bp)2613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of homeobox protein meis-like protein (SMED30013860) t-SNE clustered cells

Violin plots show distribution of expression levels for homeobox protein meis-like protein (SMED30013860) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of homeobox protein meis-like protein (SMED30013860) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for homeobox protein meis-like protein (SMED30013860) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013860

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30013860SMESG000071247.1 dd_Smed_v4_7863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013860SMESG000071247.1 dd_Smed_v4_7863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013860SMESG000071247.1 dd_Smed_v4_7863_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30013860SMESG000071247.1 dd_Smed_v4_7863_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 74.7146 bits (182), Expect = 3.176e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  139 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 198          
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 75.0998 bits (183), Expect = 6.932e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  192 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 251          
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 75.0998 bits (183), Expect = 6.932e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  192 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 251          
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Match: MEIS3 (Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537])

HSP 1 Score: 73.1738 bits (178), Expect = 1.317e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  141 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 200          
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 75.8702 bits (185), Expect = 1.355e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.7886 bits (177), Expect = 5.189e-13
Identity = 36/66 (54.55%), Postives = 44/66 (66.67%), Query Frame = 3
Query: 1866 VGLSRTN--LPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            +G SR     P QA   L  WL  +L  PYPSEE+K +LA ETGL+   VNNWFINARRR V+P++
Sbjct:  312 IGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 377          
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.7886 bits (177), Expect = 5.326e-13
Identity = 36/66 (54.55%), Postives = 44/66 (66.67%), Query Frame = 3
Query: 1866 VGLSRTN--LPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            +G SR     P QA   L  WL  +L  PYPSEE+K +LA ETGL+   VNNWFINARRR V+P++
Sbjct:  349 IGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 414          
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 72.7886 bits (177), Expect = 6.368e-13
Identity = 36/66 (54.55%), Postives = 44/66 (66.67%), Query Frame = 3
Query: 1866 VGLSRTN--LPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            +G SR     P QA   L  WL  +L  PYPSEE+K +LA ETGL+   VNNWFINARRR V+P++
Sbjct:  386 IGKSRGRGIFPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 451          
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 68.9366 bits (167), Expect = 8.416e-12
Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 3
Query: 1920 WLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            WL  +L  PYPSEE+K +LA ETGL+   VNNWFINARRR V+P++
Sbjct:  336 WLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 381          
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 68.9366 bits (167), Expect = 9.116e-12
Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 3
Query: 1920 WLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            WL  +L  PYPSEE+K +LA ETGL+   VNNWFINARRR V+P++
Sbjct:  373 WLFHNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRRIVQPMI 418          
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 73.9442 bits (180), Expect = 2.234e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  IL  WL  HL  PYPSE++K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  354 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 413          
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 73.9442 bits (180), Expect = 2.481e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  IL  WL  HL  PYPSE++K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  369 RGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 428          
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Match: vis (gene:FBgn0033748 transcript:FBtr0087944)

HSP 1 Score: 59.6918 bits (143), Expect = 7.655e-9
Identity = 28/61 (45.90%), Postives = 36/61 (59.02%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQ 2060
            R NLP  + KIL  WL  H    YPS+ EK  L+ E  L+   V NWFINARRR +  +++
Sbjct:   95 RGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIR 155          
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Match: achi (gene:FBgn0033749 transcript:FBtr0087943)

HSP 1 Score: 58.9214 bits (141), Expect = 1.101e-8
Identity = 28/61 (45.90%), Postives = 36/61 (59.02%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQ 2060
            R NLP  + KIL  WL  H    YPS+ EK  L+ E  L+   V NWFINARRR +  +++
Sbjct:   97 RGNLPKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIR 157          
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Match: vis (gene:FBgn0033748 transcript:FBtr0087945)

HSP 1 Score: 58.9214 bits (141), Expect = 1.374e-8
Identity = 28/61 (45.90%), Postives = 36/61 (59.02%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQ 2060
            R NLP  + KIL  WL  H    YPS+ EK  L+ E  L+   V NWFINARRR +  +++
Sbjct:   95 RGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIR 155          
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Match: meis1a (Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122-3])

HSP 1 Score: 71.2478 bits (173), Expect = 2.384e-14
Identity = 32/60 (53.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +L+ +TGL+   VNNWFINARRR V+P++
Sbjct:    4 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFINARRRIVQPMI 63          
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Match: pknox1.1 (pbx/knotted 1 homeobox 1.1 [Source:ZFIN;Acc:ZDB-GENE-020122-5])

HSP 1 Score: 75.8702 bits (185), Expect = 7.279e-14
Identity = 31/60 (51.67%), Postives = 42/60 (70.00%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R  LP QA  ++  WL  H+  PYP+EEEK ++A +T L+   VNNWFINARRR ++P+L
Sbjct:  270 RGVLPKQATNVMRSWLFQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARRRILQPML 329          
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 75.0998 bits (183), Expect = 1.049e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 75.0998 bits (183), Expect = 1.093e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  275 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 334          
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 74.7146 bits (182), Expect = 1.120e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 75.8702 bits (185), Expect = 1.083e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  256 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 315          
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 75.0998 bits (183), Expect = 1.166e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  275 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 334          
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 75.0998 bits (183), Expect = 1.187e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Match: meis2 (Meis homeobox 2 [Source:NCBI gene;Acc:100036664])

HSP 1 Score: 74.7146 bits (182), Expect = 1.222e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  217 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 276          
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Match: meis3 (Meis homeobox 3 [Source:NCBI gene;Acc:448474])

HSP 1 Score: 75.0998 bits (183), Expect = 1.269e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  268 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 327          
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 74.7146 bits (182), Expect = 9.268e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 75.8702 bits (185), Expect = 9.711e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 75.8702 bits (185), Expect = 9.890e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 74.7146 bits (182), Expect = 9.945e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 75.485 bits (184), Expect = 1.048e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Match: sp|P56669|HLG3_MAIZE (Homeobox protein liguleless 3 (Fragment) OS=Zea mays OX=4577 GN=LG3 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.041e-13
Identity = 28/51 (54.90%), Postives = 36/51 (70.59%), Query Frame = 3
Query: 1899 ARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKP 2051
            AR +L  W  +H R PYP+EE+K+RLA  TGL    +NNWFIN R+R+ KP
Sbjct:   34 ARTVLLEWWNTHYRWPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRHWKP 84          
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Match: sp|O14770|MEIS2_HUMAN (Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 6.506e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Match: sp|P97367|MEIS2_MOUSE (Homeobox protein Meis2 OS=Mus musculus OX=10090 GN=Meis2 PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 6.918e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Match: sp|A6NDR6|ME3L1_HUMAN (Putative homeobox protein Meis3-like 1 OS=Homo sapiens OX=9606 GN=MEIS3P1 PE=5 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 7.209e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  165 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 224          
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Match: sp|O00470|MEIS1_HUMAN (Homeobox protein Meis1 OS=Homo sapiens OX=9606 GN=MEIS1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.664e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  276 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 335          
BLAST of homeobox protein meis-like protein vs. TrEMBL
Match: A0A0F7GWU9 (Homeobox protein meis-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1417.14 bits (3667), Expect = 0.000e+0
Identity = 771/792 (97.35%), Postives = 774/792 (97.73%), Query Frame = 3
Query:  225 QRMGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMIXXXXXXXXXXXXXXXXXXXXXXXFQVPKGFPSVFSSVMXXXXXXXXXXXXXXXXXXXXXTNKKNHDKTMXXXXXXXXXXXXXPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNIIPSSTXXXXXXXXXXXXXXXXXXXXXQEITKSLEEAAVDV 2600
            QRMGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRS+RTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSD+GNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNIIPSST                  +ESQEITKSLEEAAVDV
Sbjct:   25 QRMGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSIRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSDNGNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNIIPSST------------------KESQEITKSLEEAAVDV 798          
BLAST of homeobox protein meis-like protein vs. TrEMBL
Match: A0A3P8LFX7 (Homeobox domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS1650 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.471e-36
Identity = 67/96 (69.79%), Postives = 80/96 (83.33%), Query Frame = 3
Query: 1845 IYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQ 2132
            ++S++R VGLSRTNLPF ARK LFGWL  HLREPYPSEEEK+ LA ETGLSRTTVNNWFINARRRYVKPL+QG+L + SGV K++  +N   + N+
Sbjct:   57 LFSIRRAVGLSRTNLPFPARKRLFGWLVDHLREPYPSEEEKMMLAMETGLSRTTVNNWFINARRRYVKPLMQGRLVLQSGVFKTVSNDNCSGLQNE 152          
BLAST of homeobox protein meis-like protein vs. TrEMBL
Match: A0A183VME4 (Homeobox domain-containing protein OS=Trichobilharzia regenti OX=157069 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.840e-36
Identity = 67/96 (69.79%), Postives = 80/96 (83.33%), Query Frame = 3
Query: 1845 IYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQ 2132
            ++S++R VGLSRTNLPF ARK LFGWL  HLREPYPSEEEK+ LA ETGLSRTTVNNWFINARRRYVKPL+QG+L + SGV K++  +N   + N+
Sbjct:   57 LFSIRRAVGLSRTNLPFPARKRLFGWLVDHLREPYPSEEEKMMLAMETGLSRTTVNNWFINARRRYVKPLMQGRLVLQSGVFKTVSNDNCSGLQNE 152          
BLAST of homeobox protein meis-like protein vs. TrEMBL
Match: A0A183SP21 (Homeobox domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS5969 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.615e-35
Identity = 66/95 (69.47%), Postives = 77/95 (81.05%), Query Frame = 3
Query: 1815 ADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSM 2099
            A  A+     ++S++R VGLSRTNLPF ARK LF WL  HLREPYPSEEEK+ LA ETGLSRTTVNNWFINARRRYVKPL+QG+L + SGV K++
Sbjct:   61 ATGAMASVPGLFSIRRAVGLSRTNLPFPARKRLFSWLVEHLREPYPSEEEKMMLAMETGLSRTTVNNWFINARRRYVKPLMQGRLVLQSGVFKTV 155          
BLAST of homeobox protein meis-like protein vs. TrEMBL
Match: A0A2H1CNV2 (Homeobox domain protein OS=Fasciola hepatica OX=6192 GN=D915_16109 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.356e-35
Identity = 65/85 (76.47%), Postives = 75/85 (88.24%), Query Frame = 3
Query: 1845 IYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSM 2099
            ++S++R VGLSRTNLPF ARK LFGWL  HLREPYPSEEEK+ LA ETGLSRTTVNNWFINARRRYVKPL+QG+L + SGV K++
Sbjct:  131 LFSIRRAVGLSRTNLPFPARKRLFGWLVDHLREPYPSEEEKMMLAMETGLSRTTVNNWFINARRRYVKPLMQGRLVLQSGVFKTV 215          
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Match: pknox1.1 (homeobox protein PKNOX1 [Source:NCBI gene;Acc:103043035])

HSP 1 Score: 78.1814 bits (191), Expect = 9.359e-15
Identity = 33/63 (52.38%), Postives = 44/63 (69.84%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGK 2066
            R  LP QA  ++  WL  H+  PYP+EEEK ++AN+T L+   VNNWFINARRR ++P+L  K
Sbjct:  246 RGVLPKQATNVMRSWLFQHIGHPYPTEEEKKQIANQTNLTLLQVNNWFINARRRILQPMLDAK 308          
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 75.0998 bits (183), Expect = 7.401e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  263 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 322          
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 75.485 bits (184), Expect = 7.819e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  280 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 339          
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 74.7146 bits (182), Expect = 1.039e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  279 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 338          
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Match: meis3 (homeobox protein meis3 [Source:NCBI gene;Acc:103039420])

HSP 1 Score: 74.7146 bits (182), Expect = 1.189e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  258 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 317          
BLAST of homeobox protein meis-like protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 72.4034 bits (176), Expect = 9.754e-14
Identity = 31/62 (50.00%), Postives = 43/62 (69.35%), Query Frame = 3
Query: 1872 LSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            L R  LP  A  ++  WL  H+  PYP+E+EK ++AN+T L+   VNNWFINARRR ++P+L
Sbjct:  260 LKRGVLPKHATTVMRSWLFQHIVHPYPTEDEKRQIANQTNLTLLQVNNWFINARRRILQPML 321          
BLAST of homeobox protein meis-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002620.1 (pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 gene:ENSPMAG00000002391.1 transcript:ENSPMAT00000002620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 8.990e-8
Identity = 26/57 (45.61%), Postives = 32/57 (56.14%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVK 2048
            R N    A   L  WL  H + PYP++ EKI LA  T ++ T V+ WF NARRR  K
Sbjct:   41 RKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITRMTLTQVSTWFANARRRLKK 97          
BLAST of homeobox protein meis-like protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 47.3654 bits (111), Expect = 8.307e-6
Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNW 2018
            R  LP  A  I+  WL  H+  PYP+E+EK ++A +T L+   VNNW
Sbjct:  256 RGVLPKHATGIMRSWLFQHIVHPYPTEDEKRQIAAQTNLTLLQVNNW 302          
BLAST of homeobox protein meis-like protein vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 63.929 bits (154), Expect = 1.951e-11
Identity = 27/56 (48.21%), Postives = 40/56 (71.43%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYV 2045
            R+NLP +  +IL  WL +HL  PYP+++EK  L  +TGL++  ++NWFIN RRR +
Sbjct:  166 RSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKI 221          
BLAST of homeobox protein meis-like protein vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 62.3882 bits (150), Expect = 4.753e-11
Identity = 33/84 (39.29%), Postives = 48/84 (57.14%), Query Frame = 3
Query: 1794 SVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYV 2045
            SV G+NN  +A  +  + +         R+NLP     IL  WL  H+  PYP+ +EK  L  +TGL++  ++NWFINARRR +
Sbjct:  177 SVRGSNNGYSAKEKKHKAHG-------KRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKI 253          
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 76.6406 bits (187), Expect = 4.459e-15
Identity = 34/60 (56.67%), Postives = 40/60 (66.67%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K  LA ETGL+   VNNWFINARRR V+P++
Sbjct:  242 RGIFPKAATNIMKAWLFQHLTHPYPSEEQKRSLAQETGLTILQVNNWFINARRRIVQPMI 301          
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 70.8626 bits (172), Expect = 2.316e-13
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R  LP QA  I+  WL  H+  PYP+E+EK  +A +T L+   VNNWFINARRR ++P+L
Sbjct:  201 RGVLPKQATSIMKTWLFQHIMHPYPTEDEKRSIAQQTNLTILQVNNWFINARRRILQPML 260          
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Match: EDO41178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S544])

HSP 1 Score: 49.2914 bits (116), Expect = 1.830e-7
Identity = 27/61 (44.26%), Postives = 34/61 (55.74%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQ 2060
            R NLP  +  +L  WL  H    YPSE EK  L+    LS   V NWFINARRR +  +++
Sbjct:   20 RGNLPKDSVNVLRLWLWEHRFNAYPSEAEKQYLSKAANLSVLQVCNWFINARRRILPDMIR 80          
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Match: EDO43361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ8])

HSP 1 Score: 52.7582 bits (125), Expect = 2.859e-7
Identity = 27/57 (47.37%), Postives = 33/57 (57.89%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVK 2048
            R N   QA +IL  +  SHL  PYPSEE K  LA +  +S   ++NWF N R RY K
Sbjct:  202 RRNFSKQATEILNEYFYSHLSNPYPSEEAKEELARKCNISVAQISNWFGNKRIRYKK 258          
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Match: EDO41982 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2T4])

HSP 1 Score: 47.7506 bits (112), Expect = 3.220e-7
Identity = 25/57 (43.86%), Postives = 32/57 (56.14%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVK 2048
            R N   +    L  WL  H + PYP++ EKI LA  T ++ T V+ WF NARRR  K
Sbjct:    3 RKNATRETTSTLKAWLFEHRKNPYPTKGEKIMLAILTKMTLTQVSTWFANARRRLKK 59          
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 75.0998 bits (183), Expect = 6.713e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  264 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 323          
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 74.7146 bits (182), Expect = 8.783e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  249 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 308          
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 75.0998 bits (183), Expect = 9.385e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  278 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 337          
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 74.7146 bits (182), Expect = 9.750e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  277 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 336          
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 75.485 bits (184), Expect = 1.044e-13
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  278 RGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 337          
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Match: SMESG000071247.1 (SMESG000071247.1)

HSP 1 Score: 1412.9 bits (3656), Expect = 0.000e+0
Identity = 770/790 (97.47%), Postives = 772/790 (97.72%), Query Frame = 3
Query:  231 MGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMIXXXXXXXXXXXXXXXXXXXXXXXFQVPKGFPSVFSSVMXXXXXXXXXXXXXXXXXXXXXTNKKNHDKTMXXXXXXXXXXXXXPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNIIPSSTXXXXXXXXXXXXXXXXXXXXXQEITKSLEEAAVDV 2600
            MGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSDSGNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYES+QKSSDPKREIHAKDHNIIPSST                  +ESQEITKSLEEAAVDV
Sbjct:    1 MGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSDSGNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESSQKSSDPKREIHAKDHNIIPSST------------------KESQEITKSLEEAAVDV 772          
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Match: SMESG000071247.1 (SMESG000071247.1)

HSP 1 Score: 1398.26 bits (3618), Expect = 0.000e+0
Identity = 763/783 (97.45%), Postives = 765/783 (97.70%), Query Frame = 3
Query:  252 MPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMIXXXXXXXXXXXXXXXXXXXXXXXFQVPKGFPSVFSSVMXXXXXXXXXXXXXXXXXXXXXTNKKNHDKTMXXXXXXXXXXXXXPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNIIPSSTXXXXXXXXXXXXXXXXXXXXXQEITKSLEEAAVDV 2600
            MPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSDSGNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYES+QKSSDPKREIHAKDHNIIPSST                  +ESQEITKSLEEAAVDV
Sbjct:    1 MPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRCAICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPNDVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDMIEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILHNEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGDTLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQQSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANWFSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNSGFSCSSPNTMLSGTTMISSNSDSGNLTNTTNSLSFTNNDLFQVPKGFPSVFSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSPNDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRKTLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESESYKLLDNKKSDFISQDSLIDKITISDIHHYESSQKSSDPKREIHAKDHNIIPSST------------------KESQEITKSLEEAAVDV 765          
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.404e-14
Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3
Query: 1878 RTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  478 RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 537          
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.877e-14
Identity = 42/104 (40.38%), Postives = 55/104 (52.88%), Query Frame = 3
Query: 1746 HLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            H NS  Q  D  +   S+    N +    +D      K+     R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  448 HKNSNRQNIDEKAIDQSIGSEENVEEIDSDDKNNKRQKK-----RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 546          
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 75.8702 bits (185), Expect = 8.620e-14
Identity = 42/104 (40.38%), Postives = 55/104 (52.88%), Query Frame = 3
Query: 1746 HLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSRTNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINARRRYVKPLL 2057
            H NS  Q  D  +   S+    N +    +D      K+     R   P  A  I+  WL  HL  PYPSEE+K +LA +TGL+   VNNWFINARRR V+P++
Sbjct:  448 HKNSNRQNIDEKAIDQSIGSEENVEEIDSDDKNNKRQKK-----RGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMI 546          
The following BLAST results are available for this feature:
BLAST of homeobox protein meis-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS23.176e-1455.00Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS26.932e-1455.00Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS26.932e-1455.00Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS31.317e-1355.00Meis homeobox 3 [Source:HGNC Symbol;Acc:HGNC:29537... [more]
MEIS21.355e-1355.00Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-625.189e-1354.55Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-625.326e-1354.55Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-626.368e-1354.55Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-628.416e-1263.04Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-629.116e-1263.04Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth2.234e-1355.00gene:FBgn0001235 transcript:FBtr0082256[more]
hth2.481e-1355.00gene:FBgn0001235 transcript:FBtr0082255[more]
vis7.655e-945.90gene:FBgn0033748 transcript:FBtr0087944[more]
achi1.101e-845.90gene:FBgn0033749 transcript:FBtr0087943[more]
vis1.374e-845.90gene:FBgn0033748 transcript:FBtr0087945[more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis1a2.384e-1453.33Meis homeobox 1 a [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
pknox1.17.279e-1451.67pbx/knotted 1 homeobox 1.1 [Source:ZFIN;Acc:ZDB-GE... [more]
meis2a1.049e-1355.00Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.093e-1355.00Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.120e-1355.00Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis31.083e-1355.00Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
MEIS11.166e-1355.00Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS11.187e-1355.00Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
meis21.222e-1355.00Meis homeobox 2 [Source:NCBI gene;Acc:100036664][more]
meis31.269e-1355.00Meis homeobox 3 [Source:NCBI gene;Acc:448474][more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis19.268e-1455.00Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis29.711e-1455.00Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis29.890e-1455.00Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis19.945e-1455.00Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
Meis11.048e-1355.00Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
back to top
BLAST of homeobox protein meis-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P56669|HLG3_MAIZE6.041e-1354.90Homeobox protein liguleless 3 (Fragment) OS=Zea ma... [more]
sp|O14770|MEIS2_HUMAN6.506e-1355.00Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=... [more]
sp|P97367|MEIS2_MOUSE6.918e-1355.00Homeobox protein Meis2 OS=Mus musculus OX=10090 GN... [more]
sp|A6NDR6|ME3L1_HUMAN7.209e-1355.00Putative homeobox protein Meis3-like 1 OS=Homo sap... [more]
sp|O00470|MEIS1_HUMAN8.664e-1355.00Homeobox protein Meis1 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of homeobox protein meis-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GWU90.000e+097.35Homeobox protein meis-like protein (Fragment) OS=S... [more]
A0A3P8LFX77.471e-3669.79Homeobox domain-containing protein OS=Trichobilhar... [more]
A0A183VME47.840e-3669.79Homeobox domain-containing protein OS=Trichobilhar... [more]
A0A183SP211.615e-3569.47Homeobox domain-containing protein OS=Schistocepha... [more]
A0A2H1CNV25.356e-3576.47Homeobox domain protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pknox1.19.359e-1552.38homeobox protein PKNOX1 [Source:NCBI gene;Acc:1030... [more]
meis2a7.401e-1455.00Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a7.819e-1455.00Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a1.039e-1355.00Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis31.189e-1355.00homeobox protein meis3 [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pknox29.754e-1450.00pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000002620.18.990e-845.61pep scaffold:Pmarinus_7.0:GL484724:8057:10194:-1 g... [more]
pknox28.307e-644.68pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CUP91.951e-1148.21Homeodomain-containing transcriptional repressor; ... [more]
TOS84.753e-1139.29Homeodomain-containing protein and putative transc... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364394.459e-1556.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393752.316e-1351.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411781.830e-744.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433612.859e-747.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419823.220e-743.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of homeobox protein meis-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a6.713e-1455.00Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a8.783e-1455.00homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
meis2a9.385e-1455.00Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a9.750e-1455.00Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a1.044e-1355.00Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
back to top
BLAST of homeobox protein meis-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071247.10.000e+097.47SMESG000071247.1[more]
SMESG000071247.10.000e+097.45SMESG000071247.1[more]
SMESG000078684.15.404e-1455.00SMESG000078684.1[more]
SMESG000006530.17.877e-1440.38SMESG000006530.1[more]
SMESG000006530.18.620e-1440.38SMESG000006530.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013860
GenBankAKG62112.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013860 ID=SMED30013860|Name=homeobox protein meis-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2613bp
GCATTGCACACATTCTACACTAACTAATGCAAGCAGAATTGCAGTCTATT
ATCAGGTCGACTGTCATAATGTTCATCGTGTCATTATCTTAGTTTTCGAG
TAGTCTGTCAAGCAAATCAGACCGGCGTTTTCATTTTCAATTCTAATCAA
ACAGGATTTCATTCTTATTAAGCAATAATTCTCTCATTTTCTAGCTGTTT
ATTTTATCGGATCTATTCTCAAATCAAAGAATGGGTTTATTGCCACAATT
AATGCCAACAGATGTACTTGTTTTACACTGTCCTCTTTGTACATTTCACA
GTCACCTTTTAAACAACATCGAAGAACATTTCGATGAAGTCCATCCGGAT
AAAATGATTGATTACATCATCTATCGTTGTGCTATTTGCCATAAAGTGGC
GTCTTGTCGCCATTTTATGCACGAACACATCACACTTATCCACAACAAAC
ATTCATCAAATGAACCGAGCAACTCAACGAACTCTCAAGACAACCTCTCT
ATCACGAAATCATTGTCTCCTGAACCGAATGATGTGTTTGGCAATATTGC
TTTTATCAGCATTTACTTTTCCGGGAAACTCTACTCAAAAAGTCAAAAAT
CCAATGGATTCGTGTCGGAAATGTCACAGATGCAACAGTCGCCTGACACG
AGACCCTGCTCTCGGACCAATTCAGATATGATTGAACATAGTCTACATGA
TAAGCAGTTCAAATGCATTTTCTGCAATTGTCATCAACAGACGTTCCATC
AGCTTCAGTTGCACTACGTTAGACACGGCATTCGACATCTTGGAGAGTCG
AATTCAAAAGAATCACATGGCATCTTGCACAACGAACCAAGAAATTCATC
ATATTCCAGTAAGACTTTAAATGTCTTGGATGATGTGAATGATGAAAAAG
GAAAAGAAGATAATTCCCCTAAAAATGAATACAAAGAACAGTATCTATCT
ACAACTTCTAATGAAGAATCATCTGGAGACACTTTAGCTGCAGACCAAAG
ATCCGTTCGTACCTCATCAGGAAATAACTCAATGTCAATTGAGTTTCTAT
CTCAATCCCCTCTAAAATCATTCAATCACCTGTCAAATTCACTTCAAAAT
CGAAGCAGTTTATTTAATTTGATCATGCAACAATCTGCCAACCCTAGCCC
TCAACCAACTGTAAATGATGAAAAACTTTCACCAAATATCGACAATTTTT
GCTCAGTTGGATTGTCTTTACCATTTCCAATGTCCAATAAAGTACCCGCG
ATTAACCCAAGAATAAATGGAGCTAATTGGTTCAGTAGTCTCAATCCCGG
TCAATTGATAACTTCTCCGATTTTATCCAGTCTCCACAGTCAGTTTGGCT
TGCCGTCTTTGCACCAACACATGATGAATGCGTACGCTGCAGTCAATGGA
AATAGTCCAGTTATATCTGCAAGCAATTCGGGATTTTCCTGTAGTTCTCC
CAACACAATGCTATCCGGAACAACTATGATATCTTCGAATTCAGATAGTG
GAAATCTCACCAACACTACAAACAGTCTCTCTTTCACAAATAATGATCTA
TTTCAAGTACCCAAAGGATTCCCATCGGTGTTTTCTTCGGTTATGAATGG
CAATGGAGCGAATTTAAACAATTCCATCGATAACAATTCTATTGACTTAT
CTGCCAGTACAAATAAAAAAAACCATGACAAAACAATGTCAAGTTCTGAA
TCAGACCGAAGTTCATTAACATTATCTCCAAATGACAAGTACCAGCATCT
CAACAGTCGCAATCAACCAGATGATCACAACTCTGAACCGTCATCAGTAT
CTGGAGCCAACAATGCTGATAACGCATTATTAGAGGATTCCCAGATTTAT
TCAATGAAACGAGTTGTTGGTCTCTCCAGAACTAATTTACCGTTTCAAGC
TAGAAAAATCCTTTTCGGTTGGTTGACAAGTCATCTAAGAGAGCCGTATC
CTTCTGAGGAAGAGAAAATTCGACTTGCCAATGAAACCGGTCTATCTCGA
ACGACAGTTAACAATTGGTTTATTAATGCTCGGCGTCGTTATGTCAAACC
GCTTTTGCAAGGTAAACTTGGAATGACATCGGGTGTATTGAAATCAATGC
TGGAAAATAACAACGGCATCATTCATAACCAAAGAAACCAATTCGCATCA
AACATCATGTCAGGAGGAATAAAACGAAAAACTTTATTGAACAACAATGA
AAATGAAAATGGACAAATCGTGAAACGACGTGCCAATTCTACCAACTCTT
CAAAAGGCAGCCACTCTAGAATACCCTCTATTGATAACTATCATTTGGAT
GAGAGTATCAACGTGAAAACGGAATCAGAATCCTATAAGTTGTTAGACAA
CAAAAAATCCGACTTTATCTCTCAAGACTCCCTAATTGACAAAATAACCA
TTTCCGATATCCACCATTACGAATCTAATCAGAAGTCGTCAGACCCCAAG
CGAGAAATACATGCCAAAGACCACAATATCATTCCTTCATCTACTAGTAT
GTCGAATTTAATCAATTCTTACTCAAATTTATCATCATTTTCATACTTAG
AAGAGTCTCAAGAAATCACAAAGAGTTTAGAAGAAGCTGCCGTAGACGTG
TAAAAATATTAAA
back to top

protein sequence of SMED30013860-orf-1

>SMED30013860-orf-1 ID=SMED30013860-orf-1|Name=SMED30013860-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=791bp
MGLLPQLMPTDVLVLHCPLCTFHSHLLNNIEEHFDEVHPDKMIDYIIYRC
AICHKVASCRHFMHEHITLIHNKHSSNEPSNSTNSQDNLSITKSLSPEPN
DVFGNIAFISIYFSGKLYSKSQKSNGFVSEMSQMQQSPDTRPCSRTNSDM
IEHSLHDKQFKCIFCNCHQQTFHQLQLHYVRHGIRHLGESNSKESHGILH
NEPRNSSYSSKTLNVLDDVNDEKGKEDNSPKNEYKEQYLSTTSNEESSGD
TLAADQRSVRTSSGNNSMSIEFLSQSPLKSFNHLSNSLQNRSSLFNLIMQ
QSANPSPQPTVNDEKLSPNIDNFCSVGLSLPFPMSNKVPAINPRINGANW
FSSLNPGQLITSPILSSLHSQFGLPSLHQHMMNAYAAVNGNSPVISASNS
GFSCSSPNTMLSGTTMISSNSDSGNLTNTTNSLSFTNNDLFQVPKGFPSV
FSSVMNGNGANLNNSIDNNSIDLSASTNKKNHDKTMSSSESDRSSLTLSP
NDKYQHLNSRNQPDDHNSEPSSVSGANNADNALLEDSQIYSMKRVVGLSR
TNLPFQARKILFGWLTSHLREPYPSEEEKIRLANETGLSRTTVNNWFINA
RRRYVKPLLQGKLGMTSGVLKSMLENNNGIIHNQRNQFASNIMSGGIKRK
TLLNNNENENGQIVKRRANSTNSSKGSHSRIPSIDNYHLDESINVKTESE
SYKLLDNKKSDFISQDSLIDKITISDIHHYESNQKSSDPKREIHAKDHNI
IPSSTSMSNLINSYSNLSSFSYLEESQEITKSLEEAAVDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015880Znf_C2H2-like
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR008422Homeobox_KN_domain
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 160..182
e-value: 110.0
score: 4.2
coord: 15..38
e-value: 13.0
score: 12.2
coord: 48..71
e-value: 13.0
score: 12.2
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 546..611
e-value: 1.6E-6
score: 37.7
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 550..607
score: 11.629
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 550..607
e-value: 1.03384E-11
score: 58.4089
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 549..611
e-value: 2.0E-23
score: 83.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 655..680
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 191..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 477..498
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 201..215
NoneNo IPR availablePANTHERPTHR11850:SF211HOMEOBOX PROTEIN CEH-20-RELATEDcoord: 309..619
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 309..619
IPR008422Homeobox KN domainPFAMPF05920Homeobox_KNcoord: 564..603
e-value: 1.4E-17
score: 63.3
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 550..614