Phosphoglucomutase-1

Overview
NamePhosphoglucomutase-1
Smed IDSMED30013845
Length (bp)1854
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoglucomutase-1 (SMED30013845) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoglucomutase-1 (SMED30013845) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoglucomutase-1 (SMED30013845) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoglucomutase-1 (SMED30013845) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013845

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013845SMESG000046578.1 dd_Smed_v4_3503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Match: PGM1 (phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:8905])

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 320/569 (56.24%), Postives = 421/569 (73.99%), Query Frame = 1
Query:   76 NVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
             V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY K+ I  +I  +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+++RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    6 TVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAI-QLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Match: PGM1 (phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:8905])

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 319/567 (56.26%), Postives = 421/567 (74.25%), Query Frame = 1
Query:   82 VSKAFTDQKPGTSGLRKKTKHFMQEH-YVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
             +  + DQKPGTSGLRKKT +F ++  Y++NF+Q+IF  +   D+    LV+GGDGR++NK  I   I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+++RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:   26 ATAPYHDQKPGTSGLRKKTYYFEEKPCYLENFIQSIFFSIDLKDRQGSSLVVGGDGRYFNKSAI-ETIVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 580          
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Match: PGM1 (phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:8905])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 305/540 (56.48%), Postives = 402/540 (74.44%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSE 1680
            +  V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY K+ I  +I  +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+++RLSGTGS+GAT+R+YIDSY+K  D+ KI+ +
Sbjct:    4 IVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAI-QLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEK--DVAKINQD 531          
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Match: PGM5 (phosphoglucomutase 5 [Source:HGNC Symbol;Acc:HGNC:8908])

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 272/570 (47.72%), Postives = 384/570 (67.37%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKP-GTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  + DQ+P G  GLR+ T  F  Q +Y+ NF+Q++ + +   D+    +V+G DGR++++  I  +++ +AAANGI ++IIG NGILSTPAVS IIRK  A GGI+LTASH PGG   +FG+K+NV NGGPAP+ ++DKI++ SK I  +       IDLS+     F+ +   K F V I+D V  YL+ ++ +FDF++IK ++TG   +    I  ++++GVMG YV+ V C ELG   ++A NCVPLEDFGG+HPDPNLTYA  L+  M+ G++  G AFD DGDR MILG+ GFFVSP DSLA++A N+  I YF+Q G  GF RSMPTS A+D+VA+  K+PVYE P GW+FF NLMD+ + +LCGEESFG GSDH+REKDG+WA+L WLSI+   RK+     SV+EI+  HW KFGR+++ R+D+E    +    IM+ LE  +     +G++F      + +   D+F+Y DP+D + +K QG+RI+F+D SRLI+RLS +    AT+R+Y +SY+++        +  L PL+ I L I QI + TGR+ PTVIT
Sbjct:    8 VLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAI-EIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGPGGEFGVKFNVANGGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDPVDIYLNLLRTIFDFHAIKGLLTGPSQL---KIRIDAMHGVMGPYVRKVLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEAMKGGEYGFGAAFDADGDRYMILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSMALDRVAKSMKVPVYETPAGWRFFSNLMDSGRCNLCGEESFGTGSDHLREKDGLWAVLVWLSIIAA-RKQ-----SVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDSFEYVDPVDGTVTKKQGLRIIFSDASRLIFRLSSSSGVRATLRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGRRGPTVIT 567          
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Match: PGM1 (phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:8905])

HSP 1 Score: 470.315 bits (1209), Expect = 2.525e-162
Identity = 218/375 (58.13%), Postives = 289/375 (77.07%), Query Frame = 1
Query:  649 MKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+++RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    2 LRSIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 365          
BLAST of Phosphoglucomutase-1 vs. Ensembl Celegans
Match: R05F9.6 (pep chromosome:WBcel235:II:4889437:4891427:1 gene:WBGene00019890.1 transcript:R05F9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R05F9.6)

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 300/578 (51.90%), Postives = 398/578 (68.86%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVV--DKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRK----HSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICK--ISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M   V    +K F  QKPGTSGLRK+   F Q++Y +NFVQAI +  +   K    LV+GGDGRF + +   NVI+ +AAANG+S++I+G NG LSTPA+S++IRK       DGGI+LTASHNPGG   DFGIK+N +NGGPAP+ +TD I++ +  I+ +      E D ++     ++ +  G  FVV +IDSV +Y++ M+++FDF  IKS++ G      + +L +S++G  G Y+ T+    LG   S+    VP  DFGG HPDPNLTYAK LV ++ +G+ DLG AFDGDGDRNMILGK GFFV P DSLAV+ADN+  I YF+ +   GFARSMPT+ AVD VA+   L VYE PTGWK+FGNLMDA ++++CGEESFG GSDHIREKDG+WA+LAWL IL   RKE     SV+EI+  HW K+GRN FTRYD+EN        +M  LE  + +   VG+ F ANG ++ + +ADNFQYTDP+D S +  QG+RI+F DGSRL++RLSGTGS+GAT+R+Y+DSY  + D  +  + +   LKPLV I L+ C+++Q T RK PTVIT
Sbjct:    1 MGIAVVETPTKPFAGQKPGTSGLRKRVPEFQQQNYTENFVQAILDAGLGSKKKGSQLVVGGDGRFLSMEAT-NVIIKIAAANGLSRLIVGQNGFLSTPALSNLIRKGHEGRVVDGGIILTASHNPGGPKGDFGIKFNCENGGPAPDQVTDAIYQITTKIDKYLIAKDLECDFTQVGRYEYDIEGVGH-FVVDVIDSVTEYINLMQKIFDFPKIKSLLAGELTGRKLRVLLDSMHGATGPYISTILVDHLGADPSDLLRTVPKPDFGGGHPDPNLTYAKTLVERLHTGEHDLGAAFDGDGDRNMILGKNGFFVCPSDSLAVIADNIDYIPYFKTRKVAGFARSMPTAGAVDLVAKAKGLQVYETPTGWKYFGNLMDAGRIAICGEESFGTGSDHIREKDGVWALLAWLQILAD-RKE-----SVEEIVTKHWQKYGRNVFTRYDYENVDAAGANLLMTFLEAQLPA--FVGRDFSANGVTYKVAVADNFQYTDPVDGSVATKQGLRIVFEDGSRLVFRLSGTGSAGATIRLYVDSYIPSNDTSRLLLPAHELLKPLVLIALDTCKMEQFTNRKAPTVIT 568          
BLAST of Phosphoglucomutase-1 vs. Ensembl Fly
Match: Pgm1 (gene:FBgn0003076 transcript:FBtr0075492)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 301/571 (52.71%), Postives = 403/571 (70.58%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVV-VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M   V  V +K +  QKPGTSGLRKK K F Q +Y +NFVQAI        +   LV+GGDGRFY K+    +I+ ++AANG+SK+++G NGILSTPAVS +IR + A GGIVLTASHNPGG   DFGIK+N +NGGPAP+  T+ I++ +  I  +K     +ID+SK   T+F+    GK F V +IDSVA+Y+ +M+E+FDF  +K  V+G     P+ +  +++NGV G YV+ +F   LG + S+  +  PL DFGG HPDPNLTYAKDLV  +  GD+D+G AFDGDGDRNMI+G K FFV+P DSLAV+A  ++AI YFQ+ G  GFARSMPT+SAVD V       V+EVPTGWK+FGNLMDA +L LCGEESFG GS+HIREKDG+WA+LAW+S++    K       +++I++ HW  +GRN+FTRYD+E C ++   +++  +E  I + + VGK + + G+++ +K ADNF YTDP+D S +  QG+RI+F DGSR++ RLSGTGSSGATVR+YIDSY+K   + + S  V LKPL++I L I Q+ + TGR  PTVIT
Sbjct:    1 MSLTVEIVATKPYEGQKPGTSGLRKKVKVFTQPNYTENFVQAILEANGAALAGSTLVVGGDGRFYCKEAA-ELIVRLSAANGVSKLLVGQNGILSTPAVSSLIRHNKALGGIVLTASHNPGGPENDFGIKFNCENGGPAPDAFTNHIYKITTEIKEYKLVRNLQIDISKVGVTSFDI--AGKPFTVEVIDSVANYVRHMEEIFDFAKLKDFVSGKATGKPLKMRIDAMNGVTGSYVREIFLNRLGATESSVVHTTPLPDFGGLHPDPNLTYAKDLVDTVAQGDYDIGAAFDGDGDRNMIIGSKAFFVTPSDSLAVIAHYLEAIPYFQKNGVQGFARSMPTASAVDLVGRKLGKEVFEVPTGWKYFGNLMDAGRLCLCGEESFGTGSNHIREKDGIWAVLAWISVMQHTGK------GIEDILKQHWSVYGRNYFTRYDYEECASDPCNEMVATMEKTITAPEFVGKSYSSGGKTYKVKEADNFSYTDPVDKSVATKQGLRIVFEDGSRIVVRLSGTGSSGATVRLYIDSYEKENVLGQAS--VMLKPLIDIALEISQLPKFTGRNAPTVIT 560          
BLAST of Phosphoglucomutase-1 vs. Ensembl Zebrafish
Match: pgm1 (phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1245])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 313/566 (55.30%), Postives = 419/566 (74.03%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQ-EHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            + +K +TDQKPGTSGLRK+   F Q +HY +NF+Q+I + V    + +  LV+GGDGRF+ KD I  +I+ +AAANGI +++IG +GI+STPAVS +IRK  A GGI+LTASHNPGG N DFGIK+N+ +GGPAPE ITDKIF+ SK +  +      ++DLS   + TFE  +T K F V I+DSV  Y   ++++FDF ++K +++G +    IN+  ++++GV+G YVK + C+ELG   ++A NCVP EDFGG HPDPNLTYA DLV  M+ G++D G AFDGDGDRNM+LGK GFFV+P DS+AV+  N+ +I YFQ+ G  G ARSMPTS A+D VA+  K+P+YE PTGWKFFGNLMDA KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++IM+ HW KFGRNFFTRYD+E   ++   +++  L+T +     VG+ F +  +++ ++ ADNF+YTDP+D S SK QG+RI+F+DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PLV+I L I Q+++ TGR  PTVIT
Sbjct:    7 IKTKPYTDQKPGTSGLRKRVTVFQQNQHYAENFIQSIISTVDPAQRQEGALVVGGDGRFFMKDAI-QLIIQIAAANGIGRLVIGQDGIMSTPAVSCVIRKIKAIGGIILTASHNPGGPNGDFGIKFNISSGGPAPEGITDKIFQISKSLQEYHICPELKVDLSTIGKQTFE-VDTFKPFTVEIVDSVESYAEMLRDIFDFAALKELLSGPNH---INVRLDAMHGVVGPYVKKIVCEELGSPANSAVNCVPSEDFGGHHPDPNLTYAADLVNTMKGGEYDFGAAFDGDGDRNMVLGKHGFFVNPSDSVAVIGANITSIPYFQKTGVKGLARSMPTSGALDNVAKALKMPLYETPTGWKFFGNLMDAGKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDIMKDHWQKFGRNFFTRYDYEEVDSDAANKMIDHLQTTMFDKAFVGQTFTSGDKTYQVEKADNFEYTDPVDGSVSKGQGLRIIFSDGSRIIFRLSGTGSAGATIRLYIDSYEKDPQKIYQDPQVMLAPLVDIALKISQLQEKTGRAAPTVIT 561          
BLAST of Phosphoglucomutase-1 vs. Ensembl Zebrafish
Match: pgm5 (phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060503-838])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 274/570 (48.07%), Postives = 389/570 (68.25%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGS-SGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  + +  F DQ+PGT+GLRKKT  F    +Y+ N++Q++ + +   D+    +V+G DGR++++     VI+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASH+PGG   DFGIK+NV NGGP+P+ + ++I + S+ +  +       IDLS+     F+ +   K F V I+DSV  Y + ++ +FDF+ IKS++TG + +    I  +++NGVMG YV+ + C ELG   ++A NCVPLEDFGG+HP+PN  +A  LV  M+ G+F  G AFD DGDR MI+G+ GFFVSP DSLAV+A N+  I YF Q+G  GFARSMPTS+A+D+VA+  K+ +YE PTGW+FFGNL+D+ + S CGEESFG GSDHIR+KDG+W++L WLSI+   RK+      V+EI+  HW K GRN+F R+D+E    +    +M+ LE  I       +KF      + ++ ADNF+Y DP+D S S+ QG+RI+FTD SR+I+RLSG+GS +GATVRIY +SY+++ +     ++V L PL+ I L I  I + TGR+ P +IT
Sbjct:    8 ILTIQTTPFDDQRPGTNGLRKKTAVFESNNNYLQNYIQSVLSSIDLRDRQGCTMVVGSDGRYFSR-AATEVIVQMAAANGIGRLVIGHNGILSTPAVSCIIRKIKAIGGIILTASHSPGGPGGDFGIKFNVANGGPSPDTVIERIHQVSRTLEEYAICPDLHIDLSRLGRQDFDLENKFKPFRVEIVDSVEIYFNLLRGIFDFSGIKSLLTGPNQL---KIRIDAMNGVMGPYVRRILCDELGAPANSAVNCVPLEDFGGQHPNPNPAFAGPLVDSMKGGEFGFGAAFDADGDRYMIMGENGFFVSPSDSLAVMAANLSCIPYFSQRGIRGFARSMPTSTAIDRVAKAMKVALYETPTGWRFFGNLLDSGRCSFCGEESFGTGSDHIRDKDGLWSVLVWLSIMA-VRKQ-----GVEEIVRDHWAKLGRNYFCRFDYEGVDGKAAFYLMRDLEAVITDKAFTTQKFSVGNTVYSVEKADNFEYIDPVDGSVSRKQGLRIIFTDSSRIIFRLSGSGSGTGATVRIYAESYERDPERHNRETQVVLGPLIAIALKISNIHERTGRRGPNIIT 567          
BLAST of Phosphoglucomutase-1 vs. Ensembl Zebrafish
Match: pgm5 (phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060503-838])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 274/570 (48.07%), Postives = 389/570 (68.25%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGS-SGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  + +  F DQ+PGT+GLRKKT  F    +Y+ N++Q++ + +   D+    +V+G DGR++++     VI+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASH+PGG   DFGIK+NV NGGP+P+ + ++I + S+ +  +       IDLS+     F+ +   K F V I+DSV  Y + ++ +FDF+ IKS++TG + +    I  +++NGVMG YV+ + C ELG   ++A NCVPLEDFGG+HP+PN  +A  LV  M+ G+F  G AFD DGDR MI+G+ GFFVSP DSLAV+A N+  I YF Q+G  GFARSMPTS+A+D+VA+  K+ +YE PTGW+FFGNL+D+ + S CGEESFG GSDHIR+KDG+W++L WLSI+   RK+      V+EI+  HW K GRN+F R+D+E    +    +M+ LE  I       +KF      + ++ ADNF+Y DP+D S S+ QG+RI+FTD SR+I+RLSG+GS +GATVRIY +SY+++ +     ++V L PL+ I L I  I + TGR+ P +IT
Sbjct:    8 ILTIQTTPFDDQRPGTNGLRKKTAVFESNNNYLQNYIQSVLSSIDLRDRQGCTMVVGSDGRYFSR-AATEVIVQMAAANGIGRLVIGHNGILSTPAVSCIIRKIKAIGGIILTASHSPGGPGGDFGIKFNVANGGPSPDTVIERIHQVSRTLEEYAICPDLHIDLSRLGRQDFDLENKFKPFRVEIVDSVEIYFNLLRGIFDFSGIKSLLTGPNQL---KIRIDAMNGVMGPYVRRILCDELGAPANSAVNCVPLEDFGGQHPNPNPAFAGPLVDSMKGGEFGFGAAFDADGDRYMIMGENGFFVSPSDSLAVMAANLSCIPYFSQRGIRGFARSMPTSTAIDRVAKAMKVALYETPTGWRFFGNLLDSGRCSFCGEESFGTGSDHIRDKDGLWSVLVWLSIMA-VRKQ-----GVEEIVRDHWAKLGRNYFCRFDYEGVDGKAAFYLMRDLEAVITDKAFTTQKFSVGNTVYSVEKADNFEYIDPVDGSVSRKQGLRIIFTDSSRIIFRLSGSGSGTGATVRIYAESYERDPERHNRETQVVLGPLIAIALKISNIHERTGRRGPNIIT 567          
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 310/569 (54.48%), Postives = 418/569 (73.46%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            ++ V +K +TDQKPGTSGLRK+   F    +Y +NF+Q+I +     ++ D +LV+GGDGRFY K+ I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N  NGGPAPE ITDKIF+ SK I  +      ++DL+   +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NC+PLEDFGG HPDPNLTYA +LV  M++G+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQ  G  GFARSMPTS A+D+VA+  K+ +YE PTGWKFFGNLMDANKLSLCGEESFG GSDHIREKDG+WA+LAWLSI+   RK+     SV+EI++ HW K+GRNFFTRYD+E   +E   ++MK LET +     +G++     + + ++ ADNF+Y+DP+D S S+NQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PL+ I L I ++++ TGR  PTVIT
Sbjct:    4 IQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTDPAERQDGVLVVGGDGRFYMKEAI-QLIIQIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIAT-RKQ-----SVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVMLGPLITIALKISKLQERTGRSAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 310/570 (54.39%), Postives = 418/570 (73.33%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISK-VIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            ++ V +K +TDQKPGTSGLRK+   F    +Y +NF+Q+I +     ++ D +LV+GGDGRFY K+ I  +I+ +AAANG++  V+IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N  NGGPAPE ITDKIF+ SK I  +      ++DL+   +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NC+PLEDFGG HPDPNLTYA +LV  M++G+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQ  G  GFARSMPTS A+D+VA+  K+ +YE PTGWKFFGNLMDANKLSLCGEESFG GSDHIREKDG+WA+LAWLSI+   RK+     SV+EI++ HW K+GRNFFTRYD+E   +E   ++MK LET +     +G++     + + ++ ADNF+Y+DP+D S S+NQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PL+ I L I ++++ TGR  PTVIT
Sbjct:    4 IQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTDPAERQDGVLVVGGDGRFYMKEAI-QLIIQIAAANGVTNGVVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIAT-RKQ-----SVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVMLGPLITIALKISKLQERTGRSAPTVIT 563          
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 308/564 (54.61%), Postives = 416/564 (73.76%), Query Frame = 1
Query:   85 SKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAI-FNV-VVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  + DQKPGTSGLRKKT  F  + +Y+ NF+Q+I F++ + D+    +V+GGDGR++NK  I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N  NGGPAPE ITDKIF+ SK I  +      ++DL+   +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NC+PLEDFGG HPDPNLTYA +LV  M++G+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQ  G  GFARSMPTS A+D+VA+  K+ +YE PTGWKFFGNLMDANKLSLCGEESFG GSDHIREKDG+WA+LAWLSI+   RK+     SV+EI++ HW K+GRNFFTRYD+E   +E   ++MK LET +     +G++     + + ++ ADNF+Y+DP+D S S+NQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PL+ I L I ++++ TGR  PTVIT
Sbjct:   13 TAPYYDQKPGTSGLRKKTCCFETKANYLQNFIQSILFSIDLRDRQGSTMVVGGDGRYFNKSAI-EIIVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIAT-RKQ-----SVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEKDLQKIYEDPQVMLGPLITIALKISKLQERTGRSAPTVIT 566          
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Match: bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor [Source:Xenbase;Acc:XB-GENE-1000537])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 298/537 (55.49%), Postives = 400/537 (74.49%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKI 1671
            ++ V +K +TDQKPGTSGLRK+   F    +Y +NF+Q+I +     ++ D +LV+GGDGRFY K+ I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N  NGGPAPE ITDKIF+ SK I  +      ++DL+   +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NC+PLEDFGG HPDPNLTYA +LV  M++G+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQ  G  GFARSMPTS A+D+VA+  K+ +YE PTGWKFFGNLMDANKLSLCGEESFG GSDHIREKDG+WA+LAWLSI+   RK+     SV+EI++ HW K+GRNFFTRYD+E   +E   ++MK LET +     +G++     + + ++ ADNF+Y+DP+D S S+NQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI
Sbjct:    4 IQTVKTKPYTDQKPGTSGLRKRVTVFQTNANYAENFIQSIISCTDPAERQDGVLVVGGDGRFYMKEAI-QLIIQIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNTSNGGPAPEAITDKIFQLSKTIEEYAICPDLKVDLTTIGKQQFDLENKFKPFTVEIVDSVEAYANMLRNIFDFSALKELLSGQNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCIPLEDFGGHHPDPNLTYASELVDTMKTGEHDFGAAFDGDGDRNMILGKNGFFVNPSDSVAVIAANIFSIPYFQHTGVRGFARSMPTSGALDRVAKATKIALYETPTGWKFFGNLMDANKLSLCGEESFGTGSDHIREKDGLWAVLAWLSIIAT-RKQ-----SVEEILKDHWQKYGRNFFTRYDYEEVDSEGANKMMKDLETLMFDRAFIGQQLSVGDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFADGSRVIFRLSGTGSAGATIRLYIDSYEK--DLQKI 528          
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Match: PGM5 (phosphoglucomutase 5 [Source:HGNC Symbol;Acc:HGNC:8908])

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 288/569 (50.62%), Postives = 390/569 (68.54%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  + +  + DQKPG++G RK T  F  + +Y+ NF+Q++ + +   D+    +V+G DGR+++K  I   I+ +AAANGI ++IIG NG+LSTPA+S IIRK  A GGI+LTASHNPGG   DFGIK+NV NGGPAP+ +TDKIF+ SK I  +       IDLS+     F+ +   K F V I+DSV  YL+ ++ LFD N+IKS++TG D +    I  +++NGVMG YV+ + C ELG   ++A NCVPLEDFGG++PDPNLTYA  L+  M+ G+   G AFD DGDR MILG+ GFFV+P DSLAV+A N+  I YF+Q G  GF RSMPTS+A+DKVA+  K+PVYE PTGWK+F NLMD+ + SLCGEESFG GSDH+REKDG+W++L WLSI+   RK+     SV+EI++ HW KFGR++F R+D+E         IMK LE  I       +KF      F ++  D+F+Y DP+D + SK QG+RI+F DGSR+I+R+S +G+ G T+RIY +SY+K+       ++  L PL+ I L + QI + TGRK PTVIT
Sbjct:    8 VLTIQTVPYEDQKPGSNGFRKPTAVFESKRNYLQNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSKTAI-ETIVQMAAANGIGRLIIGQNGLLSTPALSCIIRKIKAIGGIILTASHNPGGPGGDFGIKFNVANGGPAPDTVTDKIFQISKTIEEYAICPDLRIDLSRVGRQEFDLENKFKPFRVEIVDSVEVYLNMLRTLFDMNAIKSLLTGPDQL---KIRIDAMNGVMGPYVRRILCDELGAPANSAVNCVPLEDFGGQYPDPNLTYATGLLEAMKGGEHGFGAAFDADGDRYMILGENGFFVNPSDSLAVIAANLSCIPYFRQMGVRGFGRSMPTSTALDKVAKAMKVPVYETPTGWKYFANLMDSGRCSLCGEESFGTGSDHLREKDGLWSVLIWLSIMAA-RKQ-----SVEEIVQDHWAKFGRHYFCRFDYEALDPRTAVFIMKDLEAVITEKSFANQKFAVGSHVFSVEKTDSFEYVDPVDGTVSKKQGLRIIFADGSRIIFRISSSGTMGTTLRIYAESYEKDPTKHNKETQAVLGPLIAIALKLSQIHERTGRKGPTVIT 566          
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Match: Pgm1 (phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97565])

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 322/568 (56.69%), Postives = 420/568 (73.94%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY  + I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    7 VKTQAYPDQKPGTSGLRKRVKVFQSNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAI-QLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Match: Pgm1 (phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97565])

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 322/568 (56.69%), Postives = 420/568 (73.94%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY  + I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    7 VKTQAYPDQKPGTSGLRKRVKVFQSNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAI-QLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Match: Pgm1 (phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97565])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 321/567 (56.61%), Postives = 419/567 (73.90%), Query Frame = 1
Query:   82 VSKAFTDQKPGTSGLRKKTKHFMQEH-YVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
             +  + DQKPGTSGLRK T +F ++  Y++NF+Q+IF  +   D+    LV+GGDGR++NK  I   I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:   26 ATAPYHDQKPGTSGLRKNTYYFEEKPCYLENFIQSIFFSIDLKDRQGSSLVVGGDGRYFNKSAI-ETIVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 580          
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Match: Pgm1 (phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97565])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 321/567 (56.61%), Postives = 419/567 (73.90%), Query Frame = 1
Query:   82 VSKAFTDQKPGTSGLRKKTKHFMQEH-YVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
             +  + DQKPGTSGLRK T +F ++  Y++NF+Q+IF  +   D+    LV+GGDGR++NK  I   I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:   26 ATAPYHDQKPGTSGLRKNTYYFEEKPCYLENFIQSIFFSIDLKDRQGSSLVVGGDGRYFNKSAI-ETIVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 580          
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Match: Pgm5 (phosphoglucomutase 5 [Source:MGI Symbol;Acc:MGI:1925668])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 274/570 (48.07%), Postives = 385/570 (67.54%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKP-GTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  + DQ+P G  GLR+ T  F  Q +Y+ NF+Q++ + +   D+    +V+G DGR++++     +++ +AAANGI ++IIG NGILSTPAVS IIRK  A GGI+LTASH PGG   +FG+K+NV NGGPAP+ ++DKI++ SK I  +       IDLS+     F+ +   K F V I+D V  YL+ ++ +FDFN+IKS++TG   +    I  ++++GVMG YV+ V C ELG   ++A NCVPLEDFGG+HPDPNLTYA  L+  M+ G++  G AFD DGDR MILG+ GFFVSP DSLA++A N+  I YF+Q G  GF RSMPTS+A+D+VA+  K+PVYE P GW+FF NLMD+ + SLCGEESFG GSDH+REKDG+WA+L WLSI+   RK+     SV+EI+  HW K+GR+++ R+D+E    +    IM+ LE  +     +G++F      + I   D+F+Y DP+D + +K QG+RI+F+D SRLI+RLS +    AT+R+Y +SY+++        +  L PL+ I L I QI + TGR+ PTVIT
Sbjct:    8 VLTVPTAPYEDQRPTGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGCTMVVGSDGRYFSRTAT-EIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILTASHCPGGPGGEFGVKFNVANGGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDPVDIYLNLLRNIFDFNAIKSLLTGPSQL---KIRVDAMHGVMGPYVRKVLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEAMKGGEYGFGAAFDADGDRYMILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSTALDRVAKSMKVPVYETPAGWRFFSNLMDSGRCSLCGEESFGTGSDHLREKDGLWAVLVWLSIIAA-RKQ-----SVEEIVRDHWAKYGRHYYCRFDYEGLEPKATYYIMRDLEALVTDKSFIGQQFAVGSHIYSIAKTDSFEYVDPVDGTVTKKQGLRIIFSDASRLIFRLSSSSGVRATIRLYAESYERDPSGHDQEPQAVLSPLIAIALKISQIHERTGRRGPTVIT 567          
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Match: sp|P36871|PGM1_HUMAN (Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 320/569 (56.24%), Postives = 421/569 (73.99%), Query Frame = 1
Query:   76 NVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
             V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY K+ I  +I  +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+++RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    6 TVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAI-QLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVASATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIVFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Match: sp|P00949|PGM1_RABIT (Phosphoglucomutase-1 OS=Oryctolagus cuniculus OX=9986 GN=PGM1 PE=1 SV=2)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 321/569 (56.41%), Postives = 417/569 (73.29%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  V +KA+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY K+ I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    4 IVTVKTKAYPDQKPGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAI-QLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWHKFGRNFFTRYDYEEVEAEGATKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYHDPVDGSVSKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDNAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Match: sp|Q9D0F9|PGM1_MOUSE (Phosphoglucomutase-1 OS=Mus musculus OX=10090 GN=Pgm1 PE=1 SV=4)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 322/568 (56.69%), Postives = 420/568 (73.94%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY  + I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    7 VKTQAYPDQKPGTSGLRKRVKVFQSNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAI-QLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Match: sp|Q4R5E4|PGM1_MACFA (Phosphoglucomutase-1 OS=Macaca fascicularis OX=9541 GN=PGM1 PE=2 SV=3)

HSP 1 Score: 657.136 bits (1694), Expect = 0.000e+0
Identity = 320/571 (56.04%), Postives = 422/571 (73.91%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISS--EVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY K+ I  +I  +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   + F V I+DSV  Y + ++ +FDF+++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+ +YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++I++ HW K+GRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S S+NQG+R++FTDGSR+I+RLSGTGS+GAT+R+YIDSY+K  D+ KI+   +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    4 IVTVKTQAYPDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAI-QLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFEPFTVEIVDSVEAYATMLRNIFDFSALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEDILKDHWQKYGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISRNQGLRLIFTDGSRIIFRLSGTGSAGATIRLYIDSYEK--DVAKINQDPQVMLAPLISIALKVSQLQERTGRSAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Match: sp|P38652|PGM1_RAT (Phosphoglucomutase-1 OS=Rattus norvegicus OX=10116 GN=Pgm1 PE=1 SV=2)

HSP 1 Score: 656.366 bits (1692), Expect = 0.000e+0
Identity = 319/566 (56.36%), Postives = 415/566 (73.32%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V ++A+ DQKPGTSGLRK+ K F    +Y +NF+Q+I + V    + +  LV+GGDGRFY  + I  +I+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG N DFGIK+N+ NGGPAPE ITDKIF+ SK I  +      ++DL    +  F+ +   K F V I+DSV  Y + ++ +FDFN++K +++G + +    I  ++++GV+G YVK + C+ELG   ++A NCVPLEDFGG HPDPNLTYA DLV  M+SG+ D G AFDGDGDRNMILGK GFFV+P DS+AV+A N+ +I YFQQ G  GFARSMPTS A+D+VA   K+  YE PTGWKFFGNLMDA+KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+      V++I++ HW KFGRNFFTRYD+E    E   ++MK LE  +     VGK+F AN + + ++ ADNF+Y+DP+D S SKNQG+R++F DGSR+I+RLSGTGS+GAT+R+YIDSY+K+A       +V L PL+ I L + Q+++ TGR  PTVIT
Sbjct:    7 VKTQAYPDQKPGTSGLRKRVKVFQGNANYAENFIQSIVSTVEPALRQEATLVVGGDGRFYMTEAI-QLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRL---KIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIASYETPTGWKFFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQR-----VEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKDAAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Match: V5I8J8 (Phosphoglucomutase OS=Anoplophora glabripennis OX=217634 GN=PGM PE=3 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 326/566 (57.60%), Postives = 428/566 (75.62%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDK-SDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLS-NAENCVPLEDFGGRHPDPNLTYAKDLVTKM-ESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V +  F  QKPGTSGLRKK K FM++HY +NF+Q+IFN + DK     L++GGDGR+++K  I N+I+ +A+ANG++K+IIG  GILSTPAVS +IR H+  GGIVLTASHNPGG+  DFGIKYN++NGGPAP+ ++D I+E +K I  ++TT   E D   +I  T      G+ FVV IIDS  +Y+S MKE+FDF  +++++ G++     N+L +S+NGV GVYV+ +F +ELG S   N    +PL++FG  HPDPNLTYAKDLV K+ ++ ++DLG AFDGDGDRNMI+GKK FFV+P DSLAV+A+N++ I YFQ+ G HGFARSMPT++AVD+VA      ++EVPTGWK+FGNLMDA +LSLCGEESFG GSDHIREKDG+WA+LAWLSI+     EHK  +SV++I++ HW  +GRN+FTRYD+E C ++   Q+M  LE  IAS D VGK +   G+++ +  ADNF Y DPID+S +KNQG+R+LF DGSRLIYRLSGTGSSGAT+R+YIDSY+K   +    ++V LKPLVEIGL I Q+K+ TGR  PTVIT
Sbjct:    8 VTTTPFEGQKPGTSGLRKKVKVFMEKHYTENFIQSIFNALGDKVKGSTLIVGGDGRYFSKQAI-NIIIRIASANGVAKLIIGQLGILSTPAVSSLIRTHNVLGGIVLTASHNPGGIRNDFGIKYNIENGGPAPDSVSDAIYENTKKITEYRTTPKLETDRLIDIIGTTTFNVDGRDFVVEIIDSAINYVSLMKEIFDFPKLRTVIRGTETRPAFNVLIDSMNGVTGVYVRRIFVEELGASPDHNVCRIIPLDNFGEIHPDPNLTYAKDLVDKVKDNEEYDLGAAFDGDGDRNMIIGKKAFFVTPSDSLAVLANNLQCIPYFQKNGVHGFARSMPTAAAVDRVASKLGKEMFEVPTGWKYFGNLMDAGRLSLCGEESFGTGSDHIREKDGIWAVLAWLSII-----EHKN-MSVEDILKEHWSTYGRNYFTRYDYEECESDAANQMMAHLEQTIASKDFVGKSYTFGGKTYTVSQADNFSYVDPIDNSVAKNQGVRVLFEDGSRLIYRLSGTGSSGATIRVYIDSYEKENVLT--DAQVVLKPLVEIGLEISQLKKFTGRDAPTVIT 564          
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Match: A0A1B6C217 (Uncharacterized protein (Fragment) OS=Clastoptera arizonana OX=38151 GN=g.20737 PE=3 SV=1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 320/564 (56.74%), Postives = 415/564 (73.58%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDK-SDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +++K F  QKPGTSGLRK  K F QEHY +NF+Q+I   +  + +   LV+GGDGR++ K  + ++I+ ++AANG++K+IIG NGILSTPAVS +IRKH   GGIVLTASHNPGG + DFGIK+N  NGGPAP+ +T++I+E +K I  +         +++     FE    GK FVV +IDSV DYL  MKE+FDFN+IK+++ GS    P  IL NS++GV G YVK +F +ELG S SN  N VPLEDFGG HPDPNLTYA DLV  +E GD+DLG AFDGDGDRNMILG+K FFV+P DSLAV+A ++ +I YF++ G  G+ARSMPT +A+D+VA      ++EVPTGWK+FGNLMDA  LSLCGEESFG GSDHIREKDG+WA+LAWLS++    K       V EIM+ HW K+GRNFFTRYD+ENC +    Q+M  LE  + SS+ VGK   + G+S+ +K+ DNF+YTDP+D S + NQGIRILF+DGSRLI+RLSGTGSSGATVR+Y +SY+ +     + + +ALKPLV + L + +++Q TGR +PTVIT
Sbjct:   27 IITKVFDGQKPGTSGLRKAVKVFQQEHYTENFIQSILTALGPQLAGSTLVVGGDGRYFGKQAV-DIIIKISAANGVTKLIIGQNGILSTPAVSCLIRKHKVTGGIVLTASHNPGGPDNDFGIKFNTSNGGPAPDGVTNQIYELTKSITHYNMVPDLNCSVAEIKTEKFE--VDGKPFVVEVIDSVQDYLELMKEIFDFNAIKNLIQGSGSKPPFKILLNSMHGVTGPYVKRIFVKELGASESNTVNSVPLEDFGGHHPDPNLTYAADLVKALEQGDYDLGAAFDGDGDRNMILGQKAFFVNPSDSLAVLAAHLDSIPYFKKTGVKGYARSMPTGAALDRVAADKNKTLFEVPTGWKYFGNLMDAGILSLCGEESFGTGSDHIREKDGIWAVLAWLSVVANVGK------PVHEIMKDHWKKYGRNFFTRYDYENCESAPCNQMMTELEKMVTSSEFVGKVLSSGGKSYTVKLGDNFKYTDPVDKSVASNQGIRILFSDGSRLIFRLSGTGSSGATVRLYAESYESDPASISLEASIALKPLVTVALELSKLQQFTGRDKPTVIT 581          
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Match: R7UBE9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228164 PE=3 SV=1)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 325/571 (56.92%), Postives = 427/571 (74.78%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDKSDYI-LVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            MQ +V  + +K F  QKPGTSGLRK TK F+QEHY +NFVQ   + + DK +   L LGGDGRFY  +  + +I  + AANG+SKVIIG +GI+STPA+S +IRK   DGGI+LTASHNPGGLN DFGIK+N  NGGPAP  +TD IFE +  I+ +++    + D+S     +F     GK F + +IDSV DY+ YMKE+FDF +IK++++GS G   + +L NS++GV+G YV+ +   ELG+S SNA NCVPL DFGG HPDPNLTYA DLV +ME G  D G AFDGDGDRNMILGK GFFVSPCDSLAV+A N+ AI YF++ G  GFARSMPTS+AVD+VA    + ++EVPTGWKFFGNLMDA +LSLCGEESFG GSDHIREKDG+WA LAWLSI+      H+K ++V++I++ HW K+GRNFFTRYD+EN   +  +Q+M  L   I+    +G+++   G+SF +   DNF+YTDPID S SKNQG+R++F+DGSR+++RLSGTGS+GAT+R+Y+DSY+ +     + ++  LKPLVEI L+I +++++TGR++PTVIT
Sbjct:    1 MQSVV--IATKPFEGQKPGTSGLRKATKIFIQEHYTENFVQCTLSAMGDKLNGCSLALGGDGRFYGDEASVKII-KMCAANGVSKVIIGKDGIMSTPALSCVIRKFKTDGGIILTASHNPGGLNADFGIKFNTANGGPAPASVTDHIFELTSTISEYRSVPDMKPDISSVGTQSF--TVDGKPFTLQVIDSVQDYMEYMKEIFDFAAIKALLSGS-GAAKLEVLMNSMHGVVGPYVQRILVDELGMSPSNAVNCVPLPDFGGGHPDPNLTYAADLVKEMEKGVHDFGAAFDGDGDRNMILGKNGFFVSPCDSLAVIAANLDAIPYFKKTGIKGFARSMPTSAAVDRVAVEKGMEMFEVPTGWKFFGNLMDAGRLSLCGEESFGTGSDHIREKDGLWAALAWLSIVA-----HRK-MTVEQILKDHWHKYGRNFFTRYDYENVDMKGADQMMVDLNALISDPSYIGRQYTQCGKSFTLAKTDNFEYTDPIDGSVSKNQGVRLIFSDGSRIVFRLSGTGSAGATIRMYVDSYESDESKHLLDAQDMLKPLVEIALSISKLRELTGRQKPTVIT 559          
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Match: V4B404 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_102562 PE=3 SV=1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 323/573 (56.37%), Postives = 424/573 (74.00%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVVV-DK-SDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M   V  + +K + DQKPGTSGLRK  K +  +E+Y +NF+QA     + DK     LV+GGDGR+Y K+    +I+ + AANG+SK++I  NG++STPA+S  IRK+  +GGI+LTASHNPGG + DFGIK+N  NGGPAPE +T+ IFE +K I+ +K     +IDLSK   T + N E G++F V IIDSV DY  YMKE+FDFNSIK+++ GS+G  P+NIL NS++GVMG YVK + C ELG   SN  NCVPLEDFGG HPDPNLTYA DLV +++ G    G AFDGDGDRNMILG+  FFV+P DSLAV+A+N++ I YFQ  G  G+ARSMPT+ AVD+VA++    ++EVPTGWKFFGNLMDA +LSLCGEESFG GSDHIREKDG+WA+LAWL IL   +K      SV+E++  HW ++GRNFFTRYD+ENC +     +M+ L   I+S  ++ K++  +G+S+ +  ADNF YTDPID S SKNQG+RI+FTD SR+I+RLSGTGSSGAT+R+YI+ Y+ +    ++ ++V LKPL+ I L I Q++++TGR+EPTVIT
Sbjct:    1 MALAVEKIATKPYDDQKPGTSGLRKGVKVYQSKENYTENFIQATLTAGLGDKIQGSCLVVGGDGRYYGKEAT-ELIVKMCAANGLSKLLIAENGLMSTPALSCCIRKYQTNGGIILTASHNPGGPDGDFGIKFNTANGGPAPEAVTNGIFEATKSISEYKICRNLQIDLSKKGATNY-NIE-GRQFTVEIIDSVDDYCQYMKEIFDFNSIKNLIGGSNGQPPLNILLNSMHGVMGPYVKKIVCGELGARESNTVNCVPLEDFGGHHPDPNLTYAADLVNELKKGQHGFGAAFDGDGDRNMILGENAFFVTPSDSLAVLANNLECIPYFQNTGVKGYARSMPTAGAVDRVAKVKGKEMFEVPTGWKFFGNLMDAGRLSLCGEESFGTGSDHIREKDGLWAVLAWLQILAHTKK------SVKELITDHWTQYGRNFFTRYDYENCESGPANTMMENLNNLISSPTIINKEYSHDGKSYTVAQADNFCYTDPIDKSVSKNQGVRIIFTDDSRIIFRLSGTGSSGATIRLYIEGYEADIAQHQLDAQVVLKPLINIALQISQLRELTGRQEPTVIT 564          
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Match: A0A1B6JU52 (Uncharacterized protein OS=Homalodisca liturata OX=320908 GN=g.52646 PE=3 SV=1)

HSP 1 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 316/571 (55.34%), Postives = 415/571 (72.68%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDK-SDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M      V +K +  QKPGTSGLRK  K F QEHY +NFVQ+I   +  + +   LV+GGDGR++ K  + ++I+ ++AANG++K++IG NGILSTPAVS +IRK    GGIVLTASHNPGG + DFGIK+N  NGGPAP+ +T++IFE +K+I S+    A +  + K    TF  K  G+ FVV IIDSV DYL  MKE+FDFN++K+++ GS    P  +L NS++GV G YV+ +F +ELG    N  N +PLEDFGG HPDPNLTYA DLV  ++ GD+D G AFDGDGDRNMILG K FFV+P DSLAV+A+++  I YFQ+ G  G+ARSMPT +AVD+VA  +   ++EVPTGWK+FGNLMDA +LSLCGEESFG GSDHIREKDG+WA+LAWLS++    K       V EI++ HW KFGRNFFTRYD+E+C ++   ++M  LE     +D VGK   A G+S+ +K ADNF+YTDPID+S +  QGIR++F DGSRLIYRLSGTGSSGATVR+Y++SY+ +     + + VAL+PL+++ L + ++ Q TGR +PTVIT
Sbjct:    1 MALTSVQVSTKVYDGQKPGTSGLRKAVKVFQQEHYTENFVQSILTALGSQLTGSTLVVGGDGRYFGKQAV-DIIIKISAANGVAKLVIGQNGILSTPAVSCLIRKLKVTGGIVLTASHNPGGPDNDFGIKFNTSNGGPAPDAVTNQIFELTKVIKSYSLVPALQCPIDKIGTQTF--KVDGRDFVVEIIDSVQDYLLLMKEIFDFNTLKTLLQGSSSRPPFKLLINSMHGVTGPYVQRIFVEELGAPKDNTINTIPLEDFGGHHPDPNLTYAADLVQALQKGDYDFGAAFDGDGDRNMILGHKAFFVTPSDSLAVLANHLGCIPYFQRTGVKGYARSMPTGAAVDRVAAANNKEIFEVPTGWKYFGNLMDAGRLSLCGEESFGTGSDHIREKDGIWAVLAWLSVIAHTGK------PVHEILQAHWAKFGRNFFTRYDYEDCESDPCNKMMAELEALATKTDFVGKVLTAGGKSYKVKTADNFKYTDPIDNSIASKQGIRVIFEDGSRLIYRLSGTGSSGATVRLYVESYESDPASLGLDASVALQPLIQVALELSKLPQFTGRDKPTVIT 562          
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Match: pgm1 (phosphoglucomutase 1 [Source:NCBI gene;Acc:103038467])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 315/566 (55.65%), Postives = 416/566 (73.50%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQ-EHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V +K +TDQKPGTSGLRK+   F Q +HY +NF+Q+I + V    + +  LV+GGDGRF+ KD I  +I+ +AAANGI +++IG NGI+STPAVS +IRK  A GGI+LTASHNPGG N DFGIKYN+ NGGPAPE IT+KIF+ SK +  +      + DLS   + TFE  +T K F V I+DSV  Y   ++++FDF ++K +++G +    IN+  ++++GV+G YVK + C+ELG   ++A NCVP EDFGG HPDPNLTYA DLV  M+ G++D G AFDGDGDRNM+LGK GFFV+P DS+AV+  N+  I YFQ+ G  G ARSMPTS A+D VA+  K+ +YE PTGWKFFGNLMDA KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++IM+ HW KFGRNFFTRYD+E   ++   +++  L+  +     VG+KF +  +++ ++ ADNF+YTDP+D S SK QG+RI+F+DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PLV+I L I Q+++ TGR  PTVIT
Sbjct:    7 VKTKPYTDQKPGTSGLRKRVTVFQQNQHYAENFIQSIISTVEPSQRQEGTLVVGGDGRFFMKDAI-QLIVQIAAANGIGRLVIGQNGIMSTPAVSCVIRKTKAIGGIILTASHNPGGPNGDFGIKYNISNGGPAPEGITNKIFDISKGLQEYHICPELKADLSTIGKQTFE-VDTFKPFTVEIVDSVESYAEMLRDIFDFAALKELLSGPNH---INVRLDAMHGVVGPYVKKIVCEELGSPANSAVNCVPSEDFGGHHPDPNLTYAADLVNTMKGGEYDFGAAFDGDGDRNMVLGKHGFFVNPSDSVAVIGANITCIPYFQKTGVKGLARSMPTSGALDNVAKALKMELYETPTGWKFFGNLMDAGKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAA-RKQ-----SVEDIMKEHWQKFGRNFFTRYDYEEVDSDAANKMITELQNTMFDKAFVGQKFSSGDKTYQVEKADNFEYTDPVDASVSKGQGLRIIFSDGSRIIFRLSGTGSAGATIRLYIDSYEKDPQKIYQDPQVMLAPLVDIALKISQLQEKTGRTGPTVIT 561          
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000019378.2 (phosphoglucomutase-1-like [Source:NCBI gene;Acc:103046368])

HSP 1 Score: 622.083 bits (1603), Expect = 0.000e+0
Identity = 300/569 (52.72%), Postives = 406/569 (71.35%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  + DQ+PGTSGLRKK   F  +++Y+ NF+Q+IF+ +   D+    +V+GGDGR++N   I  VI+ +AAANG+  ++IG NGI+STPAVS +IRK  A GGI+LTASHNPGG + DFGIK+N+ NGGPAPE +T+KIF  S+ I  F       +DL+   + +F+ +   K F V I+DSV  Y + ++ +FDF  +K +++G +    I I  ++++GV G YVK + C+ELG   ++A NC+P EDFGG+HPDPNLTYA DLV  M+SG +D G AFDGDGDRNMILGK GFF+SP DS+A++A N+  I YFQ  G  GFARSMPTS A+D VA+  K+ +YE PTGWKFFGNLMDA +LSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV+E+M  HW  +GRN++TRYD+E    +   ++M  LE  I     +G+ F A  +++ ++ ADNF+Y+DP+D S S+NQG+RI+F DGSR+++RLSGTGSSGATVR+YIDSY+K+ +      +V L  LV I L + Q+++ TGR  P+VIT
Sbjct:   83 VLTVPTTPYPDQRPGTSGLRKKVLVFQTKQNYLQNFIQSIFSSIDLRDRQGSTMVVGGDGRYFNTTAI-QVIVQMAAANGVGHLVIGQNGIMSTPAVSSVIRKFKAIGGILLTASHNPGGPDGDFGIKFNIANGGPAPEAVTEKIFRISRSIEEFTICPELRVDLTTIGKQSFDLENKFKPFTVEIMDSVESYANMLRNIFDFALLKELLSGENH---IRIRLDAMHGVTGPYVKRILCEELGSPANSAINCIPQEDFGGQHPDPNLTYAVDLVESMKSGQYDFGAAFDGDGDRNMILGKHGFFISPSDSVALIAANIFCIPYFQHMGVRGFARSMPTSGALDNVAKATKIQLYETPTGWKFFGNLMDAGRLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEEVMVEHWRTYGRNYYTRYDYEEVDIDAAVEMMLELEVMITDKAFIGQTFNAGEKTYEVEKADNFEYSDPVDGSISRNQGLRIMFKDGSRIVFRLSGTGSSGATVRLYIDSYEKDLNQIFQDPQVKLAELVSIALKLSQLQERTGRSSPSVIT 641          
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Match: pgm1 (phosphoglucomutase 1 [Source:NCBI gene;Acc:103038467])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 298/566 (52.65%), Postives = 396/566 (69.96%), Query Frame = 1
Query:   79 VVSKAFTDQKPGTSGLRKKTKHFMQ-EHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V +K +TDQKPGTSGLRK+   F Q +HY +NF+Q+I + V    + +  LV+GGDGRF+ KD I  +I+ +AAANGI +++IG NGI+STPAVS +IRK  A GGI+LTASHNPGG N DFGIKYN+ NGGPAPE IT+KIF+ SK +  +      + DLS   + TFE  +T K F V I+DSV  Y   ++++FDF ++K +++G +    IN+  ++++GV+G YVK + C+ELG   ++A NCVP EDFG                           AFDGDGDRNM+LGK GFFV+P DS+AV+  N+  I YFQ+ G  G ARSMPTS A+D VA+  K+ +YE PTGWKFFGNLMDA KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV++IM+ HW KFGRNFFTRYD+E   ++   +++  L+  +     VG+KF +  +++ ++ ADNF+YTDP+D S SK QG+RI+F+DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PLV+I L I Q+++ TGR  PTVIT
Sbjct:    7 VKTKPYTDQKPGTSGLRKRVTVFQQNQHYAENFIQSIISTVEPSQRQEGTLVVGGDGRFFMKDAI-QLIVQIAAANGIGRLVIGQNGIMSTPAVSCVIRKTKAIGGIILTASHNPGGPNGDFGIKYNISNGGPAPEGITNKIFDISKGLQEYHICPELKADLSTIGKQTFE-VDTFKPFTVEIVDSVESYAEMLRDIFDFAALKELLSGPNH---INVRLDAMHGVVGPYVKKIVCEELGSPANSAVNCVPSEDFG--------------------------AAFDGDGDRNMVLGKHGFFVNPSDSVAVIGANITCIPYFQKTGVKGLARSMPTSGALDNVAKALKMELYETPTGWKFFGNLMDAGKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAA-RKQ-----SVEDIMKEHWQKFGRNFFTRYDYEEVDSDAANKMITELQNTMFDKAFVGQKFSSGDKTYQVEKADNFEYTDPVDASVSKGQGLRIIFSDGSRIIFRLSGTGSAGATIRLYIDSYEKDPQKIYQDPQVMLAPLVDIALKISQLQEKTGRTGPTVIT 535          
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Match: pgm5 (phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060503-838])

HSP 1 Score: 493.426 bits (1269), Expect = 7.707e-169
Identity = 254/572 (44.41%), Postives = 372/572 (65.03%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVD-KV-AELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSS-GATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  F DQ+PG++GLR++T  F  Q++++ N++Q++ + +   D+    +++G DGR++++  I  VI+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG   DFGIK+N+ NGGP+P+ + ++I++ S+ +  +       IDLS+     F+ +   K F V I+DSV  YL+ ++ +FDF +IK+++TG D MGP              YV+ + C ELG  +++A NCVPLEDFGG++P+PN T+A  L+  M+ G+F  G AFD DGDR MILG+ GFFV+P DSLAV+A N+  + YF+Q G  GFARSMPTSSA+D KV   L    ++   T W+    L   +  S+C E     GSDHIREKDG+WA+L WLSI+   RK+      V+EI+  HW K GRN++ R+D+E         +M+ LE  +       +KF      + ++ AD+F+Y DP+D S S+NQG+RI+FTD SR+I+RLSG+G+  G+T+RIY +SY+++ +     ++V L PL+ I L I  I + TGR+ PT+IT
Sbjct:    8 VLTVQTTPFEDQRPGSTGLRRRTAVFETQKNFLQNYIQSLLSAIDLRDRQGCTMLVGSDGRYFSRTAI-EVIVQMAAANGIGRLVIGHNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPGGDFGIKFNIANGGPSPDTVMERIYQVSRTLEEYAICPDLHIDLSRLGRQDFDLENKFKPFRVEIVDSVEIYLNMLRGIFDFGAIKNLLTGPDLMGP--------------YVRRILCDELGAPVNSAVNCVPLEDFGGQYPNPNPTFAVSLMESMKGGEFGFGAAFDADGDRCMILGQNGFFVNPSDSLAVMAANLSCVPYFRQVGIRGFARSMPTSSALDSKVNPALFSDQLWGSVTQWRVSVELWVLDG-SVCLEPD---GSDHIREKDGLWAVLVWLSIIA-VRKQ-----GVEEIVRDHWAKLGRNYYCRFDYEGVDPRAAFYLMRDLEGVVTDKAFANQKFAVGNNVYSVEKADSFEYIDPVDGSVSRNQGLRIIFTDSSRIIFRLSGSGAGVGSTIRIYAESYERDPERHSRETQVVLGPLIAIALKISDIHERTGRRGPTIIT 554          
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Match: pgm5 (phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060503-838])

HSP 1 Score: 492.271 bits (1266), Expect = 1.624e-168
Identity = 254/574 (44.25%), Postives = 375/574 (65.33%), Query Frame = 1
Query:   70 VRNVVSKA--FTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVD-KV-AELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSS-GATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +R +V++   F DQ+PG++GLR++T  F  Q++++ N++Q++ + +   D+    +++G DGR++++  I  VI+ +AAANGI +++IG NGILSTPAVS IIRK  A GGI+LTASHNPGG   DFGIK+N+ NGGP+P+ + ++I++ S+ +  +       IDLS+     F+ +   K F V I+DSV  YL+ ++ +FDF +IK+++TG D MGP              YV+ + C ELG  +++A NCVPLEDFGG++P+PN T+A  L+  M+ G+F  G AFD DGDR MILG+ GFFV+P DSLAV+A N+  + YF+Q G  GFARSMPTSSA+D KV   L    ++   T W+    L   +  S+C E     GSDHIREKDG+WA+L WLSI+   RK+      V+EI+  HW K GRN++ R+D+E         +M+ LE  +       +KF      + ++ AD+F+Y DP+D S S+NQG+RI+FTD SR+I+RLSG+G+  G+T+RIY +SY+++ +     ++V L PL+ I L I  I + TGR+ PT+IT
Sbjct:    1 MRALVARTTPFEDQRPGSTGLRRRTAVFETQKNFLQNYIQSLLSAIDLRDRQGCTMLVGSDGRYFSRTAI-EVIVQMAAANGIGRLVIGHNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPGGDFGIKFNIANGGPSPDTVMERIYQVSRTLEEYAICPDLHIDLSRLGRQDFDLENKFKPFRVEIVDSVEIYLNMLRGIFDFGAIKNLLTGPDLMGP--------------YVRRILCDELGAPVNSAVNCVPLEDFGGQYPNPNPTFAVSLMESMKGGEFGFGAAFDADGDRCMILGQNGFFVNPSDSLAVMAANLSCVPYFRQVGIRGFARSMPTSSALDSKVNPALFSDQLWGSVTQWRVSVELWVLDG-SVCLEPD---GSDHIREKDGLWAVLVWLSIIA-VRKQ-----GVEEIVRDHWAKLGRNYYCRFDYEGVDPRAAFYLMRDLEGVVTDKAFANQKFAVGNNVYSVEKADSFEYIDPVDGSVSRNQGLRIIFTDSSRIIFRLSGSGAGVGSTIRIYAESYERDPERHSRETQVVLGPLIAIALKISDIHERTGRRGPTIIT 549          
BLAST of Phosphoglucomutase-1 vs. Ensembl Sea Lamprey
Match: pgm1 (phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1245])

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 319/572 (55.77%), Postives = 404/572 (70.63%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVVV--DKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKF---VVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +K + DQKPGTSGLRK+   F  +EHY +NFVQA+   +   +++   L+ GGDGRFY    I  +I  ++AANGI +++IG  GI STPAVS++IRK  A GGI+LTASHNPGG N DFGIK+N  NGGPAPE +T KIFE SK +  F T     +DL+K    TF  +   + F    V IIDSV DYL  +K++FD  +IKS++TG   +    +  ++++GVMG YV+ V  QELG    +A +C PLEDFGG HPDPNLTYA +LVT M+SG+F +G AFDGDGDRNMILG KGFFV+P DS+AV+A N+  I +FQ+ G  GFARSMPTS A+D+VAE+ K+ ++EVPTGWKFFGNLMDA KLSLCGEESFG GSDHIREKDGMWA+LAWLSIL  FRKE     S+++IM+ HW K+GRNFFTRYD+E   +     +M  LE  +     VGK F    ++F +  +DNF YTDP+D S SKNQG+R++FTDGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PLV I   +  I   TGR  PTVIT
Sbjct:   24 VVRVPTKPYDDQKPGTSGLRKRVSVFQSKEHYAENFVQAVLGSLEPGERTGATLLCGGDGRFYMHHAIA-LIARISAANGIGQLVIGQKGIFSTPAVSNLIRKRKAVGGIILTASHNPGGPNGDFGIKFNTANGGPAPEGVTAKIFELSKTLKEFLTCPDVNVDLTKVGTQTFNVEGAAQPFTAPAVEIIDSVEDYLVMLKDIFDLPAIKSLLTGPKAL---KLRVDAMHGVMGPYVRRVLVQELGAPADSAVSCEPLEDFGGHHPDPNLTYAAELVTAMKSGEFGVGAAFDGDGDRNMILGHKGFFVNPSDSVAVIAANISCIPFFQRTGVKGFARSMPTSGAIDRVAEVEKVALFEVPTGWKFFGNLMDAGKLSLCGEESFGTGSDHIREKDGMWALLAWLSILA-FRKE-----SIEQIMKAHWAKYGRNFFTRYDYEEVDSGAANTMMSDLEKKLFDPAFVGKAFTEGDKTFTVAKSDNFSYTDPVDGSVSKNQGLRLIFTDGSRIIFRLSGTGSAGATIRLYIDSYEKDPAKIYQDPQVMLAPLVAISQKLSDIHGRTGRTGPTVIT 585          
BLAST of Phosphoglucomutase-1 vs. Ensembl Yeast
Match: PGM1 (Phosphoglucomutase, minor isoform; catalyzes the conversion from glucose-1-phosphate to glucose-6-phosphate, which is a key step in hexose metabolism; PGM1 has a paralog, PGM2, that arose from the whole genome duplication [Source:SGD;Acc:S000001610])

HSP 1 Score: 530.791 bits (1366), Expect = 0.000e+0
Identity = 278/577 (48.18%), Postives = 377/577 (65.34%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVVVDKSD-YILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHS---ADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNA-ENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKF-RKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M  L+ +V + A+ DQKPGTSGLRKKTK FM E HY +NF+QA    + + S+   LV+GGDGRFYN DVI+N I  V AANG+ K++IG  G+LSTPA SHIIR +      GGI+LTASHNPGG   D GIKYN+ NGGPAPE +T+ I+E SK +  +K    F      N+    +N++ G   +V IID    Y+ ++KE+FDF+ IKS +          +L +SLNG+ G Y K +F  E G+      +N  PL DFGG HPDPNLTYA+ LV +++      G A DGDGDRNMI G    FVSP DS+A++A+    I YF ++G +G ARS PTSSA+D+VA    L  YEVPTGWKFF  L DA KLS+CGEESFG GS+HIREKDG+WAI+AWL+IL  + R+  +K  S++ I +  W ++GR FFTRYD+E+   EQ E+++ +L  F++  +V G  F A+    +I   D F Y D +D S S+NQG+ + F++G++ + RLSGTGSSGAT+R+Y++ Y    +    +++V LKP++   +   + K+I G  EPTV T
Sbjct:    1 MSLLIDSVPTVAYKDQKPGTSGLRKKTKVFMDEPHYTENFIQATMQSIPNGSEGTTLVVGGDGRFYN-DVIMNKIAAVGAANGVRKLVIGQGGLLSTPAASHIIRTYEEKCTGGGIILTASHNPGGPENDLGIKYNLPNGGPAPESVTNAIWEASKKLTHYKIIKNFP---KLNLNKLGKNQKYGP-LLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYGKAIFVDEFGLPAEEVLQNWHPLPDFGGLHPDPNLTYARTLVDRVDREKIAFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYAPEIPYFAKQGIYGLARSFPTSSAIDRVAAKKGLRCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKDGLWAIIAWLNILAIYHRRNPEKEASIKTIQDEFWNEYGRTFFTRYDYEHIECEQAEKVVALLSEFVSRPNVCGSHFPADESLTVIDCGD-FSYRD-LDGSISENQGLFVKFSNGTKFVLRLSGTGSSGATIRLYVEKYTDKKENYGQTADVFLKPVINSIVKFLRFKEILGTDEPTVRT 570          
BLAST of Phosphoglucomutase-1 vs. Ensembl Yeast
Match: PGM2 (Phosphoglucomutase; catalyzes the conversion from glucose-1-phosphate to glucose-6-phosphate, which is a key step in hexose metabolism; functions as the acceptor for a Glc-phosphotransferase; protein abundance increases in response to DNA replication stress; PGM2 has a paralog, PGM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004711])

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 278/577 (48.18%), Postives = 375/577 (64.99%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQE-HYVDNFVQAIFNVVVDKSD-YILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHS--ADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAF-EIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNA-ENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEH-KKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            M F +  V +K + DQKPGTSGLRKKTK F  E +Y +NF+Q+I   + + S    LV+GGDGR+YN DVIL+ I  + AANGI K++IG +G+LSTPA SHI+R +     GGI+LTASHNPGG   D GIKYN+ NGGPAPE +T+ I+E SK + S+K    F E+DL     T  +NK+ G   +V IID   DY++++KE+FDF+ IK  +          +L +S+NGV G Y K +F  E G+      +N  P  DFGG HPDPNLTYA  LV +++    + G A DGDGDRNMI G    FVSP DS+A++A+    I YF ++G +G ARS PTS A+D+VA+ H L  YEVPTGWKFF  L DA KLS+CGEESFG GS+H+REKDG+WAI+AWL+IL  + K H +   S++ I    W K+GR FFTRYDFE    E+  +I+  L  ++  S VV   F A+ +S  +    +F YTD +D S S +QG+ +  ++G+R + RLSGTGSSGAT+R+YI+ Y  +    + ++E  LKP++   +     KQ+ G +EPTV T
Sbjct:    1 MSFQIETVPTKPYEDQKPGTSGLRKKTKVFKDEPNYTENFIQSIMEAIPEGSKGATLVVGGDGRYYN-DVILHKIAAIGAANGIKKLVIGQHGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWEISKKLTSYKIIKDFPELDLG----TIGKNKKYGP-LLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADEVLQNWHPSPDFGGMHPDPNLTYASSLVKRVDREKIEFGAASDGDGDRNMIYGYGPSFVSPGDSVAIIAEYAAEIPYFAKQGIYGLARSFPTSGAIDRVAKAHGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKDGVWAIMAWLNILAIYNKHHPENEASIKTIQNEFWAKYGRTFFTRYDFEKVETEKANKIVDQLRAYVTKSGVVNSAFPAD-ESLKVTDCGDFSYTD-LDGSVSDHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIEKYCDDKSQYQKTAEEYLKPIINSVIKFLNFKQVLGTEEPTVRT 569          
BLAST of Phosphoglucomutase-1 vs. Ensembl Nematostella
Match: EDO38261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH5])

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 302/572 (52.80%), Postives = 399/572 (69.76%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVV--DKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEAN----GQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  F DQKPGTSGLRK    F Q +Y +NF+QAI + +   D+    LV+GGDGRF+ +D +   I+ +AAAN I +++IG NGI+STPAVS +IRK  A GGI+LTASHNPGG N DFG+KYN  NGGPAPE +T+ IFE +K ++ +K       DL+     +++    G+ F V+I DSV DY++ MKE+FDF+ +K  + G DG   +NIL +S++GV G YVK + C ELG S S+  NCVPLEDFGG HPDPNLTYA DLV  M+ G+  LG AFDGDGDRNMILG  GFFV+P DS+AV+ +N K+I YF + G  GFARSMPTS+A+D+VA+   +  +E PTGWKFFGNLMDA +L LCGEESFG GSDHIREKDG+WA LAWLSIL        + +SV E+++  W K GRNFFTRYD+EN  N+   ++   L    +   ++GK +        +S+ ++  D+F YTDPID S S+ QG+ ++FTDGSR++YRLSGTGS GAT+R+YI+SY+ +     + ++V L+PLV+I L I  ++ +TGR  PTVIT
Sbjct:    4 VSVVQTSPFEDQKPGTSGLRKPVSVFQQTNYTENFIQAILDAIPAKDRKGCTLVVGGDGRFFMRDAV-QTIVRMAAANEIGELVIGQNGIVSTPAVSCVIRKIKAQGGIILTASHNPGGPNGDFGVKYNTSNGGPAPEGVTNHIFELTKTMSQYKICTDITADLTALGTQSWDID--GRNFTVNIRDSVDDYVALMKEIFDFDLLKQFLGGQDGKPGMNILIDSMHGVTGPYVKRIVCGELGASESSVVNCVPLEDFGGHHPDPNLTYAADLVNIMKKGEHGLGAAFDGDGDRNMILGHNGFFVTPSDSVAVIGENYKSIPYFVKTGIKGFARSMPTSAALDRVAQKLGIEYFETPTGWKFFGNLMDAGRLCLCGEESFGTGSDHIREKDGVWAFLAWLSILA------NRKMSVAEVLKDFWSKNGRNFFTRYDYENVDNQAANRMNDNLRQQASEGALIGKTYTGGEGKYQKSYTVQKMDDFSYTDPIDGSISQKQGVCVIFTDGSRIVYRLSGTGSVGATIRVYIESYEPDVTKHMLDAQVMLRPLVDIALRISDLQALTGRDAPTVIT 566          
BLAST of Phosphoglucomutase-1 vs. Ensembl Nematostella
Match: EDO25365 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWP5])

HSP 1 Score: 48.1358 bits (113), Expect = 3.154e-6
Identity = 44/157 (28.03%), Postives = 73/157 (46.50%), Query Frame = 1
Query:  910 LGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQ-KGCHG-FARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMG-SDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDF 1371
            +G A DGD DR  +  + G FV     + ++      I Y  + KG +G    +   +  V K+ EL+ LP      G+K+   +M    + + GEES G+    HI E+DG++  L    +L +F  E  K  +++E+    +   GR  + R D 
Sbjct:    1 MGLATDGDADRIGLYDEDGNFVDAHHIILLL------IHYLHKYKGLNGKVVVAFSVTDRVKKMCELYNLPYQVTKIGFKYISKIMIDEDVLVGGEESGGIAVKGHIPERDGIFDGL----MLYQFMAETGK--TLKELCNEVYDVVGRFVYERNDL 145          
BLAST of Phosphoglucomutase-1 vs. Ensembl Medaka
Match: pgm1 (phosphoglucomutase 1 [Source:NCBI gene;Acc:101175638])

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 317/569 (55.71%), Postives = 422/569 (74.17%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFMQ-EHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            +  V +K + DQKPGTSGLRK+   F Q +HY +NF+Q+I +VV   ++    LV+GGDGRF+ KD I  +I+ +AAANGI+ ++IG NGI+STPAVS +IRK  A GGI+LTASHNPGG N DFGIKYN+ +GGPAPE IT+KIFE SK +  +      ++DLSK  + TFE  ET K F+V I+DSV  Y   ++++FDF ++K++++G +    IN+  ++++GV+G Y++ + C+ELG   ++A NCVP EDFGG HPDPNLTYA DLV  M+SG++D G AFDGDGDRNM+LGK GFFV+P DS+A +A N+ +I YF++ G  G ARSMPTS A+D VA+  ++ +YE PTGWKFFGNLMDA KLSLCGEESFG GSDHIREKDG+WA+LAWLSIL   RK+     SV+EIM+ HW  FGRNFFTRYD+E   ++   +++K LE  +     VGK F +  +S+++ +ADNF YTDP+D S SKNQG+RI+F+DGSR+I+RLSGTGS+GAT+R+YIDSY+K+        +V L PLV+I L + Q+ + TGR  PTVIT
Sbjct:    4 ITTVKTKPYADQKPGTSGLRKRVTVFQQNQHYAENFIQSIISVVDPAERQAATLVVGGDGRFFMKDAI-QLIVQIAAANGINHLVIGQNGIMSTPAVSCVIRKIKAVGGIILTASHNPGGPNGDFGIKYNISSGGPAPEGITNKIFEISKALQEYHICPDLKVDLSKIGKQTFE-VETFKPFIVEIVDSVEAYAEMLRDIFDFPALKNLLSGPNH---INVRLDAMHGVVGPYIRKIVCEELGSPANSAVNCVPQEDFGGHHPDPNLTYAADLVNTMKSGEYDFGAAFDGDGDRNMVLGKHGFFVNPSDSVAAIAANITSIPYFKKTGVKGLARSMPTSGALDNVAKALQMELYETPTGWKFFGNLMDAGKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILAT-RKQ-----SVEEIMKNHWQTFGRNFFTRYDYEEVDSDAANKMIKDLEAQMFEPSFVGKTFSSGDKSYVVAVADNFAYTDPVDGSVSKNQGLRIIFSDGSRIIFRLSGTGSAGATIRLYIDSYEKDPQKIYQDPQVMLAPLVDIALKVSQLHERTGRTGPTVIT 561          
BLAST of Phosphoglucomutase-1 vs. Ensembl Medaka
Match: ENSORLT00000012986.2 (phosphoglucomutase-1 [Source:NCBI gene;Acc:101175508])

HSP 1 Score: 608.216 bits (1567), Expect = 0.000e+0
Identity = 296/569 (52.02%), Postives = 400/569 (70.30%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHF-MQEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            V  V +  + DQ+P +SGLRKK   F  +  Y+ NF+Q+IF+ +   D+    +V+GGDGRF+N+  I  VI+ +AAANG+ ++IIG +GI+STPAV  +IRK+ A GGI+LTASHNPGG + DFGIK+N  NGGPA E +T KIF+ S+ +  F       +DL    +  F+ +   K   V I+DSV  Y + ++ +FDF ++K +++G +   PI +  ++++GV+G YVK + C+ELG    +A NCVP+EDFGG+HPDPNLT A +LV  M  G FD G AFDGDGDRNMILGK GFFV+P DSLAV+ADN+  I YFQ  G  GFARSMPTS+A+D+VA+  K+ +YE P GWKFFGNLMDA  +SLCGEESFG G DHIREKDG+WA+LAWLSI+   R+      SV++I++ HW K+GRN+FTRYD++N   +    +M+ LE  IA    V ++F    + F ++ ADNF+YTDP+D S S+NQG+RI+F+DGSR+IYRLSGTG+ GATVRIY+DSY+K  D+    ++V L PL  I L I Q+   TGR  P++IT
Sbjct:    8 VLTVATAPYPDQRPSSSGLRKKVSVFQFKRSYLHNFIQSIFSSIDLRDRQGSTMVVGGDGRFFNRAAI-EVIVQMAAANGVGRLIIGHHGIMSTPAVPCVIRKYKAIGGIILTASHNPGGPDGDFGIKFNTANGGPASEAVTSKIFQISRTLEKFAICPGLRVDLETLGKQAFDLENKFKPLTVEIVDSVESYANLLRNIFDFAALKDLLSGEN---PIRVRIDAMHGVLGPYVKRILCKELGCPAISAINCVPMEDFGGQHPDPNLTDAAELVDSMRDGSFDFGAAFDGDGDRNMILGKHGFFVTPSDSLAVIADNIFCIPYFQHSGVRGFARSMPTSTALDRVAKATKIEIYETPAGWKFFGNLMDAGLVSLCGEESFGTGGDHIREKDGLWAVLAWLSIISTRRR------SVEDIVKDHWLKYGRNYFTRYDYQNVDLDAVCDMMEDLEIMIADKTFVKQRFAVKDKIFQVEKADNFEYTDPVDSSISRNQGLRIIFSDGSRIIYRLSGTGNDGATVRIYLDSYEK--DLLFEDTQVMLSPLATIALKISQLHLRTGRIGPSIIT 564          
BLAST of Phosphoglucomutase-1 vs. Ensembl Medaka
Match: pgm5 (phosphoglucomutase-like protein 5 [Source:NCBI gene;Acc:101165066])

HSP 1 Score: 491.5 bits (1264), Expect = 1.271e-168
Identity = 238/495 (48.08%), Postives = 337/495 (68.08%), Query Frame = 1
Query:   70 VRNVVSKAFTDQKPGTSGLRKKTKHFM-QEHYVDNFVQAIFNVV--VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQ 1545
            V  V +  F DQ+PGTSGLR+KT  F  + +Y+ N++Q++ + +   D+    +V+G DGR++++     VI+ +AAANGI +++IG N +LSTPAVS IIRK  A GGI+LTASHN GG   +FGIK+NV NGGP+ + + ++I + S+ +  +       IDLS+     F+ +   K F V I+DSV  YL  ++ +FDF++IKS++TG D    + I  +++NGVMG YV+ + C ELG   ++A NCVPLEDFGGR P+PNLTYA  LV  M+ GDF  G AFD DGDR MILG+ GFFV+P DS+A++A N+  I YF+Q G  GFARSM TS A+D+VA+  KL +YE P GW++FGNLMD+ + SLCGEESFG GSDHIREKDG+W++L WLSI+   RK+     SV++++  HW KFGRN+F R+D+E         +M+ LET I+      +KF    + + ++ A+NF+Y DP+D + ++NQ
Sbjct:    8 VVTVQTSPFEDQRPGTSGLRRKTAVFEGKRNYLQNYIQSLLSSIDLRDRQGCTMVVGSDGRYFSRAAT-EVIVQMAAANGIGRLVIGHNSLLSTPAVSCIIRKIKAIGGIILTASHNSGGPGGNFGIKFNVANGGPSSDTVMERISQVSRTLEEYAICPDLRIDLSRLGRQEFDLENKFKPFRVEIVDSVEVYLQLLRSIFDFSAIKSLLTGPD---QLKIHIDAMNGVMGPYVRRILCDELGAPANSAVNCVPLEDFGGRPPEPNLTYATSLVEAMKGGDFGFGAAFDADGDRYMILGENGFFVNPSDSVAIMAANLSTIPYFKQHGVRGFARSMATSCALDRVAKAMKLALYETPAGWRYFGNLMDSGRCSLCGEESFGTGSDHIREKDGLWSVLMWLSIMAA-RKQ-----SVEQLVREHWAKFGRNYFCRFDYEGLDPRAAFYLMRDLETVISDKAFTSQKFAVGERIYSVERAENFEYIDPVDGTVARNQ 492          
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Match: SMESG000046578.1 (SMESG000046578.1)

HSP 1 Score: 1175.61 bits (3040), Expect = 0.000e+0
Identity = 569/570 (99.82%), Postives = 570/570 (100.00%), Query Frame = 1
Query:   58 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWA+LAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT
Sbjct:    1 MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAVLAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 570          
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Match: SMESG000046578.1 (SMESG000046578.1)

HSP 1 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 539/540 (99.81%), Postives = 540/540 (100.00%), Query Frame = 1
Query:  148 MQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            MQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWA+LAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT
Sbjct:    1 MQEHYVDNFVQAIFNVVVDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKELFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAVLAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 540          
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Match: SMESG000000652.1 (SMESG000000652.1)

HSP 1 Score: 370.163 bits (949), Expect = 1.149e-124
Identity = 175/340 (51.47%), Postives = 223/340 (65.59%), Query Frame = 1
Query:  748 MGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRILFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEIGLNICQIKQITGRKEPTVIT 1767
            MG YV+ +   EL V   N  +C PLEDFG  HPDPNLTYA++LV  M    FD GCAFDGDGDRNMILG KGFFVSP DSLAV+ADN+K I YF++KG  GFARSMPTS AVD+VA+ H + ++EVPTGWKFFGNLMD  ++SLCGEESFGMGS+HIREKDG+W++LAWLS+L   R +  K ISV+ ++E HW +FGRNF+TRYD+E C +E G++IMK+L+  I     VG+ +++  + + IK+ +NF Y D +D + S NQ                                               LKPL+++ L ICQI+ +TGR  PTVIT
Sbjct:    1 MGPYVRRILGDELKVPFDNMIHCDPLEDFGSNHPDPNLTYARNLVEIMTESTFDFGCAFDGDGDRNMILGSKGFFVSPSDSLAVIADNLKIIPYFKRKGIQGFARSMPTSRAVDRVAQKHGIMLHEVPTGWKFFGNLMDTYQISLCGEESFGMGSNHIREKDGLWSVLAWLSVLSFLRHKEHKLISVESVIESHWKRFGRNFYTRYDYEACKSEDGDEIMKILQKLIRQPTTVGRAYKSGEKEYKIKLCNNFTYLDLVDETTSTNQE---------------------------------------------KLKPLIDVALEICQIQSVTGRNNPTVIT 295          
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Match: SMESG000000652.1 (SMESG000000652.1)

HSP 1 Score: 353.214 bits (905), Expect = 2.656e-118
Identity = 158/266 (59.40%), Postives = 201/266 (75.56%), Query Frame = 1
Query:  748 MGVYVKTVFCQELGVSLSNAENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILGKKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELHKLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAWLSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIMKVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQ 1545
            MG YV+ +   EL V   N  +C PLEDFG  HPDPNLTYA++LV  M    FD GCAFDGDGDRNMILG KGFFVSP DSLAV+ADN+K I YF++KG  GFARSMPTS AVD+VA+ H + ++EVPTGWKFFGNLMD  ++SLCGEESFGMGS+HIREKDG+W++LAWLS+L   R +  K ISV+ ++E HW +FGRNF+TRYD+E C +E G++IMK+L+  I     VG+ +++  + + IK+ +NF Y D +D + S NQ
Sbjct:    1 MGPYVRRILGDELKVPFDNMIHCDPLEDFGSNHPDPNLTYARNLVEIMTESTFDFGCAFDGDGDRNMILGSKGFFVSPSDSLAVIADNLKIIPYFKRKGIQGFARSMPTSRAVDRVAQKHGIMLHEVPTGWKFFGNLMDTYQISLCGEESFGMGSNHIREKDGLWSVLAWLSVLSFLRHKEHKLISVESVIESHWKRFGRNFYTRYDYEACKSEDGDEIMKILQKLIRQPTTVGRAYKSGEKEYKIKLCNNFTYLDLVDETTSTNQ 266          
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Match: SMESG000000655.1 (SMESG000000655.1)

HSP 1 Score: 191.815 bits (486), Expect = 2.021e-57
Identity = 92/172 (53.49%), Postives = 133/172 (77.33%), Query Frame = 1
Query:   67 LVRNVVSKA---FTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVV---VDKSDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSHIIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQSKLINSFKTT-DAFEIDLSK 561
            +   ++SK    F+DQKPGTSGLRK TK F+Q +Y +N++QAIFN +   ++     LV+GGDGR++NK VI  +++P+AAAN I+K+IIG NG+LSTPA SH+IRK+ ADGGI+LTASHNPGGLN DFGIK+N+ NGGP  + ++++++ ++  I+S+ T  ++ EIDLS+
Sbjct:    1 MTYTIISKETFPFSDQKPGTSGLRKTTKTFLQTNYTENYLQAIFNTLKGRIELGGVTLVVGGDGRYHNKYVIEKILIPMAAANRIAKLIIGLNGLLSTPAASHLIRKYGADGGIILTASHNPGGLNFDFGIKFNLSNGGPCTDKVSNELYNETLQISSYVTVLESMEIDLSE 172          
The following BLAST results are available for this feature:
BLAST of Phosphoglucomutase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGM10.000e+056.24phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM10.000e+056.26phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM10.000e+056.48phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM50.000e+047.72phosphoglucomutase 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
PGM12.525e-16258.13phosphoglucomutase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R05F9.60.000e+051.90pep chromosome:WBcel235:II:4889437:4891427:1 gene:... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pgm10.000e+052.71gene:FBgn0003076 transcript:FBtr0075492[more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgm10.000e+055.30phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
pgm50.000e+048.07phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
pgm50.000e+048.07phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bud230.000e+054.48BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud230.000e+054.39BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud230.000e+054.61BUD23, rRNA methyltransferase and ribosome maturat... [more]
bud230.000e+055.49BUD23, rRNA methyltransferase and ribosome maturat... [more]
PGM50.000e+050.62phosphoglucomutase 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgm10.000e+056.69phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm10.000e+056.69phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm10.000e+056.61phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm10.000e+056.61phosphoglucomutase 1 [Source:MGI Symbol;Acc:MGI:97... [more]
Pgm50.000e+048.07phosphoglucomutase 5 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36871|PGM1_HUMAN0.000e+056.24Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PG... [more]
sp|P00949|PGM1_RABIT0.000e+056.41Phosphoglucomutase-1 OS=Oryctolagus cuniculus OX=9... [more]
sp|Q9D0F9|PGM1_MOUSE0.000e+056.69Phosphoglucomutase-1 OS=Mus musculus OX=10090 GN=P... [more]
sp|Q4R5E4|PGM1_MACFA0.000e+056.04Phosphoglucomutase-1 OS=Macaca fascicularis OX=954... [more]
sp|P38652|PGM1_RAT0.000e+056.36Phosphoglucomutase-1 OS=Rattus norvegicus OX=10116... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5I8J80.000e+057.60Phosphoglucomutase OS=Anoplophora glabripennis OX=... [more]
A0A1B6C2170.000e+056.74Uncharacterized protein (Fragment) OS=Clastoptera ... [more]
R7UBE90.000e+056.92Uncharacterized protein OS=Capitella teleta OX=283... [more]
V4B4040.000e+056.37Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1B6JU520.000e+055.34Uncharacterized protein OS=Homalodisca liturata OX... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgm10.000e+055.65phosphoglucomutase 1 [Source:NCBI gene;Acc:1030384... [more]
ENSAMXT00000019378.20.000e+052.72phosphoglucomutase-1-like [Source:NCBI gene;Acc:10... [more]
pgm10.000e+052.65phosphoglucomutase 1 [Source:NCBI gene;Acc:1030384... [more]
pgm57.707e-16944.41phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
pgm51.624e-16844.25phosphoglucomutase 5 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgm10.000e+055.77phosphoglucomutase 1 [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PGM10.000e+048.18Phosphoglucomutase, minor isoform; catalyzes the c... [more]
PGM20.000e+048.18Phosphoglucomutase; catalyzes the conversion from ... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO382610.000e+052.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO253653.154e-628.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pgm10.000e+055.71phosphoglucomutase 1 [Source:NCBI gene;Acc:1011756... [more]
ENSORLT00000012986.20.000e+052.02phosphoglucomutase-1 [Source:NCBI gene;Acc:1011755... [more]
pgm51.271e-16848.08phosphoglucomutase-like protein 5 [Source:NCBI gen... [more]
back to top
BLAST of Phosphoglucomutase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046578.10.000e+099.82SMESG000046578.1[more]
SMESG000046578.10.000e+099.81SMESG000046578.1[more]
SMESG000000652.11.149e-12451.47SMESG000000652.1[more]
SMESG000000652.12.656e-11859.40SMESG000000652.1[more]
SMESG000000655.12.021e-5753.49SMESG000000655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013845 ID=SMED30013845|Name=Phosphoglucomutase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1854bp
CAGATAATTCATAGAAATTAATTTTAACTCACGTACTTAATTTAAAGTTT
TATAAAAATGCAATTCTTAGTACGAAATGTTGTATCAAAAGCATTTACTG
ATCAGAAACCGGGTACTAGTGGGTTAAGGAAAAAAACAAAACACTTCATG
CAAGAACATTATGTTGATAATTTTGTACAGGCTATATTTAATGTAGTAGT
TGATAAATCTGATTATATCTTGGTATTGGGTGGTGATGGGAGGTTTTACA
ACAAAGATGTGATATTAAATGTAATTTTACCAGTAGCAGCTGCTAATGGC
ATCAGCAAAGTTATTATCGGAACAAATGGAATTCTATCAACTCCTGCAGT
ATCGCACATTATAAGAAAACATTCAGCAGATGGTGGTATAGTTTTGACAG
CTAGCCATAATCCTGGGGGCCTTAACGAAGATTTTGGAATCAAATATAAT
GTTAAAAATGGAGGACCTGCTCCCGAACATATCACTGATAAAATTTTCGA
ACAATCTAAATTAATTAATTCATTTAAAACCACTGATGCTTTTGAAATTG
ATTTATCAAAAAATATCGAAACGACATTCGAAAATAAAGAAACCGGGAAA
AAATTTGTAGTCAGCATCATTGATTCTGTGGCTGATTATTTGAGTTATAT
GAAAGAATTGTTTGATTTTAATTCCATTAAGTCAATGGTGACTGGTTCCG
ATGGCATGGGACCAATTAATATTCTTGCTAATTCATTAAACGGAGTGATG
GGAGTTTACGTTAAAACCGTCTTTTGCCAAGAACTTGGAGTTTCACTGAG
TAATGCGGAAAATTGTGTTCCGCTTGAAGATTTCGGAGGTCGCCATCCTG
ATCCAAATCTCACTTATGCTAAAGATCTAGTGACAAAAATGGAAAGTGGA
GATTTTGATCTCGGATGTGCATTTGACGGGGATGGAGATCGAAACATGAT
TTTAGGGAAAAAAGGATTTTTTGTTTCACCTTGTGATTCACTGGCAGTTG
TGGCGGATAACGTTAAGGCAATTAAATATTTTCAACAAAAAGGTTGTCAT
GGATTTGCTAGGAGTATGCCAACTAGCTCAGCTGTTGATAAGGTCGCTGA
GCTTCACAAACTTCCAGTTTATGAAGTGCCAACTGGATGGAAATTTTTCG
GCAATCTCATGGATGCAAATAAATTATCATTGTGTGGAGAAGAAAGTTTT
GGAATGGGTTCAGATCACATTCGTGAAAAGGATGGCATGTGGGCTATTTT
GGCATGGCTATCGATTTTATGCAAATTCCGTAAAGAACATAAAAAGCCAA
TTTCTGTCCAAGAGATAATGGAACTTCATTGGGGAAAATTTGGACGGAAT
TTCTTTACTCGATATGATTTTGAGAATTGCACCAATGAACAGGGAGAACA
GATTATGAAAGTTTTGGAAACGTTTATTGCAAGTTCTGACGTGGTGGGGA
AAAAATTCGAAGCAAACGGCCAGAGTTTTATCATTAAAATTGCCGATAAT
TTCCAATACACTGATCCAATTGATCATTCTCATTCGAAAAATCAAGGAAT
TCGAATTCTGTTTACCGATGGATCTAGACTGATTTATAGGCTCAGTGGAA
CTGGTAGCAGTGGCGCAACTGTGAGGATTTACATTGATAGTTATCAGAAA
AATGCTGATATTTGTAAAATTTCATCGGAAGTGGCCTTAAAACCGTTAGT
GGAAATCGGTCTGAATATTTGCCAAATCAAACAAATTACCGGAAGAAAAG
AACCAACTGTTATTACGTAGATTATATTCCCATTCGGCATTGTGATTTGC
AGCAGTGATTCTCTCCCTTTCATTGAAATAGAATATGTGACTTCGAAAAA
AAAA
back to top

protein sequence of SMED30013845-orf-1

>SMED30013845-orf-1 ID=SMED30013845-orf-1|Name=SMED30013845-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=571bp
MQFLVRNVVSKAFTDQKPGTSGLRKKTKHFMQEHYVDNFVQAIFNVVVDK
SDYILVLGGDGRFYNKDVILNVILPVAAANGISKVIIGTNGILSTPAVSH
IIRKHSADGGIVLTASHNPGGLNEDFGIKYNVKNGGPAPEHITDKIFEQS
KLINSFKTTDAFEIDLSKNIETTFENKETGKKFVVSIIDSVADYLSYMKE
LFDFNSIKSMVTGSDGMGPINILANSLNGVMGVYVKTVFCQELGVSLSNA
ENCVPLEDFGGRHPDPNLTYAKDLVTKMESGDFDLGCAFDGDGDRNMILG
KKGFFVSPCDSLAVVADNVKAIKYFQQKGCHGFARSMPTSSAVDKVAELH
KLPVYEVPTGWKFFGNLMDANKLSLCGEESFGMGSDHIREKDGMWAILAW
LSILCKFRKEHKKPISVQEIMELHWGKFGRNFFTRYDFENCTNEQGEQIM
KVLETFIASSDVVGKKFEANGQSFIIKIADNFQYTDPIDHSHSKNQGIRI
LFTDGSRLIYRLSGTGSSGATVRIYIDSYQKNADICKISSEVALKPLVEI
GLNICQIKQITGRKEPTVIT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036900A-D-PHexomutase_C_sf
IPR005841Alpha-D-phosphohexomutase_SF
IPR005844A-D-PHexomutase_a/b/a-I
IPR005843A-D-PHexomutase_C
IPR016055A-D-PHexomutase_a/b/a-I/II/III
IPR005846A-D-PHexomutase_a/b/a-III
IPR005845A-D-PHexomutase_a/b/a-II
IPR016066A-D-PHexomutase_CS
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0071704organic substance metabolic process
GO:0006006glucose metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016868intramolecular transferase activity, phosphotransferases
GO:0000287magnesium ion binding
GO:0004614phosphoglucomutase activity
GO:0016853isomerase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016529sarcoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005841Alpha-D-phosphohexomutase superfamilyPRINTSPR00509PGMPMMcoord: 109..123
score: 66.67
coord: 255..268
score: 55.06
coord: 219..238
score: 28.02
coord: 283..298
score: 61.33
IPR005846Alpha-D-phosphohexomutase, alpha/beta/alpha domain IIIPFAMPF02880PGM_PMM_IIIcoord: 313..427
e-value: 8.6E-25
score: 87.1
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 198..303
e-value: 7.1E-36
score: 124.9
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 5..197
e-value: 1.3E-76
score: 258.6
NoneNo IPR availableGENE3DG3DSA:3.30.310.50coord: 411..570
e-value: 6.0E-63
score: 213.5
NoneNo IPR availableGENE3DG3DSA:3.40.120.10coord: 304..403
e-value: 1.2E-40
score: 139.6
NoneNo IPR availablePANTHERPTHR22573PHOSPHOHEXOMUTASE FAMILY MEMBERcoord: 6..570
IPR005844Alpha-D-phosphohexomutase, alpha/beta/alpha domain IPFAMPF02878PGM_PMM_Icoord: 16..150
e-value: 1.8E-33
score: 115.2
IPR005843Alpha-D-phosphohexomutase, C-terminalPFAMPF00408PGM_PMM_IVcoord: 493..543
e-value: 1.5E-5
score: 25.1
IPR005845Alpha-D-phosphohexomutase, alpha/beta/alpha domain IIPFAMPF02879PGM_PMM_IIcoord: 193..303
e-value: 6.6E-13
score: 49.2
IPR016066Alpha-D-phosphohexomutase, conserved sitePROSITEPS00710PGM_PMMcoord: 110..119
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 7..205
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 192..305
IPR016055Alpha-D-phosphohexomutase, alpha/beta/alpha I/II/IIISUPERFAMILYSSF53738Phosphoglucomutase, first 3 domainscoord: 291..435
IPR036900Alpha-D-phosphohexomutase, C-terminal domain superfamilySUPERFAMILYSSF55957Phosphoglucomutase, C-terminal domaincoord: 430..570