Transposase, Tc1-like protein

Overview
NameTransposase, Tc1-like protein
Smed IDSMED30013844
Length (bp)2104
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposase, Tc1-like protein (SMED30013844) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposase, Tc1-like protein (SMED30013844) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposase, Tc1-like protein (SMED30013844) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposase, Tc1-like protein (SMED30013844) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013844SMESG000052306.1 SMESG000022767.1 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013844SMESG000052306.1 SMESG000022767.1 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013844SMESG000052306.1 SMESG000022767.1 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30013844SMESG000052306.1 SMESG000022767.1 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000022809.1 SMESG000022808.1 Contig38122newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000022809.1 SMESG000022808.1 Contig38122uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000026220.1 Contig30306newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000026220.1 Contig30306uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000008737.1 Contig15210newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013844SMESG000008737.1 Contig15210uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30013844SMESG000051975.1 Contig12724newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013844SMESG000051975.1 Contig12724uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A4Q9LLI7 (Uncharacterized protein (Fragment) OS=Hamiltosporidium tvaerminnensis OX=1176355 GN=CWI38_2203p0010 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 5.014e-127
Identity = 202/366 (55.19%), Postives = 256/366 (69.95%), Query Frame = 1
Query:  364 LKHGTINDISAKYNVLRASISKLWRNASEQLRTDEIVIDSSSMRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKEFKLLRRVSSTVKPLLTDRNKIERLTFCLSYIKT----DGCFDNFFNHVHIDDKWFYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENYFDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVFLMIRAKFPRS--NDIIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANAGN 1443
            LK G IN++S+ +  L    + +      Q R D   + SS  +  CGRK K Y   L  ++ IPLN RG LRSLS A  IPK+TLF      K ++R+SSTVKP LTD+NK++RL FCLS +      D  FD+ +++VHID+KWFYL+KVKRS YL ++EE P R  +SKRFI K+MF+AAVARPR D   +NYFDGKIGIWPFVY+E A+RNSKNR KGT ITKN+ES+T+   K MI  NV   I++KFP +     IYVQQ N KPHF+++D D++  GS D ++I FK QP NSPD+NVLDLGFFN+IQS+QH  SP TIDELI+CV +AF +L  + LDNVF TLQ CME  +LA+ GN
Sbjct:   31 LKLGAINEVSSAFQNLACCTNSI------QKRQDMCHV-SSKKKKRCGRKPKEYSKNLAQIRNIPLNRRGTLRSLSLAIDIPKSTLFDIFISGKYMKRISSTVKPTLTDKNKMDRLKFCLSKVNLANNGDFLFDDLYDYVHIDEKWFYLTKVKRSYYLMLNEEEPERNYKSKRFIMKIMFMAAVARPRYDAHRKNYFDGKIGIWPFVYQEPAQRNSKNRAKGTMITKNVESVTAVHCKNMIIDNVIPAIKSKFPPAYKKKTIYVQQDNAKPHFSDNDADIVALGSADDWNIKFKAQPANSPDLNVLDLGFFNSIQSLQHEASPHTIDELINCVQDAFHQLEANTLDNVFTTLQACMESIMLADGGN 389          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A1R3KDY3 (Transposase, Tc1-like protein OS=Corchorus olitorius OX=93759 GN=COLO4_08929 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 2.426e-111
Identity = 186/399 (46.62%), Postives = 252/399 (63.16%), Query Frame = 1
Query:  361 KLKHGTINDISAKYNVLRASISKLWRNASEQLRTDEIVIDSSSMRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKEFKLLRRVSSTVKPLLTDRNKIERLTFCLSYIKTDGCFDN-----FFNHVHIDDKWFYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENYFDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVFLMIRAKFPR-SNDIIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANAGNNYKLPRISKAKLCNNGTLPVSITCKPEAILTA 1539
            KLK G+I   +  +N    ++ ++W  A   L   E V  SS      GRKR   D  +N + KIPL  R  LRSL+ A  +PKTT++R +KE  L++  S+ +KP LT++NK+ RL FCLS +     ++N      +++VHID+KWF++SK     YL   E  PHRTC+SKRFI KVMF+A VARPR    S  +F+GKIGI+PFVY+E AKRNSKNR  GT  TK I SIT +  +K + +NV   IR K+P   +  IY+QQ N KPH + +D + LE   +DGF I   NQPPNSPD+NVLDLGFF AIQ++Q+  +P T+ EL+S V  +FD L P+ L+NVFL+LQ CM E +    GNNY+L  ++K +L   G LP S +C  + +  A
Sbjct:   38 KLKWGSIKADATSFNTSARTVRRIWLEAKRALSVGEPVDLSSKAIGKVGRKRVEID--VNDIAKIPLRRRTNLRSLAQALNMPKTTVYRRVKE-GLVKPHSNAIKPFLTEQNKMVRLKFCLSMLNNGTLYNNPIFVDMYDYVHIDEKWFFMSKTTERYYLLPWEVEPHRTCKSKRFIPKVMFMAVVARPRFVKESNQFFNGKIGIFPFVYQEPAKRNSKNRRVGTLETKPIASITKEVTRKCLIENVLPAIREKWPEYGSKTIYIQQDNAKPHIDSNDAEFLEAARRDGFDIRLTNQPPNSPDLNVLDLGFFRAIQALQYQEAPNTVAELVSVVERSFDRLPPESLNNVFLSLQLCMIEVMKVLGGNNYRLKHVNKNRLEGQGELPTSFSCDQDIVKQA 433          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A1R3J2B7 (Uncharacterized protein OS=Corchorus olitorius OX=93759 GN=COLO4_20007 PE=4 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 5.851e-111
Identity = 185/399 (46.37%), Postives = 249/399 (62.41%), Query Frame = 1
Query:  361 KLKHGTINDISAKYNVLRASISKLWRNASEQLRTDEIVIDSSSMRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKEFKLLRRVSSTVKPLLTDRNKIERLTFCLSYIKT-----DGCFDNFFNHVHIDDKWFYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENYFDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVFLMIRAKFPR-SNDIIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANAGNNYKLPRISKAKLCNNGTLPVSITCKPEAILTA 1539
            KLK G+I   +  +N    ++ ++W  A   L   E V  SS      GRKR   D  +N + KIPL  R  LRSL+ A  +P T ++R +KE  L++  S  +KP LTD+NK  RL FCLS +       +  F + +++VHID+KWF++SK     YL   E  PHRTC+SKRFI KVMF+AAVARPR    S  +F+GKIGI+PFVY+E AKRNSKNR  GT  TK I SIT +  +K + +N+   IR K+P   +  IY+QQ N KPH + +D + LE   +DGF I   NQPPNSPD+NVLDLGFF AIQ++Q+  +P T+ EL+S V  +FD L P+ L+NVFL+LQ CM E +    GNNY+L  ++K +L   G LP S +C  + +  A
Sbjct:   38 KLKWGSIKAAATSFNTSTRTVRRIWLEAQRALSVGEPVDLSSKAIGRVGRKRVEID--VNDVAKIPLRRRTNLRSLAQALNMPTTIVYRRVKE-GLVKPHSDAIKPFLTDQNKKVRLKFCLSMLNNGTLHHNPTFVDMYDYVHIDEKWFFMSKTTERYYLLPSEVEPHRTCKSKRFIPKVMFMAAVARPRFVKESNQFFNGKIGIFPFVYQEPAKRNSKNRRVGTLETKPIASITKEVTRKCLIENILPAIREKWPEYGSKTIYIQQDNAKPHIDSNDAEFLEAARRDGFDIRLTNQPPNSPDLNVLDLGFFRAIQALQYQEAPNTVAELVSAVERSFDRLSPESLNNVFLSLQLCMIEVMKVLGGNNYRLKHVNKNRLEGQGELPTSFSCDQDIVKQA 433          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: A0A081AT54 (HTH_Tnp_Tc3_2 domain-containing protein OS=Phytophthora parasitica P1976 OX=1317066 GN=F444_03700 PE=4 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 1.504e-102
Identity = 180/407 (44.23%), Postives = 252/407 (61.92%), Query Frame = 1
Query:  328 FLMNKSS*NPPKLKHGTINDISAKYNVLRASISKLWRNASEQLRTDEIVID--SSSMRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKEFKLLRRVSSTVKPLLTDRNKIERLTFCLSYI--KTDG--CFDNFFNHVHIDDKWFYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENYFDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVFLMIRAKFPRSND--IIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANAGNNYKLPRISKAKLCNNGTLPVSITCKPE 1524
            FL+++S  +  ++  G I+   AKY   R++IS+LW    ++ RT+E  +   +S +  NCGRK  + D+    ++KIPL+ R  ++SL+ A G+  T + R LKE    RR SS VKP LT+ N++ R+ F LS+   K  G   F + F+ VHID+KWF     ++  YL  +EE P R  QSKRFI+K MF+AAVARPR D   +  FDGKIGIW F  + EAKR SKNR KGT + +N+ES+  + YK  +  ++   I+AK+PRS     IY+QQ N KPH + DDPD++  G   G+ I  + QPPNSPD+NVLDLG+F +IQS+Q+    + ++ L+  V++AF  +  D L+ +F+TLQ CME  I AN GNNYK P   K  L   G LPVS  C  E
Sbjct:   17 FLLDRS--DNGEISGGDISAAVAKYGRHRSTISRLW-ELHKKTRTEENRLGNLASGLIGNCGRKAIDTDELRLQIRKIPLSRRMTIKSLAAALGVSTTVVRRLLKE-GAFRRHSSNVKPALTEENRLARVQFALSHTTRKRGGEMVFADMFDVVHIDEKWFNEDTDRKCYYLDANEEEPVRQRQSKRFISKTMFIAAVARPRYDAHRKQAFDGKIGIWAFAEEYEAKRTSKNRPKGTIVLRNVESVDREAYKATLIGDIIPAIKAKWPRSGKKRTIYIQQDNAKPHVSVDDPDIMAAGRSGGWDIRMRCQPPNSPDLNVLDLGYFRSIQSLQYQTECRGVEALLDAVNSAFSAMKADTLNKIFMTLQTCMECIIRANGGNNYKTPHRGKDALKKAGQLPVSFACSAE 419          
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Match: W2NW41 (HTH_Tnp_Tc3_2 domain-containing protein OS=Phytophthora parasitica OX=4792 GN=L914_03500 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 7.069e-102
Identity = 179/406 (44.09%), Postives = 248/406 (61.08%), Query Frame = 1
Query:  328 FLMNKSS*NPPKLKHGTINDISAKYNVLRASISKLWR-NASEQLRTDEIVIDSSSMRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKEFKLLRRVSSTVKPLLTDRNKIERLTFCLSYI--KTDG--CFDNFFNHVHIDDKWFYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENYFDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVFLMIRAKFPRSND--IIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANAGNNYKLPRISKAKLCNNGTLPVSITCKPE 1524
            FL+++S  +  ++  G I+   AKY   R++IS+LW  +   Q   + +   +S +  NCGRK  + D+    ++KIPL+ R  ++SL+ A G+  T + R LKE    RR SS VKP LT+ N++ R+ F LS+   K  G   F + F+ VHID+KWF     ++  YL  DEE P R  QSKRFI+K MF+AAVARPR D   +  FDGKIGIW F  + EAKR SKNR KGT + +N+ES+  + YK     ++   I+AK+PRS     IY+QQ N KPH + DDPD++  G   G+ I  + QPPNSPD+NVLDLG+F +IQS+Q+    + ++ L+  V++AF  +  D L+ +F+TLQ CME  I AN GNNYK P   K  L   G LPVS  C  E
Sbjct:   17 FLLDRS--DNGEISGGDISAAVAKYERHRSTISRLWELHKKTQTEENRLGNLASGLIGNCGRKAIDTDELRLQIRKIPLSRRMTIKSLAAALGVSTTVIRRLLKE-GAFRRHSSNVKPALTEENRLARVQFALSHTTRKRGGEMVFADMFDVVHIDEKWFNEDTDRKCYYLDADEEEPVRQRQSKRFISKTMFIAAVARPRYDAHRKQAFDGKIGIWAFAEEYEAKRTSKNRPKGTIVLRNVESVDREAYKATHIGDIIPAIKAKWPRSGKKRTIYIQQDNAKPHVSVDDPDIMAAGRSGGWDIRMRCQPPNSPDLNVLDLGYFRSIQSLQYQTECRGVEALLDAVNSAFSAMKADTLNKIFMTLQTCMECIIRANGGNNYKTPHRGKDALKKAGQLPVSFACSAE 419          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000005293.1 (SMESG000005293.1)

HSP 1 Score: 72.0182 bits (175), Expect = 8.350e-13
Identity = 32/72 (44.44%), Postives = 48/72 (66.67%), Query Frame = 1
Query: 1222 FKNQPPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNVFLTLQQCMEETILANA 1437
            ++    NSPD NVLD+G+ N+I SIQ+  SPK ID+LI  V  A+ +   +K++N+FLTLQ+  E ++L   
Sbjct:  556 YQETASNSPDFNVLDIGYLNSIHSIQYQSSPKNIDDLIDVVQRAWGDHAVEKVENIFLTLQKSSESSLLVEG 627          
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Match: SMESG000039871.1 (SMESG000039871.1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.220e-7
Identity = 24/35 (68.57%), Postives = 29/35 (82.86%), Query Frame = 1
Query: 1234 PPNSPDMNVLDLGFFNAIQSIQHHHSPKTIDELIS 1338
            P NSPD +VLDLG+FN+IQSIQ+  SPK ID LI+
Sbjct: 1340 PSNSPDFDVLDLGYFNSIQSIQYQSSPKNIDYLIA 1374          
The following BLAST results are available for this feature:
BLAST of Transposase, Tc1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Q9LLI75.014e-12755.19Uncharacterized protein (Fragment) OS=Hamiltospori... [more]
A0A1R3KDY32.426e-11146.62Transposase, Tc1-like protein OS=Corchorus olitori... [more]
A0A1R3J2B75.851e-11146.37Uncharacterized protein OS=Corchorus olitorius OX=... [more]
A0A081AT541.504e-10244.23HTH_Tnp_Tc3_2 domain-containing protein OS=Phytoph... [more]
W2NW417.069e-10244.09HTH_Tnp_Tc3_2 domain-containing protein OS=Phytoph... [more]
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposase, Tc1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005293.18.350e-1344.44SMESG000005293.1[more]
SMESG000039871.12.220e-768.57SMESG000039871.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013844 ID=SMED30013844|Name=Transposase, Tc1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2104bp
AAATAATATATCTGACGGTGTTGCTAAAGTGCCGCATATCATAAAATAAA
TGTCAAGTTATTAAAATACTCCCTCTGTTCCGAAATAATGTTTGCATTTG
AAATAAATTTTTCCGATTATCAATGTTTTTGGTCAACTTTAAACTTTATT
AATTTATATAGATAGATAATGATCTAGTATGGATGGATTGACAAAAATTT
CCATGATTATAGGGTTTTTTATTGTTAAATTTTAAATACTCCTAAAATAC
AAATAAAAAATGAATACAGAAAATTTACATTCAACTTATCACTTATCTAA
TGAAGAAAGAAGTTTAATTTTTCAAGATTTTTAATGAATAAGTCCAGCTG
AAATCCTCCCAAGCTGAAGCATGGAACCATAAATGACATTTCCGCTAAGT
ACAACGTATTGAGAGCTTCAATTTCGAAACTTTGGAGAAATGCTTCCGAA
CAACTTCGAACAGATGAAATAGTTATTGATTCATCATCAATGAGGATAAA
TTGTGGACGAAAAAGGAAAAACTATGATGATAAATTAAACGGTATGAAGA
AAATTCCGTTAAACTGGCGAGGAATGCTTCGAAGTTTATCATGTGCCAGT
GGTATTCCAAAAACAACATTATTCAGGAATTTGAAGGAGTTTAAACTATT
AAGACGGGTTTCATCTACAGTTAAGCCATTACTAACAGATAGAAATAAAA
TTGAACGCCTGACATTTTGTCTGTCCTATATAAAAACAGATGGATGCTTC
GATAATTTTTTCAATCATGTTCATATTGATGACAAATGGTTTTATCTTTC
GAAAGTTAAGCGCAGCTGTTACTTGACCATGGATGAAGAGATTCCTCATA
GAACATGTCAAAGCAAAAGATTCATAACAAAGGTGATGTTTTTGGCAGCA
GTTGCTAGGCCCCGAGGTGATATTGGCTCTGAGAATTATTTTGATGGCAA
GATTGGCATCTGGCCGTTTGTTTATAAAGAAGAAGCCAAAAGAAATAGCA
AGAACCGAATGAAGGGTACTTACATAACTAAAAATATTGAATCAATTACT
TCGAAGGAATATAAAAAAATGATTAAGCAAAATGTGTTTCTAATGATCAG
AGCAAAGTTTCCTCGATCAAATGATATCATCTACGTTCAGCAACATAATT
TAAAGCCGCATTTTAATGAAGACGATCCAGATATGCTCGAAGAAGGATCA
AAAGATGGGTTTTCTATTATGTTTAAAAATCAACCACCTAATAGTCCCGA
CATGAACGTATTAGATCTTGGATTCTTCAATGCCATTCAATCCATTCAGC
ATCACCATTCTCCGAAGACCATTGATGAATTGATTAGCTGTGTGAGTAAT
GCCTTTGATGAGCTACACCCAGATAAACTGGATAATGTATTTTTAACACT
CCAGCAGTGCATGGAGGAGACGATACTTGCAAATGCGGGAAATAATTATA
AGTTGCCGCGTATTAGCAAAGCAAAGCTCTGCAACAATGGTACGCTACCA
GTATCCATAACTTGTAAACCAGAAGCGATTCTTACAGCTCGCCAAAATAT
TGATGAACATACCCTATAAAATTGAATCCTACCTCCTTGGCACGAATAAA
ATGTTTTATCTAATAAATATTGACATTTTTTACAATAATTATTACGACTG
TTTGTTAATAATGCTATAAAAATTTTTAAATGTAAACATTATATAGGAAC
AGAGGGAGTATTTTTTTTTTTGAATGTTTATTATTTATTATTATTATTAA
CTGATATATTTATATTCACTTTGTTATTTGTTGACATTTCCTAGAGTACT
CATTGATAAGCACACGTCCATTCTTTTCTATTCATTACCTGCTTTGCCTT
AAAGAAAATCCTCTTTCATTTCAGACAAAATTATTTAATTATAAAAATTA
TATTTATAAATACTTTTTTTGGATAAAACAAAAAACTGCTAAAAATGAAT
CTTTTTATCATAACAATTATTCATCAACATTAGAATTACTTGTAAATGTT
TCTGTTATTATTTTTAATATTTAAGCAAATTTAGTAAAATTTTTGTTTAA
CTATGGTTTTTATAAAAAATTCACAGATGCTCTCAAACACCCATTAAAAT
GCCA
back to top

protein sequence of SMED30013844-orf-1

>SMED30013844-orf-1 ID=SMED30013844-orf-1|Name=SMED30013844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MRINCGRKRKNYDDKLNGMKKIPLNWRGMLRSLSCASGIPKTTLFRNLKE
FKLLRRVSSTVKPLLTDRNKIERLTFCLSYIKTDGCFDNFFNHVHIDDKW
FYLSKVKRSCYLTMDEEIPHRTCQSKRFITKVMFLAAVARPRGDIGSENY
FDGKIGIWPFVYKEEAKRNSKNRMKGTYITKNIESITSKEYKKMIKQNVF
LMIRAKFPRSNDIIYVQQHNLKPHFNEDDPDMLEEGSKDGFSIMFKNQPP
NSPDMNVLDLGFFNAIQSIQHHHSPKTIDELISCVSNAFDELHPDKLDNV
FLTLQQCMEETILANAGNNYKLPRISKAKLCNNGTLPVSITCKPEAILTA
RQNIDEHTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006313transposition, DNA-mediated
GO:0015074DNA integration
GO:0032502developmental process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002089reproductive organ