Tektin-2

Overview
NameTektin-2
Smed IDSMED30013840
Length (bp)1578
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin-2 (SMED30013840) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin-2 (SMED30013840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin-2 (SMED30013840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin-2 (SMED30013840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013840SMESG000065255.1 SMESG000050057.1 SmedASXL_012923SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v6_2339_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013840SMESG000039796.1 SMESG000039794.1 SMESG000039792.1 SMESG000065255.1 SMESG000050057.1 OX_Smed_1.0.02541ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30013840SMESG000065255.1 SMESG000050057.1 dd_Smed_v4_2339_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 348.977 bits (894), Expect = 3.634e-115
Identity = 199/398 (50.00%), Postives = 270/398 (67.84%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMN 1377
            MA+++ KP+ ++Q  DWHTNS+ +STN++  + ASH IRQEAR LRNET+ +T WD++DN TRL +RID +  WKE+L++    LD EI+ L   K+  E+ L+A N+P DV  ECLTLR++R  ID V+D  E  L KE E+I   K  LQQK+ +AFEQ+ LL E + Q+  D + K   + ID    +LN  SPNIS K D TRV  GSTT QQW+D+SR+N  RA AE+ ++  LREA   TI   +N+L+AQ+ AT++A RKR+ + EK   EL WQ+KN  +EIA +++D++ +E+ +R K+ + KL+ TRLE R  RPNVELCRD  QYGLTDEV QLEAT AAL +K  QA+ ALD L K L R++ DIA K  S+  D KC   R ++ 
Sbjct:    1 MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLT 398          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 190.274 bits (482), Expect = 2.078e-54
Identity = 134/416 (32.21%), Postives = 224/416 (53.85%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK-CEKARERMNPRPTTLQEDNLLMQGIIR 1431
            MA + +P  K+ P++WH  +      ++  +  S  +  E++ L +E +  T+  Q D   +L  R++ ++ WK+ L++  E+L    ++L   K  LEK LE L  P  +   CL  R+ R  ID V D  EH L+KE E+I      L + ++EA EQ+ +   A+  + KDL+DK +A+ ID   ++LN NSPNI +  ++ R+   S + + W D+S  N ++A+ +  +S  L+  +   +    NDL+ Q +  D A +  + D + A D+L      V +EIA+ EK++  +E +I  +   AK+A TRLE R  RPNVELCRD  QY L  EV+++    A L E   QA+  L GL ++   ++++I +KE ++  D   C + R+ +   P    ED+ +  G +R
Sbjct:    1 MAKLLQPPPKFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSI---PLRDGEDHGVWAGGLR 413          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 147.132 bits (370), Expect = 6.326e-38
Identity = 116/423 (27.42%), Postives = 203/423 (47.99%), Query Frame = 1
Query:  133 SSYI*KFKKFKNYSLCQLMASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRPTTLQ 1398
            + Y  + ++    ++   +++ T    +Y P DW+ ++      S   +  S  +R +   L  +   +T+  Q D T  L +R++ I  WK  +  + +++  E   L + K  LE+ L     P  V  ECL  R+ R  ID V DE E  LL E + I  C+ R++  +D+A  Q+     +++++ KDL DK  A  ID   ++L   S  + +     RV    + P+ W  ++  N  R+ +E  +S +LR+ I + +    N++  Q N  + +   RI +   A +++         EI   E  ++ ++ +I+ K    K+AQTRL+ R  RPN+ELCRD  Q  L +EV +++ T   L ++ R A   L  L      ++ D+A+K  SL  D+ KC   R+     P TL+
Sbjct:   66 APYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSY---PNTLR 485          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 147.132 bits (370), Expect = 6.326e-38
Identity = 116/423 (27.42%), Postives = 203/423 (47.99%), Query Frame = 1
Query:  133 SSYI*KFKKFKNYSLCQLMASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRPTTLQ 1398
            + Y  + ++    ++   +++ T    +Y P DW+ ++      S   +  S  +R +   L  +   +T+  Q D T  L +R++ I  WK  +  + +++  E   L + K  LE+ L     P  V  ECL  R+ R  ID V DE E  LL E + I  C+ R++  +D+A  Q+     +++++ KDL DK  A  ID   ++L   S  + +     RV    + P+ W  ++  N  R+ +E  +S +LR+ I + +    N++  Q N  + +   RI +   A +++         EI   E  ++ ++ +I+ K    K+AQTRL+ R  RPN+ELCRD  Q  L +EV +++ T   L ++ R A   L  L      ++ D+A+K  SL  D+ KC   R+     P TL+
Sbjct:   66 APYCTRSQRVSENTMLPFVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSY---PNTLR 485          
BLAST of Tektin-2 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 130.183 bits (326), Expect = 2.763e-32
Identity = 125/405 (30.86%), Postives = 188/405 (46.42%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRPTTLQ 1398
            +A+ +    KY   +W  N +A    +   +  S   R E++ L  ET    +  Q D+T  + +R+     WK  L+ + E L  E   L   K  LE+ L+A  VP  +  + L  R+ R   + V D  E  LLKE ELI   +  L++ I +A  Q+ L  E +     D  DK  A  ID      +  S  +   P ST   + ++TP+    +++ N  RA  E  +S  LR  +   +     DL+ Q +A + A  +R  + E A  +L+        EI   E ++  ++ +I+ K     +AQTRL  R  RPN+ELCRDA Q+ L  EV++L  +  AL EK  +A  +L  LE     ++ DIA    SL  DR KC   R R    PT LQ
Sbjct:   29 LATASFRTSKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRY---PTILQ 430          
BLAST of Tektin-2 vs. Ensembl Celegans
Match: R02E12.4 (pep chromosome:WBcel235:X:4005314:4007634:1 gene:WBGene00019828.1 transcript:R02E12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02E12.4)

HSP 1 Score: 63.1586 bits (152), Expect = 1.583e-10
Identity = 75/348 (21.55%), Postives = 157/348 (45.11%), Query Frame = 1
Query:  292 DIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSI-DNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFK-PDSTRVVKGSTTP-QQWEDYSRY------NHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAAL---LEKQRQARHALDGLEKQLHR 1299
            +I + AR    E +++    Q   T +L  R+  ++ W   ++ +   + +E ++L      L+  L+     +     CL +R  +  + D+  D  +  L KE+EL++    ++++  +    Q+ +   AR  +L+DL  K  A+ +D     +  +      + PD  R+      P Q+  +YS +      N   A      S+++ + +  +I  + + L+ +  A +  ++  + + ++  D L+ Q    + EI   +  ++ +  S+R K    ++A +R   R  RP +ELC D  Q+ L  E+  L+ T  +L   L+K +++R  LD    +L R
Sbjct:   12 EIVRMARLAVKEANMRAARMQGQTTQQLMQRVKDLKYWSGEIDRELADVKEEHDDLLRCYRRLQLCLDITGRSSRCNESCLAVRRKKVQVGDHTSDRVDMELHKEKELMTDTMKQMKEIGERVERQLEVNQSARKNLLRDLTLKQEAISLDHKSVAIGADGTKTVIRTPDGDRLDFREGAPLQRMSEYSEWIENTGNNLNYAARARVHSRKIGQKLCQSIREMAHQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGAIEEISFSLRQKSGPLQVALSRQNQRGLRPGIELCNDKAQHALHQELMMLKGTFLSLENQLDKAKESRKKLDNDRDKLQR 359          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG3085 (gene:FBgn0034816 transcript:FBtr0310344)

HSP 1 Score: 164.466 bits (415), Expect = 6.015e-45
Identity = 122/396 (30.81%), Postives = 208/396 (52.53%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            + ++ KP       DW+     +   ++  +  +  IR  +R LRNET ++  W  Y+    L DRI  +  W++I+ +  EK+++EI  L   K+  E+ LEAL  P  V+ ECLT+RD R   +   DE +  +  E  ++   +  L  +  +A+E++  L E R ++  +++ K  A+ +D +Q  L+ NS NIS+KPD TR  K S + + W +  +     A  EL  +  +REA+        N L++Q+   ++ IRKRI + ++A +EL WQ+  +++E+     +++  E+++R K    KLA+TRLENR  R  +ELC D     L  EV++L   +  L  K  +++     LE+   RI  D+  K+ SL TD +    R R+
Sbjct:    6 VVTMEKPLQHISLTDWYARVNQMRNVADARRSDAFAIRHSSRSLRNETRIEGDWANYETNEALTDRISELNRWRDIISKSFEKIEREIFMLQEEKNATERELEALAGPISVIAECLTIRDGRLGSEITYDEADTEIKNELVVLENNQRLLADRCQKAWEKLNRLEEVRFKIGLEIEFKVEAVQLDNSQLALDRNSANISYKPDPTRNPKNSCSYESWLENVKNIKLLAENELADTYAIREALFVCREKARNMLQSQQERAEHTIRKRIFETQRARNELEWQQLKMKEEMEKAMCEIRTSENALRDKTDALKLAETRLENRAQRSGMELCMDQAHDMLCLEVEKLREIRRRLQVKIDESKTNFSLLEEHGKRIDVDLENKQHSLMTDIRALDLRMRL 401          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG3085 (gene:FBgn0034816 transcript:FBtr0071963)

HSP 1 Score: 164.466 bits (415), Expect = 6.015e-45
Identity = 122/396 (30.81%), Postives = 208/396 (52.53%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            + ++ KP       DW+     +   ++  +  +  IR  +R LRNET ++  W  Y+    L DRI  +  W++I+ +  EK+++EI  L   K+  E+ LEAL  P  V+ ECLT+RD R   +   DE +  +  E  ++   +  L  +  +A+E++  L E R ++  +++ K  A+ +D +Q  L+ NS NIS+KPD TR  K S + + W +  +     A  EL  +  +REA+        N L++Q+   ++ IRKRI + ++A +EL WQ+  +++E+     +++  E+++R K    KLA+TRLENR  R  +ELC D     L  EV++L   +  L  K  +++     LE+   RI  D+  K+ SL TD +    R R+
Sbjct:    6 VVTMEKPLQHISLTDWYARVNQMRNVADARRSDAFAIRHSSRSLRNETRIEGDWANYETNEALTDRISELNRWRDIISKSFEKIEREIFMLQEEKNATERELEALAGPISVIAECLTIRDGRLGSEITYDEADTEIKNELVVLENNQRLLADRCQKAWEKLNRLEEVRFKIGLEIEFKVEAVQLDNSQLALDRNSANISYKPDPTRNPKNSCSYESWLENVKNIKLLAENELADTYAIREALFVCREKARNMLQSQQERAEHTIRKRIFETQRARNELEWQQLKMKEEMEKAMCEIRTSENALRDKTDALKLAETRLENRAQRSGMELCMDQAHDMLCLEVEKLREIRRRLQVKIDESKTNFSLLEEHGKRIDVDLENKQHSLMTDIRALDLRMRL 401          
BLAST of Tektin-2 vs. Ensembl Fly
Match: Tektin-A (gene:FBgn0028902 transcript:FBtr0080788)

HSP 1 Score: 112.079 bits (279), Expect = 7.641e-26
Identity = 108/398 (27.14%), Postives = 180/398 (45.23%), Query Frame = 1
Query:  187 MASVT--KPAM------KYQPADWHT-NSFAISTNSERMQQASHD-IRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK 1350
            MA +T  +P +      +Y P +W T N   +   +  + +A  +       FLR    V     Q + T +L  R   I  WK  LE   + +  EI  +   + +L K +  L VP  +  EC+  R  R   + V D+ E  L+ E  LI++ +  L + +D+   Q      AR ++  D  DK  +  ID     LN  S  I F+P + R      + + WE +S             S  LR  ++ T+ +   D++ Q +  + A+  RI+  ++A+       KN+    A +E  ++ ++  I +   + K+AQTR++NR  RPNVE CRD  Q  L D V  ++++ +ALL +  +A      L     R++ +I LK  SL  DR+
Sbjct:  169 MAGITGTRPVVDRYSITRYSPNEWRTRNHETVQVVNASLGRADKNRFSSTTEFLRLSALVDK--SQKETTDKLRIRSQLIGKWKNTLENAIKAMADEISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIAEIRRLLMKTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKYWEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFENDLKNILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDRE 564          
BLAST of Tektin-2 vs. Ensembl Fly
Match: Tektin-A (gene:FBgn0028902 transcript:FBtr0331277)

HSP 1 Score: 112.079 bits (279), Expect = 7.641e-26
Identity = 108/398 (27.14%), Postives = 180/398 (45.23%), Query Frame = 1
Query:  187 MASVT--KPAM------KYQPADWHT-NSFAISTNSERMQQASHD-IRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK 1350
            MA +T  +P +      +Y P +W T N   +   +  + +A  +       FLR    V     Q + T +L  R   I  WK  LE   + +  EI  +   + +L K +  L VP  +  EC+  R  R   + V D+ E  L+ E  LI++ +  L + +D+   Q      AR ++  D  DK  +  ID     LN  S  I F+P + R      + + WE +S             S  LR  ++ T+ +   D++ Q +  + A+  RI+  ++A+       KN+    A +E  ++ ++  I +   + K+AQTR++NR  RPNVE CRD  Q  L D V  ++++ +ALL +  +A      L     R++ +I LK  SL  DR+
Sbjct:  169 MAGITGTRPVVDRYSITRYSPNEWRTRNHETVQVVNASLGRADKNRFSSTTEFLRLSALVDK--SQKETTDKLRIRSQLIGKWKNTLENAIKAMADEISTMEVERIKLRKSMVVLGVPESIAKECIEKRATRPDTELVRDQVEEELVNELALIAEIRRLLMKTLDDFNSQQVENRTARQRLEYDWSDKKESYEIDTINTGLNNCSRTIMFRPGAVRQPPEQASEKYWEHFSMETLDECEKCRLKSVALRNTLNSTLMNAARDIRTQADVVEKALTSRINCTQEAVQRFENDLKNILQGTADVENRIEQMKRRINSFDSSMKVAQTRMDNRSYRPNVENCRDLAQQELIDGVHTIQSSVSALLHELEEAERVKTDLVNSRARLEREIMLKRRSLFIDRE 564          
BLAST of Tektin-2 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070050)

HSP 1 Score: 107.071 bits (266), Expect = 3.509e-24
Identity = 107/385 (27.79%), Postives = 178/385 (46.23%), Query Frame = 1
Query:  214 KYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKAR 1365
            +Y   +W+ N+    + S   +  S  +R +A  L  ETD K    Q D   RL +RI  +  W+  L  + EKL  E+ ++N  + +  K L  L +P  +  ECL  R++R   + V D  E  LL E   +   + RL    ++  +Q      A++ +  D+  K  ++GID   + LN +S  I++     +     +T + W   S  + +R+ AE     +LR      ++SV   +    + T+ A  +R  +  +A + +    + V+ E+  MEK L  ++ +I+ K    K+AQTRLE R  R  VELC+D  Q  L  EV+ ++     L  K  +A     GL K    ++ D+  K  +L  DR KC   R
Sbjct:  206 RYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLR 590          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt2 (tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-040113-1])

HSP 1 Score: 307.76 bits (787), Expect = 1.574e-99
Identity = 177/403 (43.92%), Postives = 262/403 (65.01%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTT 1392
            MA+++ KPA +Y  +DW TN+  +S  +E  +  SH+IRQE R LRNET  KT W++YD+T +L DRI+ I  WKE L+   +++D+E++ L  +K+E+E+ L A  +P +V  ECL LR+ R   + V D  E  L KE E+I   +  LQQ ID+AFEQ+  L EAR Q+  DLQDK  A+ +D++  +L   SP IS KP+ TRV  GST PQQWE +SRYN  RA  E+  S ++RE    T   V N+L+AQ+ + ++A+RKR H  E+A  ++ WQ K  +DEIA +EKD+ G+E+ ++AK    KL  TRLENR  RP ++LCRD  Q+GL DE K LEAT  AL +K  QA+H+L  L++   ++ ++++ K+ +L+ +++  + R+R+    TT
Sbjct:    1 MATLSSKPASRYSVSDWATNNKQMSDTAEHKRNVSHEIRQEGRALRNETTNKTSWNEYDSTRKLRDRINDITRWKENLKACAQEVDEEMDALTLSKEEMERALAATVLPLEVTAECLNLREGRRGKELVSDPVEAELKKEVEVIDGAQRVLQQCIDQAFEQLCRLQEARQQLTIDLQDKIEALDVDMSCLSLTIQSPEISLKPNPTRVPPGSTNPQQWEQFSRYNISRAREEMQVSVQIRENNSITRAQVQNELEAQRMSVEFALRKRTHHEEQAHHDMQWQLKTTQDEIAELEKDIIGLEEDLQAKTAPLKLVHTRLENRIKRPGMDLCRDEVQFGLVDEAKHLEATILALKQKLAQAQHSLQSLKQHEAQMMEELSRKQDALSLEQRSNQTRQRLTLGGTT 403          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt2 (tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-040113-1])

HSP 1 Score: 307.76 bits (787), Expect = 1.574e-99
Identity = 177/403 (43.92%), Postives = 262/403 (65.01%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTT 1392
            MA+++ KPA +Y  +DW TN+  +S  +E  +  SH+IRQE R LRNET  KT W++YD+T +L DRI+ I  WKE L+   +++D+E++ L  +K+E+E+ L A  +P +V  ECL LR+ R   + V D  E  L KE E+I   +  LQQ ID+AFEQ+  L EAR Q+  DLQDK  A+ +D++  +L   SP IS KP+ TRV  GST PQQWE +SRYN  RA  E+  S ++RE    T   V N+L+AQ+ + ++A+RKR H  E+A  ++ WQ K  +DEIA +EKD+ G+E+ ++AK    KL  TRLENR  RP ++LCRD  Q+GL DE K LEAT  AL +K  QA+H+L  L++   ++ ++++ K+ +L+ +++  + R+R+    TT
Sbjct:    1 MATLSSKPASRYSVSDWATNNKQMSDTAEHKRNVSHEIRQEGRALRNETTNKTSWNEYDSTRKLRDRINDITRWKENLKACAQEVDEEMDALTLSKEEMERALAATVLPLEVTAECLNLREGRRGKELVSDPVEAELKKEVEVIDGAQRVLQQCIDQAFEQLCRLQEARQQLTIDLQDKIEALDVDMSCLSLTIQSPEISLKPNPTRVPPGSTNPQQWEQFSRYNISRAREEMQVSVQIRENNSITRAQVQNELEAQRMSVEFALRKRTHHEEQAHHDMQWQLKTTQDEIAELEKDIIGLEEDLQAKTAPLKLVHTRLENRIKRPGMDLCRDEVQFGLVDEAKHLEATILALKQKLAQAQHSLQSLKQHEAQMMEELSRKQDALSLEQRSNQTRQRLTLGGTT 403          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 146.362 bits (368), Expect = 5.995e-38
Identity = 112/397 (28.21%), Postives = 200/397 (50.38%), Query Frame = 1
Query:  199 TKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            T  + +Y P DW+ ++ +    SE  + ++  +R++   L  + +  T+  Q   +  + +R++ I  W+  +  + + +  EI  L++ K  LE+ L     P  V  ECL  R+ R SID V D+ E  L+KE ++I  C+ R+++ ++ A  Q+     A++++ +DL DK  A  ID   ++L   S  IS+     R+    + P  W  ++  N   + +E  +S +LR+ I   +++  N++  Q N+ + +   RI +     + L         EI   E  ++ ++ +IR K    K+AQTRLE R  RPNVELCRD P + L  EV+++E T   L ++  +A + L  L K    ++ D+++K  SL  D+ KC   R+     P
Sbjct:   71 TALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTP 467          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 145.591 bits (366), Expect = 1.157e-37
Identity = 112/397 (28.21%), Postives = 200/397 (50.38%), Query Frame = 1
Query:  199 TKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            T  + +Y P DW+ ++ +    SE  + ++  +R++   L  + +  T+  Q   +  + +R++ I  W+  +  + + +  EI  L++ K  LE+ L     P  V  ECL  R+ R SID V D+ E  L+KE ++I  C+ R+++ ++ A  Q+     A++++ +DL DK  A  ID   ++L   S  IS+     R+    + P  W  ++  N   + +E  +S +LR+ I   +++  N++  Q N+ + +   RI +     + L         EI   E  ++ ++ +IR K    K+AQTRLE R  RPNVELCRD P + L  EV+++E T   L ++  +A + L  L K    ++ D+++K  SL  D+ KC   R+     P
Sbjct:   86 TALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTP 482          
BLAST of Tektin-2 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 145.591 bits (366), Expect = 1.157e-37
Identity = 112/397 (28.21%), Postives = 200/397 (50.38%), Query Frame = 1
Query:  199 TKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            T  + +Y P DW+ ++ +    SE  + ++  +R++   L  + +  T+  Q   +  + +R++ I  W+  +  + + +  EI  L++ K  LE+ L     P  V  ECL  R+ R SID V D+ E  L+KE ++I  C+ R+++ ++ A  Q+     A++++ +DL DK  A  ID   ++L   S  IS+     R+    + P  W  ++  N   + +E  +S +LR+ I   +++  N++  Q N+ + +   RI +     + L         EI   E  ++ ++ +IR K    K+AQTRLE R  RPNVELCRD P + L  EV+++E T   L ++  +A + L  L K    ++ D+++K  SL  D+ KC   R+     P
Sbjct:   86 TALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSFPSTP 482          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:NCBI gene;Acc:493269])

HSP 1 Score: 346.665 bits (888), Expect = 1.863e-114
Identity = 197/401 (49.13%), Postives = 270/401 (67.33%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRP 1386
            MA+++ KP  ++   DW TN+  ISTN+ER + +SH IRQEAR LRNET  +TKWD+ DN+TR  ++      W+++L++   ++D EI  L   KDE E+ L+A N+P DV  EC T R++R  ID V+D  E  L KE E+I   +  LQQKI EAFEQ+ LL EAR+Q+  D + K   + ID    +L +NSPNIS K D  RV+ G+TTPQ+WE +SRY+ +RA AE+ +S RLRE+I  TI   +N+ +AQ+ A ++A RKRIH+ E+AL ELNWQ+KN ++EI  ME D++ +++ +R K  + KLA TRLE R  RPNVELCRD  QYGLTDEV+Q+E T AAL EK  Q+++ALD L K L RI++D   K+ SL  D KC   R ++   P
Sbjct:    1 MATLSLKPGSRFSVTDWQTNAALISTNAERQRISSHQIRQEARALRNETSNQTKWDEQDNSTREVEK------WRQVLDKCLSEVDAEINALTQIKDEAEQALQAKNIPLDVAIECFTHRESRREIDLVKDPVEDELHKEVEVIEGVRRALQQKISEAFEQLCLLQEARHQLNFDQRSKTDTVEIDQTCLSLTKNSPNISLKVDPARVLNGTTTPQEWEQFSRYSKERAEAEVRTSGRLRESIALTIAQTNNECEAQRVAVEFAFRKRIHEFERALAELNWQEKNTKEEIEEMEGDIRHLDEDLREKKGSLKLAHTRLETRLHRPNVELCRDQVQYGLTDEVRQIEGTIAALKEKLSQSQNALDALYKHLARIEEDTKWKQNSLILDNKCLDTRRKLTLPP 395          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 174.866 bits (442), Expect = 9.389e-49
Identity = 124/398 (31.16%), Postives = 209/398 (52.51%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK-CEKARERMN 1377
            MA + +   K+ P +W+  +      +E  +  S  +  E++ L +E +  T+  Q D   +L  R++ I+ WK+ L+   E    +I  L   K  LEK LE+   P  +  +CL  R+ R  ID V DE E  L+KE E+I      L++ I++  EQ+ +   A+  + KDL+DK  A+ ID +   L  NSP+I +  ++ R+   S TP +WE+Y+  N  +A  +  ++  LR  I   +    +D+  Q +   YA++ RI + + A ++L      V DEI++ EK+++ ++ ++  K    K+AQTRL+ R  RPNVELCRD  QY L +EV+++      L E   QA   L  L +    ++++I +KE S+  D   C + RE ++
Sbjct:    1 MAKLVQLPPKFLPKEWNIANKTCYARAESQRSRSERLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSVTPIEWENYTNTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDEVICMQMREAIS 398          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 153.68 bits (387), Expect = 1.683e-40
Identity = 127/402 (31.59%), Postives = 191/402 (47.51%), Query Frame = 1
Query:  169 YSLCQLMASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARER 1371
            YS   L  +  + A KY   +W   + A    +   +  S   R EA+ L  ET+ + +  Q D T  L +R+  I  WK  L  +   ++ E + L   K  LE+ L+A ++P  +  + L  RD R   + V DE E  LLKE +LI   +  L++ +D+  +Q+    +A+  +  D  DK  A   D      N  S +I F  +S++    ++TP+ W  Y+  N  +A  E  +S  LR  I   +  +  DL+AQ  A      KR  + E A  +L    K   +EI   EK++  ++ +I  K P  K+AQTRL +R  RPNVELCRD  Q  L  EV +L  +  AL  K   +  +L  LE     ++ DIA K  S+  DR KC   R R
Sbjct:   49 YSSSGLATAGFRTA-KYLHEEWQQGNLATFYRAFSDRDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTLRTR 449          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 153.68 bits (387), Expect = 2.694e-40
Identity = 117/392 (29.85%), Postives = 196/392 (50.00%), Query Frame = 1
Query:  214 KYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            +Y P DW+ ++     +SE  ++++  +R +   L  E D KT+  Q D    L +R++ I  WK  +  + +++  E   L+  K  +E+ L     P  V  ECL  R+ R SID V D+ E  L++E + I  C+ ++++ + +   Q+     A++++ +D+ DK  A+ ID    NL  +S  I +     R+    + P+ W  YS  N  R+ ++  +S +LRE     + S  ND+  Q NA +     RI +   A ++L         EI   E  ++ ++ +I+ K    K+AQTRL+ R  RPNVELCRD+ Q  L  EV+ ++ T  AL  + R+A  AL  L      ++ D+A+K  SL  D+ KC   R+     P
Sbjct:   93 RYTPDDWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSFPSTP 484          
BLAST of Tektin-2 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 92.4337 bits (228), Expect = 4.323e-20
Identity = 89/327 (27.22%), Postives = 153/327 (46.79%), Query Frame = 1
Query:  304 EARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLL----TEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHAL 1272
            E++ L +E++  T+  Q D   +L  R++ I+ WKE+  + ++ ++   + L   K  LEK LE    P  +  +CL  ++ R  ID V DE E  L+K  ++I                 MTLL    T ++  + KDL+DK  A+ ID +   L  NSP+I +  ++ R+   S TP +WED++  N  +A     ++  LR  I   +    +D+ A KN  +  + K I                   EI++ EK+++ ++ ++  K    K+ Q RL+ R  RPNVEL ++     L  +++ +        E  R  RH +
Sbjct:   22 ESQRLVDESEKTTQKSQKDFNKKLDQRLEEIQFWKELDSKLEDTVNDIAQLLA-CKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGV--------------MTLLEYNRTNSKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDIYA-KNKLEEHLAKVIS------------------EISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVELFQEITTNALISDLEVVLGN----WESTRPKRHVI 310          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt2 (tektin 2 [Source:MGI Symbol;Acc:MGI:1346335])

HSP 1 Score: 321.242 bits (822), Expect = 1.161e-104
Identity = 193/397 (48.61%), Postives = 264/397 (66.50%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ +Y+ +DW TNS+ +STN+ER + ASH IRQEAR LRNET+ +  WD++DN TRLA+RID +  WKE L++    LD EI++L  AK+  E+ L+A N+P DV  ECLTLR++R  ID V D  E  LLKE E+I   K  LQ+KI +AF+ + LL E R Q+  D +DK   + ID    +LN  SPNIS K + TR+ K STT QQW++++R+N  RA AE+ +S  LREAI   I   +N+L AQ+ AT++  RKR+ + E    EL WQ+KN  +EIA ++ D++ +E+ +R K+   KLA TRLE+R  R NVELCRD  QYGL DEV QLEAT   + +K  Q ++ALD L K L RI+ DIA K  +L  D KC   R ++
Sbjct:    1 MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKL 397          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt2 (tektin 2 [Source:MGI Symbol;Acc:MGI:1346335])

HSP 1 Score: 321.242 bits (822), Expect = 1.161e-104
Identity = 193/397 (48.61%), Postives = 264/397 (66.50%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ +Y+ +DW TNS+ +STN+ER + ASH IRQEAR LRNET+ +  WD++DN TRLA+RID +  WKE L++    LD EI++L  AK+  E+ L+A N+P DV  ECLTLR++R  ID V D  E  LLKE E+I   K  LQ+KI +AF+ + LL E R Q+  D +DK   + ID    +LN  SPNIS K + TR+ K STT QQW++++R+N  RA AE+ +S  LREAI   I   +N+L AQ+ AT++  RKR+ + E    EL WQ+KN  +EIA ++ D++ +E+ +R K+   KLA TRLE+R  R NVELCRD  QYGL DEV QLEAT   + +K  Q ++ALD L K L RI+ DIA K  +L  D KC   R ++
Sbjct:    1 MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKL 397          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 173.326 bits (438), Expect = 3.784e-48
Identity = 124/400 (31.00%), Postives = 214/400 (53.50%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK-CEKARERMNPR 1383
            MA + +   ++ P +W+  + +    +E  +  S  +  E++ L  E +  T+  Q D   +L  R++ +R WK+ L++  E+L  + ++L   K  LE+ LE+   P  +  +CL  R+ R  ID V D  E  L KE ++I      L + ++E+ EQ+ L   A+  + KDL+DK  A+ ID   ++LN NSPNI+F     R+   S + + W D+S  N ++A+ +L +S  L+  +   +    NDL+ Q    D A    + + + A ++L      V +EIA+ EK++  +E++I  +   AK+A TRLE R  RPNVELCRD  QY L  E++++    A L E   QA+  L  L ++   ++++I +KE ++  D+  C + R+ + PR
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPR 400          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 173.326 bits (438), Expect = 3.784e-48
Identity = 124/400 (31.00%), Postives = 214/400 (53.50%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK-CEKARERMNPR 1383
            MA + +   ++ P +W+  + +    +E  +  S  +  E++ L  E +  T+  Q D   +L  R++ +R WK+ L++  E+L  + ++L   K  LE+ LE+   P  +  +CL  R+ R  ID V D  E  L KE ++I      L + ++E+ EQ+ L   A+  + KDL+DK  A+ ID   ++LN NSPNI+F     R+   S + + W D+S  N ++A+ +L +S  L+  +   +    NDL+ Q    D A    + + + A ++L      V +EIA+ EK++  +E++I  +   AK+A TRLE R  RPNVELCRD  QY L  E++++    A L E   QA+  L  L ++   ++++I +KE ++  D+  C + R+ + PR
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPR 400          
BLAST of Tektin-2 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 173.326 bits (438), Expect = 3.784e-48
Identity = 124/400 (31.00%), Postives = 214/400 (53.50%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRK-CEKARERMNPR 1383
            MA + +   ++ P +W+  + +    +E  +  S  +  E++ L  E +  T+  Q D   +L  R++ +R WK+ L++  E+L  + ++L   K  LE+ LE+   P  +  +CL  R+ R  ID V D  E  L KE ++I      L + ++E+ EQ+ L   A+  + KDL+DK  A+ ID   ++LN NSPNI+F     R+   S + + W D+S  N ++A+ +L +S  L+  +   +    NDL+ Q    D A    + + + A ++L      V +EIA+ EK++  +E++I  +   AK+A TRLE R  RPNVELCRD  QY L  E++++    A L E   QA+  L  L ++   ++++I +KE ++  D+  C + R+ + PR
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSIPPR 400          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q9UIF3|TEKT2_HUMAN (Tektin-2 OS=Homo sapiens OX=9606 GN=TEKT2 PE=1 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.745e-114
Identity = 199/398 (50.00%), Postives = 270/398 (67.84%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMN 1377
            MA+++ KP+ ++Q  DWHTNS+ +STN++  + ASH IRQEAR LRNET+ +T WD++DN TRL +RID +  WKE+L++    LD EI+ L   K+  E+ L+A N+P DV  ECLTLR++R  ID V+D  E  L KE E+I   K  LQQK+ +AFEQ+ LL E + Q+  D + K   + ID    +LN  SPNIS K D TRV  GSTT QQW+D+SR+N  RA AE+ ++  LREA   TI   +N+L+AQ+ AT++A RKR+ + EK   EL WQ+KN  +EIA +++D++ +E+ +R K+ + KL+ TRLE R  RPNVELCRD  QYGLTDEV QLEAT AAL +K  QA+ ALD L K L R++ DIA K  S+  D KC   R ++ 
Sbjct:    1 MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLT 398          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q4R5V1|TEKT2_MACFA (Tektin-2 OS=Macaca fascicularis OX=9541 GN=TEKT2 PE=2 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 5.983e-114
Identity = 198/397 (49.87%), Postives = 267/397 (67.25%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ ++Q  DWHTNS+ +STN++  + ASH IRQEAR LRNET+ +T WD++DN TRL +RID +  WKE+L++    LD EI+ L   KD   + L+A N+P DV  ECLTLR++R  ID V+D  E  L KE E+I   K  LQQK+ +AFE + LL E R Q+  D + K   + ID    +LN  SPNIS K D TRV  GSTT QQW+D+S++N  R  AE+ ++  LREAI  TI   +N+L+AQ+ AT++A RKR+ + EK   EL WQ+KN  +EIA +++D++ +E+ +R K  + KL+ TRLE R  RPNVELCRD  QYGLTDEV QLEAT AAL +K  QA+ ALD L K L R++ DIA K  S+  D KC   R ++
Sbjct:    1 MATLSVKPSQRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKDSAGQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEHLCLLQEVRQQLNSDHRGKMETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSQFNKDRGEAEMKAATELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHLEEDLRTKFLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKL 397          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q2T9Q6|TEKT2_BOVIN (Tektin-2 OS=Bos taurus OX=9913 GN=TEKT2 PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 6.421e-111
Identity = 198/397 (49.87%), Postives = 266/397 (67.00%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ +++  DW TNS+ +STN+ER + ASH IRQEAR LRNET+ +T WD++DN TRLA+RID +  WKE+L++    LD EI+ L   K+  E+ L+A N+P DV  ECLTLR++R  ID V+D  E  L KE E+I   K  LQQKI +AFE++ LL EAR ++  D + K   + ID    +LN  SPNIS K + TRV  GST+ QQW+D SR+N     AE+  +  LREAI  TI   +N+L+AQ+ AT++A RKR+ + EK   EL WQ+KN  +EIA + +D++ +E+ +R K+   KL  TRLE R  RPNVELCRD  QYGLTDEV QLEAT AAL +K  QA+ ALD L K L R++ DIA K  S+  D KC   R ++
Sbjct:    1 MATLSVKPSPRFRLPDWQTNSYLLSTNAERQRDASHQIRQEARVLRNETNNQTIWDEHDNRTRLAERIDTVSRWKEMLDKCLTDLDAEIDALAQMKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELHKEVEVIEATKKALQQKISQAFEKLFLLQEARQRLNSDHRGKMETLDIDRGCLSLNLTSPNISLKINPTRVPNGSTSLQQWDDLSRFNKDHGEAEMKKAIELREAIALTIAETNNELEAQRVATEFAFRKRLREMEKLYSELKWQEKNTLEEIAELHEDIRHLEEDLRRKLQNLKLCHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQDALDALYKHLARLQADIACKANSMLLDTKCMDTRRKL 397          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q6AYM2|TEKT2_RAT (Tektin-2 OS=Rattus norvegicus OX=10116 GN=Tekt2 PE=2 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.884e-109
Identity = 190/397 (47.86%), Postives = 269/397 (67.76%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ +Y+ +DW TNS+ +STN+ER + ASH IRQEAR LRNET+ +T WD++DN TRLA+RID +  WKE+L++    LD EI++L  AK+ +E+ L+A N+P DV  ECLTLR++R  ID V+D  E  L+KE E+I   K  LQ+KI +AF+ + LL E R Q+  D +DK   + ID    +LN  +PN+S K + TRV K STT Q+W+D++R+N  RA+ E+ +S  LRE I   I   +N+L+AQ+ AT++  RKR+ + E    EL WQ+KN  +EIA ++ D++ +E+ +R K+   KLA TRLE+R  RPNVELCRD  QYGL DEV QLEAT + + +K  Q + ALD L K L RI+ DIA K  ++  D KC   R ++
Sbjct:    1 MATLSLKPSQRYRLSDWLTNSYLLSTNAERQRDASHQIRQEARILRNETNNQTVWDEHDNRTRLAERIDTVNRWKEMLDKCLTDLDAEIDSLTQAKESVEQSLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEEELMKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTAPNLSLKVNPTRVPKDSTTLQEWDDFTRFNKNRADTEMKASIELRETIALAIAQTNNELEAQRVATEFTFRKRLREMESLYSELKWQEKNTLEEIAELQADIRRLEEDLRRKMMNLKLAHTRLESRTYRPNVELCRDQTQYGLIDEVHQLEATISIMKQKLAQTQDALDALFKHLARIQADIACKTNTMLLDTKCMDIRRKL 397          
BLAST of Tektin-2 vs. UniProt/SwissProt
Match: sp|Q922G7|TEKT2_MOUSE (Tektin-2 OS=Mus musculus OX=10090 GN=Tekt2 PE=1 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.119e-104
Identity = 193/397 (48.61%), Postives = 264/397 (66.50%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERM 1374
            MA+++ KP+ +Y+ +DW TNS+ +STN+ER + ASH IRQEAR LRNET+ +  WD++DN TRLA+RID +  WKE L++    LD EI++L  AK+  E+ L+A N+P DV  ECLTLR++R  ID V D  E  LLKE E+I   K  LQ+KI +AF+ + LL E R Q+  D +DK   + ID    +LN  SPNIS K + TR+ K STT QQW++++R+N  RA AE+ +S  LREAI   I   +N+L AQ+ AT++  RKR+ + E    EL WQ+KN  +EIA ++ D++ +E+ +R K+   KLA TRLE+R  R NVELCRD  QYGL DEV QLEAT   + +K  Q ++ALD L K L RI+ DIA K  +L  D KC   R ++
Sbjct:    1 MATLSFKPSERYRLSDWRTNSYLLSTNAERQRDASHQIRQEARILRNETNNQIVWDEHDNRTRLAERIDTVNRWKETLDKCLTDLDAEIDSLAQAKESAEQNLQAKNLPLDVAIECLTLRESRRDIDVVRDPVEEELLKEVEVIEATKKVLQEKISQAFQHLCLLQEIRQQLNSDHRDKMETLEIDRGCLSLNLTSPNISLKVNPTRIPKDSTTLQQWDEFTRFNKNRAEAEMKASIELREAIALAIAQTNNELDAQRVATEFTFRKRLREMESFYSELKWQEKNTLEEIAELQGDIRRLEEDLRRKMMNLKLAHTRLESRTYRSNVELCRDQTQYGLIDEVHQLEATINTMKQKLAQTQNALDALFKHLARIQADIACKTNTLLLDTKCMDTRRKL 397          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267F8D0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027076g1 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 8.033e-180
Identity = 266/421 (63.18%), Postives = 330/421 (78.38%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRETNKML 1449
            MA+ TKP  KYQP DW TN++AIS+N+ER ++AS  +RQEARFLRNETD KTKWDQ DN TRLADR+D IR WKEILE+    LD EI  L+ +K++ E+ LE  N+PTD VNECLT+RD R SIDNVEDE EH L KEQE+I+K K  LQQK+DE FEQ+ +L EAR Q+L DLQ+KNIA+GIDI+QYNLNE SPNIS+KP+ TRV KGSTTPQQWED+SRYN  RA AE+ SS RLREA H TIH  DNDL++Q+ A+DYA+RKR+H+ E+A DEL WQK+  EDEIA +E+D++ +E++I+AKIP AKLA+TRLENR  RP VELCRDA QYGLTDEV+Q++A+K AL +K +QARH LDGL+KQL RI  D+A K  S+  DR+    R R+  +P T  + N+L  GI RE +K+L
Sbjct:    7 MATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEIAKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEHQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEEEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 427          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A1I8H088 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g2 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 8.258e-180
Identity = 266/421 (63.18%), Postives = 330/421 (78.38%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRETNKML 1449
            MA+ TKP  KYQP DW TN++AIS+N+ER ++AS  +RQEARFLRNETD KTKWDQ DN TRLADR+D IR WKEILE+    LD EI  L+ +K++ E+ LE  N+PTD VNECLT+RD R SIDNVEDE EH L KEQE+I+K K  LQQK+DE FEQ+ +L EAR Q+L DLQ+KNIA+GIDI+QYNLNE SPNIS+KP+ TRV KGSTTPQQWED+SRYN  RA AE+ SS RLREA H TIH  DNDL++Q+ A+DYA+RKR+H+ E+A DEL WQK+  EDEIA +E+D++ +E++I+AKIP AKLA+TRLENR  RP VELCRDA QYGLTDEV+Q++A+K AL +K +QARH LDGL+KQL RI  D+A K  S+  DR+    R R+  +P T  + N+L  GI RE +K+L
Sbjct:    1 MATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEHQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEEEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 421          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267D9M0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g1 PE=4 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 8.666e-179
Identity = 265/421 (62.95%), Postives = 329/421 (78.15%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRETNKML 1449
            MA+ TKP  KYQP DW TN++AIS+N+ER ++AS  +RQEARFLRNETD KTKWDQ DN TRLADR+D IR WKEILE+    LD EI  L+ +K++ E+ LE  N+PTD VNECLT+RD R SIDNVEDE E  L KEQE+I+K K  LQQK+DE FEQ+ +L EAR Q+L DLQ+KNIA+GIDI+QYNLNE SPNIS+KP+ TRV KGSTTPQQWED+SRYN  RA AE+ SS RLREA H TIH  DNDL++Q+ A+DYA+RKR+H+ E+A DEL WQK+  EDEIA +E+D++ +E++I+AKIP AKLA+TRLENR  RP VELCRDA QYGLTDEV+Q++A+K AL +K +QARH LDGL+KQL RI  D+A K  S+  DR+    R R+  +P T  + N+L  GI RE +K+L
Sbjct:    7 MATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEQQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEQEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 427          
BLAST of Tektin-2 vs. TrEMBL
Match: A0A267DEM6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030066g3 PE=4 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 8.835e-179
Identity = 265/421 (62.95%), Postives = 329/421 (78.15%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRETNKML 1449
            MA+ TKP  KYQP DW TN++AIS+N+ER ++AS  +RQEARFLRNETD KTKWDQ DN TRLADR+D IR WKEILE+    LD EI  L+ +K++ E+ LE  N+PTD VNECLT+RD R SIDNVEDE E  L KEQE+I+K K  LQQK+DE FEQ+ +L EAR Q+L DLQ+KNIA+GIDI+QYNLNE SPNIS+KP+ TRV KGSTTPQQWED+SRYN  RA AE+ SS RLREA H TIH  DNDL++Q+ A+DYA+RKR+H+ E+A DEL WQK+  EDEIA +E+D++ +E++I+AKIP AKLA+TRLENR  RP VELCRDA QYGLTDEV+Q++A+K AL +K +QARH LDGL+KQL RI  D+A K  S+  DR+    R R+  +P T  + N+L  GI RE +K+L
Sbjct:    6 MATETKPNAKYQPVDWFTNAYAISSNAERQREASDQVRQEARFLRNETDNKTKWDQKDNNTRLADRVDVIRKWKEILEQTLGDLDAEISKLSESKEQTEEALERKNLPTDTVNECLTVRDGRRSIDNVEDEIEQQLRKEQEVIAKAKRNLQQKVDEQFEQLCVLQEARQQILADLQNKNIALGIDIDQYNLNEQSPNISYKPNPTRVPKGSTTPQQWEDFSRYNVDRAKAEIASSGRLREAAHRTIHDTDNDLESQRQASDYALRKRLHEQEQAKDELEWQKQQTEDEIAELERDIRALEEAIKAKIPPAKLAETRLENRTTRPGVELCRDAVQYGLTDEVQQIKASKDALYDKLKQARHNLDGLQKQLDRINADLAEKTNSIMLDRRTADVRNRLATKPITQTDGNMLKTGITRERSKVL 426          
BLAST of Tektin-2 vs. TrEMBL
Match: V3ZV47 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_193495 PE=4 SV=1)

HSP 1 Score: 501.13 bits (1289), Expect = 7.848e-172
Identity = 261/421 (62.00%), Postives = 324/421 (76.96%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRETNKML 1449
            MA+  +P  ++QP DW TN++ ISTN+ER + ASH +RQE RFL NETD +TKWDQ+ N  RLADR+D IR WKEILE+    LD+EI +L+++K+  E+ LEA N+P DV  ECLTLR+ R  ID V+DE E+ L KE E+I   +  LQQ++ ++FEQ+ LL EAR Q+  DLQDKNIA+GIDI+QYNL + SPNIS+KPDS RV KGSTTPQQWED+SRYN +RA+AE+ +S RLREAIHHT+   DNDL+AQK AT++A+RKRIH+ E+A DEL WQKKN EDEIA +E D++ + ++IRAK    KLAQTRLENR  RPNVELCRDAPQYGLTDEVKQLEATK AL EK +QA+HALDGLEK LHRI DD+ALK  SL  D++    RE++N RP T  E NL + GI RE  K+L
Sbjct:    1 MATQVRPTTRFQPPDWFTNNYTISTNAERQRDASHQVRQEGRFLTNETDNQTKWDQHSNNVRLADRVDHIRKWKEILEKTLADLDQEIADLSDSKELTEQALEAKNLPLDVAVECLTLREGRQGIDIVQDEAENQLHKEVEVIEGIRKNLQQRVSDSFEQICLLQEARQQIQADLQDKNIALGIDIDQYNLTDRSPNISYKPDSLRVPKGSTTPQQWEDFSRYNKERADAEMQASGRLREAIHHTLQKTDNDLEAQKIATEFALRKRIHEFERAKDELEWQKKNTEDEIAELENDIRKLAEAIRAKTNPMKLAQTRLENRTYRPNVELCRDAPQYGLTDEVKQLEATKKALEEKLKQAQHALDGLEKNLHRINDDLALKNNSLMLDKRNMSVREKLNARPQTSVERNLTLTGIEREKTKVL 421          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 298.516 bits (763), Expect = 6.371e-96
Identity = 172/398 (43.22%), Postives = 254/398 (63.82%), Query Frame = 1
Query:  187 MASVT-KPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMN 1377
            MA+++ KP ++ +  DW  ++  IS  +E  +  SH+IRQE R LRNET  KT WD+YD++ RL DRI  +  WK+ LE   + ++ EI+ L  AK+E E+ L A  +P +V  EC TLR+ R   + V D  E  L KE ++I   +  LQQ ID++FEQ+ LL EA +Q+  DLQ K  A+ +D++  +L   SP IS KP+  RV  GSTTPQQWE +S +N  RA  E+ +S +LRE I  T   V N+L+AQ+ AT++A+RKR H  E+AL E+ WQ K  +DEI  ME+D++G+E  ++AK+   KL  TRLENR  RP V+LCRD  Q+GL +E KQL++T   L +K  QA  +L  L+    ++ +D++ K+ +LA +++  + R R++
Sbjct:    1 MATMSMKPGLRCRVPDWENSNKLISDTAEHRRHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQWEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLAQALDSLQSLQHHEAQMLEDLSRKQEALALEQRTAQTRTRLS 398          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 157.147 bits (396), Expect = 8.748e-42
Identity = 117/394 (29.70%), Postives = 197/394 (50.00%), Query Frame = 1
Query:  208 AMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            + +Y P DW  +++     SE  + ++  +R++   L  + D  T+W Q   +  L +R++ I  W+  L  + + +  EI  L   K  LE+ L     P     ECL  R+ R SID V D  E  L+KE E+I  C+ R+++ +D+A  Q+     A++++ +DL DK  A  ID   + +   S  IS+     R+    + P  W  ++  N   + +E ++S +LR+ I   +++  N++  Q N+ + +   RI +  +A + L         EI   E  ++ ++ +IR K    K+AQTRLE R  RPNVELCRD P + L  EV+++E +   L E+  +A + L  L K    ++ DI++K  SL  D+ KC   R      P
Sbjct:   90 STRYMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPSLSLPDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSFPSTP 483          
BLAST of Tektin-2 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 122.865 bits (307), Expect = 5.375e-30
Identity = 118/404 (29.21%), Postives = 193/404 (47.77%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRPTTL 1395
            +A+    + KY P +W  N+ A    +    Q +  + + +R L  E    T+  Q   T  L  R+  +   +  L+   E+L  E E L + K  LEK L   ++P  +  + LT R+ R   D V+D  E  LLKE ELI   +  L++ + +A +Q+ L  EA+  +  D  DK+ A  +D         S +    P S R+       + W  +++ N + A  +   S  LRE     +     DL+AQ    D +  +R  +  +A ++L  Q + V DEI + E+++  ++ ++  K    ++AQ+RL  R  RPN+ELCRD PQ  L  EV+Q+  +   L ++  +AR +L  LE+    ++ +I+ K  SL  DR KC   R R    PT L
Sbjct:   28 LATAGFRSAKYSPREWQENNSATLQRALTDHQHAQRVLRASRALSAEAAAGTQDAQSRGTLLLGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKCLTHRTRY---PTVL 428          
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 172.555 bits (436), Expect = 8.241e-51
Identity = 88/187 (47.06%), Postives = 124/187 (66.31%), Query Frame = 1
Query:  817 STTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMN 1377
            S++P+ W+++SR N +RA AE+ +S  LREAI  TI    N+L+AQKN+TD+A RKR H+ +K   EL WQKKN + EI+ +E D+  +E  +RAK+   K+A TRLE R  R  VELCRD PQYG+T EV Q+EAT A L +K   + +AL GL   L R++ D+A K  +L  +R+C   R ++ 
Sbjct:    1 SSSPRTWDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGLERRCVDVRRKLT 187          
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 137.117 bits (344), Expect = 8.778e-38
Identity = 81/211 (38.39%), Postives = 123/211 (58.29%), Query Frame = 1
Query:  184 LMASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKG 816
            ++    KP  ++   +WH +   +S+ ++  +  S  +RQEAR LR++++ +TKWDQ+D+ TRL +R+ +++ W E L+   +  D EI  L   KD+ E+ L+A  VP  V  ECL LRDAR  +D V D  E  L +E + I + K  L + I++AF Q+  L EAR Q+  D++DK  A+ ID     LN  S  IS KP+  RV KG
Sbjct:    1 MLGVSVKPGRRFTVGEWHDSGERVSSGAQSRRDVSRSVRQEARHLRDQSNNQTKWDQHDSNTRLEERMSSVQRWVERLQHTLDDTDAEINALAKTKDDAERALQAKAVPLQVATECLFLRDARRGVDLVHDPVEDELHREVKAIERAKEALTRSINDAFLQVCQLQEARQQLQGDVRDKEEALEIDSTCRALNNASATISLKPNPMRVPKG 211          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 348.591 bits (893), Expect = 4.883e-116
Identity = 193/407 (47.42%), Postives = 266/407 (65.36%), Query Frame = 1
Query:  193 SVTKPAM--KYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDN 1407
            ++T P +  ++  +DWHT++  I TN+ER ++ASH +RQE+RFLRNETD  T+W Q+D+ T+L  RID I  WK  LE    + D EI  L   K+  E+ LEA  VP D+  ECL LR+ R SID V DE E  L KE E+I   K  LQQK+DE+FEQ+ LL EAR+Q+  D+ DK   + ID + Y +N  S NI ++ + TR VKGS TP+ W+ +S YN  RA AE+ +S+ LREAI  T+    NDL+AQ+ A++Y+ RKRIH+ ++A  EL WQ+KN   EIA +E D++G++++I AK     +AQTRLENR  RPNVELCRD PQY L  EV ++  +  AL EK R+A+++L+ L   L RI +D+A K  SLA D +C   RE+M   P  + + N
Sbjct:    2 ALTNPNIPPRFAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSVTPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALDNRCMSVREKMREIPHKMMDMN 408          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 208.764 bits (530), Expect = 3.642e-62
Identity = 146/401 (36.41%), Postives = 220/401 (54.86%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            MA + +P  KY P +WH ++      +E+ + A+  +R E+  LR E +V+T   Q D   +L  RI  I  WK  L+ ++ + ++EI  + N K  LE+ L    +P  +  +CL  R+ R  ID V D  E  LLKE E+I   +  L++ I++A EQ+ LL  AR  + KD +DK  A  ID     L  +SP + +  D+ ++ K S TP +WED+S  N  +A  E  SS  LR  I   +    NDL  Q  A + A  KRI +  KA  +L      V++EIAAME+++  ++ +I  KI   K+AQTR+ENR  RPN+ELCRD  QY L DEV ++      L EK  +A  +L  L ++   +++DI +KE SL  DR +C + R+++   P
Sbjct:    1 MARLVQPPPKYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSVTPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMNQCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRKQITHVP 401          
BLAST of Tektin-2 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 169.088 bits (427), Expect = 1.424e-47
Identity = 126/373 (33.78%), Postives = 191/373 (51.21%), Query Frame = 1
Query:  259 TNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERM 1374
            ++ E+ +  +  +R E   LR ET + T   Q D   +L  R+  I  WK  LE+   +   EI+ L      LEK L A   P ++  +CL  R+ R  ID V D  E  L KE E+I   +  L++ +D+A EQ+ LL  A+ Q+ KDL DK  A+GID     LN +S +I F P +  + + S TP +WE YS  N  +A  E  +S  LR  I+  +     DL+      +    KRI D   A   L  +   V DE+A+M+ +++ +  +I  K    K+A TRL+ R  RPNVELCRD  QY L  EV ++  +   L  +  +A+ ++  L +    ++DDI +K  SL  DR +C   R+++
Sbjct:    5 SSGEKERATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDRDQCMVVRQQV 377          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 262.307 bits (669), Expect = 5.595e-82
Identity = 152/399 (38.10%), Postives = 248/399 (62.16%), Query Frame = 1
Query:  199 TKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTL 1395
             KP+++   ++W+ N+  +   +++ +  S +IRQE + LRNET  KT WD+ + + RL +R+  +  W+++L+   +K+D+E++ L  +K+  E+ L A   P +V  EC+ LR+ R   + V D  +  L KE ELI + +  LQQ IDEAF+Q+ +L EAR+Q+  DLQ+K  A+ ID +   L   SPNIS K + TR+  G++TPQ+W   S +N  +A   +  SQ++RE +  +   + N+L+A++ AT++A+RKR H  E+A DEL WQ +N+E EIA ME D++ ++  ++AK    KLA TRLENR  RP ++LCRD  QY L  EV+QLEAT  AL  K  +A+H+L  +     ++  D++ K+ +L+ +++    R R+    +T+
Sbjct:    4 VKPSLRCGVSEWNNNNLQLWAEAQQQRLVSSEIRQECKSLRNETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTPQEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKLSKAQHSLQNMRLHHGQMLQDLSRKQEALSLEQRSLNTRTRLTSGSSTV 402          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 151.754 bits (382), Expect = 6.582e-40
Identity = 119/392 (30.36%), Postives = 197/392 (50.26%), Query Frame = 1
Query:  214 KYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            +Y P DW+ ++ +    SE  ++++  +R++   L  + D  T+  Q + +  +++R++ IR WK  L  + + +  EI  L   K  LE+ L     P  V  ECL  R+ R SID V D  E  L+K  E+I  C+ R++  +D A  Q+     A++++ KDL DK  A  ID   ++L   S  I +     R     + P  W  ++  N  R+ +E  +S +LR+ I   +++  N++  Q N  + A   RI +   A   L         EI   E  ++ ++ +IR K    K+AQTRLE R  RPN+ELCRD P + L  EV+++E T   L E+  +A + L  L K   ++++D+++K  SL  D+ KC   R+     P
Sbjct:   90 RYTPDDWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLIK-IEVIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTFPSMP 480          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 137.887 bits (346), Expect = 2.810e-35
Identity = 116/396 (29.29%), Postives = 187/396 (47.22%), Query Frame = 1
Query:  208 AMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATD-RKCEKARERMNPRPTT 1392
            + KY PA+W +N   I   +      +  I+Q +R L  +++  T   Q + T  L +R+  I  W+  L    E+L  ++E L  A+  LE+ LEA + P  +  + L  R  R   D V+D  E  LLKE  LI   +  L++ I +   Q+    +A+  +  D  DK  A  +D      +  SP+    P S    +    P  W  +++ N  +A  E  +S+RLR  +   +     DL  Q++  D A  +R  +  +A  EL  +   V  +I   EK++ G++ +I  K    ++ Q+RL  R  RPN+ELCRD  Q  L  E  Q+E T  +L +K  +AR +L  LE+    ++ DI+ K  SL  +  KC   R  +   P+T
Sbjct:   46 STKYSPAEWFSNYQTILVRAGADNLEAESIQQLSRTLNRDSEGVTLQTQAEGTRLLGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEATDTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLKQKLNEARISLSNLEESRMELQKDISCKSQSLFIEGEKCMTQRRHL---PST 438          
BLAST of Tektin-2 vs. Ensembl Medaka
Match: tekt1 (tektin-1 [Source:NCBI gene;Acc:101161072])

HSP 1 Score: 66.6254 bits (161), Expect = 1.976e-11
Identity = 68/260 (26.15%), Postives = 121/260 (46.54%), Query Frame = 1
Query:  484 KRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNL-------NENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGL-------TDEVKQLE 1221
            K L+A   P +V + C+  R  R + +   DE +  LLKE E + + +  LQ+  ++  EQ+ L   A+  + KDL++K+ A  +D N   L       + + P     P+ + V+    T  QWE+ S  N  +A  + T+S+ L+  +   +     D++ Q  AT  AI+  +   + A +++  +   ++ EI++  K  + +  ++        L Q RL  R  RP  E  RD  Q  L       T+ +KQL+
Sbjct:   89 KALDACKEPLEVTDLCMKERLKRPNSERFHDEVDGELLKESEGLKRVESLLQRVTEQISEQLRLNRSAKYGIEKDLKEKSEAQNVD-NFCTLMATLSMSHRHRPKTHSTPEPSSVL----TLDQWENISYANMAKAEQQKTNSRSLQVLVQSVLDQTAADMQKQVQATTTAIQLNVQKMKNAKNQMEDELVKIQSEISSQRKTREDLRVAVAENEEFLSLTQARLALRHERPGKEQWRDPAQRKLLADVQKITEHIKQLQ 343          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000065255.1 (SMESG000065255.1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 361/366 (98.63%), Postives = 362/366 (98.91%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLE 1284
            MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQAR  +  LE
Sbjct:    1 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARWGIVRLE 366          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000050057.1 (SMESG000050057.1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 361/366 (98.63%), Postives = 362/366 (98.91%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLE 1284
            MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQAR  +  LE
Sbjct:    1 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARWGIVRLE 366          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000026446.1 (SMESG000026446.1)

HSP 1 Score: 355.91 bits (912), Expect = 1.640e-118
Identity = 200/416 (48.08%), Postives = 277/416 (66.59%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRPTTLQEDNLLMQGIIRE 1434
            MA+ ++P  +Y P +W ++++ +S NSE  +  S   RQ  R  R ETD+KTK DQ D+ TRL+DRID IR W+E+L++ K  LDKEI+ L+  K+E+E +LE  N+  D+VNEC+  RD R  I+NV D+ +  L  EQ LI++CK  LQ KID+AFEQ+  + EAR +   DLQDK  A+ IDI QYN+NE S +IS+KP+ TR  K ST PQ+WED+SRY+  RA  E+   QR RE +H+T H VD+ L  Q   T+YA+RKRIH+ E+A++EL +QKK  E E   +  D++ +E++ RAKIP+AKL QTRLENR  RP +E CRDA Q GL DEV QL  +K  L E+   AR+ALDG++K+L  I D++  K+ +L  D+     R R+   P T    N++  GI+RE
Sbjct:    1 MATESRPVKEYAPGEWFSDAYELSKNSEEKRDISEKARQLGRATRIETDLKTKTDQLDSNTRLSDRIDIIRRWRELLDKTKTNLDKEIQALSETKEEMEHQLEDKNINEDIVNECINNRDCRRGIENVNDDGQMELRNEQNLIAECKKLLQSKIDDAFEQLCRMQEAREEFFGDLQDKTTALEIDITQYNMNEKSSHISYKPNPTRKPKMSTDPQEWEDFSRYSINRAKTEMVKGQRTREDLHYTAHKVDDMLDHQSQRTEYALRKRIHELEQAVNELEYQKKLTEKEREELLDDIKALEEAARAKIPSAKLTQTRLENRLERPRMEQCRDAAQEGLVDEVGQLADSKETLEERLANARNALDGVDKKLAEINDNLNGKKHALLMDKMSLDYRLRLKSVPMTRTPCNMIPFGIMRE 416          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000081245.1 (SMESG000081245.1)

HSP 1 Score: 152.14 bits (383), Expect = 7.986e-41
Identity = 126/397 (31.74%), Postives = 207/397 (52.14%), Query Frame = 1
Query:  187 MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERM 1374
            MA + KP M+Y   +W  ++     N+E  +Q +  ++ E   L +ETD +T     D   ++  RID I+ WK  L++    +  E   L+     + K  EAL  P  +  +C+  R+ R +ID V D+ +  L+KE E+ +  K  L + I++A EQ+ L  +A  ++ +D+ DK  A GID     L  NS +I +   +  +   + TP+ W+ ++  N    + +L +S  +R  I   +    +D K QK A D A R+RI++   +  +L      V  EI+ +E  ++ +E +I AKI   KLAQTRL+ RK RPNVE CRD PQY L +EV++LE   A L  +   A      L+++   ++++I +K+ SL  D  +C   RE +
Sbjct:    1 MAHLVKPPMRYTHPEWTYSNNTKYRNAEIERQTAERLQNECDRLIDETDKRTVKSLNDVNKKIDQRIDDIKYWKNELDKKLADVAVENYKLDEHIKRVGKAREALLEPLHISKQCMANREGRVAIDLVHDDVQKELIKEVEVHNGVKELLDRTIEQAVEQLRLNRKAEYRLKRDMDDKLTAQGIDEFVRELKPNSKDIGYTNAAAEIDPKAVTPEDWQSFTNENILNMDRQLLNSSDMRSIIDGVLQQTADDQKRQKIAVDTAFRRRINEVRDSKGKLEEHLARVLKEISNVEDTIKNLEMAIEAKIQPLKLAQTRLQVRKGRPNVENCRDNPQYRLLEEVEELEKDIAHLQRRLADANSEKKALKRRQLDLEEEIQVKQNSLFIDEVECMGIRESI 397          
BLAST of Tektin-2 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 147.902 bits (372), Expect = 1.961e-38
Identity = 121/392 (30.87%), Postives = 198/392 (50.51%), Query Frame = 1
Query:  214 KYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDVKTKWDQYDNTTRLADRIDAIRLWXXXXXXXXXXXXXXXXXXXXAKDELEKRLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRLQQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISFKPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVDNDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVEDSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAALLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDR-KCEKARERMNPRP 1386
            +Y P DW T +     +++R++     IR +   L  ETD +TK  Q D   ++ DR+     WK  L+++ +K+  E  NLN  K   EK L        +  ECL  R+ R  ID V D  E  L+ E + + + +  ++  I +A  QM+L   A+++   D +DK IA  ID N + +  +S  I+F      +    +TP+ W  YS  N +R+ AE  +S ++RE I  T+    ND+  + N  + A+ +RI +   A +++      +  EI  MEK+++ ++  I+ K    K+AQTRL  R  RP +ELCRD P + L +EV ++    A L+ + R+A  AL  L      ++ D+ +K  +L  DR KC   R+    +P
Sbjct:  113 RYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPIQP 504          
The following BLAST results are available for this feature:
BLAST of Tektin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT23.634e-11550.00tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT12.078e-5432.21tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT36.326e-3827.42tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT36.326e-3827.42tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT42.763e-3230.86tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
back to top
BLAST of Tektin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02E12.41.583e-1021.55pep chromosome:WBcel235:X:4005314:4007634:1 gene:W... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG30856.015e-4530.81gene:FBgn0034816 transcript:FBtr0310344[more]
CG30856.015e-4530.81gene:FBgn0034816 transcript:FBtr0071963[more]
Tektin-A7.641e-2627.14gene:FBgn0028902 transcript:FBtr0080788[more]
Tektin-A7.641e-2627.14gene:FBgn0028902 transcript:FBtr0331277[more]
CG328193.509e-2427.79gene:FBgn0052819 transcript:FBtr0070050[more]
back to top
BLAST of Tektin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt21.574e-9943.92tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tekt21.574e-9943.92tektin 2 (testicular) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tekt35.995e-3828.21tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt31.157e-3728.21tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt31.157e-3728.21tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
back to top
BLAST of Tektin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt21.863e-11449.13tektin 2 (testicular) [Source:NCBI gene;Acc:493269... [more]
gdf109.389e-4931.16growth differentiation factor 10 [Source:Xenbase;A... [more]
plcd11.683e-4031.59phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
tekt32.694e-4029.85tektin 3 [Source:NCBI gene;Acc:549229][more]
fam168a4.323e-2027.22family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt21.161e-10448.61tektin 2 [Source:MGI Symbol;Acc:MGI:1346335][more]
Tekt21.161e-10448.61tektin 2 [Source:MGI Symbol;Acc:MGI:1346335][more]
Tekt13.784e-4831.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt13.784e-4831.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt13.784e-4831.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
back to top
BLAST of Tektin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UIF3|TEKT2_HUMAN1.745e-11450.00Tektin-2 OS=Homo sapiens OX=9606 GN=TEKT2 PE=1 SV=... [more]
sp|Q4R5V1|TEKT2_MACFA5.983e-11449.87Tektin-2 OS=Macaca fascicularis OX=9541 GN=TEKT2 P... [more]
sp|Q2T9Q6|TEKT2_BOVIN6.421e-11149.87Tektin-2 OS=Bos taurus OX=9913 GN=TEKT2 PE=2 SV=1[more]
sp|Q6AYM2|TEKT2_RAT1.884e-10947.86Tektin-2 OS=Rattus norvegicus OX=10116 GN=Tekt2 PE... [more]
sp|Q922G7|TEKT2_MOUSE8.119e-10448.61Tektin-2 OS=Mus musculus OX=10090 GN=Tekt2 PE=1 SV... [more]
back to top
BLAST of Tektin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F8D08.033e-18063.18Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8H0888.258e-18063.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267D9M08.666e-17962.95Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DEM68.835e-17962.95Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
V3ZV477.848e-17262.00Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt26.371e-9643.22tektin 2 [Source:NCBI gene;Acc:103026688][more]
tekt38.748e-4229.70tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt45.375e-3029.21tektin 4 [Source:NCBI gene;Acc:103034475][more]
back to top
BLAST of Tektin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEKT28.241e-5147.06tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT28.778e-3838.39tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO373574.883e-11647.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392923.642e-6236.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406811.424e-4733.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tekt25.595e-8238.10tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt36.582e-4030.36tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt42.810e-3529.29tektin 4 [Source:NCBI gene;Acc:101173527][more]
tekt11.976e-1126.15tektin-1 [Source:NCBI gene;Acc:101161072][more]
back to top
BLAST of Tektin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065255.10.000e+098.63SMESG000065255.1[more]
SMESG000050057.10.000e+098.63SMESG000050057.1[more]
SMESG000026446.11.640e-11848.08SMESG000026446.1[more]
SMESG000081245.17.986e-4131.74SMESG000081245.1[more]
SMESG000021346.11.961e-3830.87SMESG000021346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013840 ID=SMED30013840|Name=Tektin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1578bp
ATAAGAATTATGCAGAAAATTTGATTTAAATAATATTACCTAAATTTAAT
GATTACTAAAATTTTAAAATCAATTTCATTTAATCTTTGTGAAATTTACT
GTGTTTTAAATGACAAAGTCATAGTTACCGGCAGTAGTTATATTTGAAAA
TTTAAGAAATTTAAAAATTATAGTCTTTGTCAACTAATGGCGTCAGTTAC
AAAACCAGCAATGAAATATCAACCAGCTGATTGGCATACGAATAGTTTTG
CTATCAGTACTAATTCAGAGAGAATGCAACAGGCGAGTCATGATATTCGA
CAGGAAGCGAGATTTTTAAGAAATGAAACCGATGTAAAAACCAAATGGGA
TCAATACGATAACACAACGCGTTTAGCCGATCGAATTGACGCTATTCGCT
TATGGAAAGAGATTCTTGAAGAAGACAAAGAGAAATTAGATAAAGAAATC
GAGAATTTAAATAACGCTAAAGATGAATTGGAAAAACGATTGGAAGCGCT
AAACGTTCCGACCGACGTTGTCAATGAATGCCTAACACTGCGAGATGCTC
GCACTAGTATTGACAATGTTGAGGATGAGCCAGAACATATGCTTTTGAAA
GAACAAGAGTTGATAAGCAAATGTAAATTGCGACTGCAACAGAAAATCGA
TGAGGCATTTGAACAGATGACCTTGTTGACTGAGGCGAGAAATCAGGTGC
TGAAGGATTTGCAGGATAAAAACATCGCGATGGGCATCGATATCAATCAA
TACAACCTCAATGAAAATTCCCCAAATATCAGCTTCAAGCCTGACTCGAC
ACGAGTTGTGAAAGGAAGTACGACTCCTCAACAGTGGGAGGACTACAGCC
GATATAATCACCAGCGAGCCAACGCTGAACTGACGAGCTCCCAGCGATTG
CGAGAAGCAATCCATCACACAATCCATTCGGTCGATAACGATTTGAAGGC
CCAGAAAAACGCTACAGATTACGCGATACGGAAGCGGATCCATGACAACG
AAAAAGCTCTCGATGAGTTGAATTGGCAAAAAAAAAATGTGGAGGATGAA
ATCGCGGCCATGGAAAAGGACCTGCAAGGCGTGGAAGACTCGATTCGTGC
GAAAATTCCCACCGCAAAATTGGCTCAGACTCGTCTTGAGAACCGGAAAG
CTCGTCCAAATGTGGAACTGTGTAGAGACGCACCACAATACGGCCTGACA
GACGAGGTGAAGCAATTGGAGGCGACAAAGGCTGCCTTGCTGGAGAAACA
GCGACAAGCAAGACACGCGCTGGATGGCCTAGAGAAGCAGTTACACAGAA
TCAAAGATGACATCGCACTGAAAGAGTTCTCACTGGCAACCGACAGGAAA
TGCGAAAAAGCCAGAGAGAGAATGAACCCGAGGCCGACAACACTCCAGGA
AGACAATTTACTGATGCAAGGAATCATCAGGGAAACCAACAAAATGCTGC
CGGCCTGAATTGATTGCGATACTGTAAGGCTAGGAGATTTACGTGGAAGA
TTTCAGTGATTTCTAATAATAAATTATAGAGTATTGTTCCTTCCGTGTTG
TTGTGCTTGATTTGTGCTGCTGCCTGCC
back to top

protein sequence of SMED30013840-orf-1

>SMED30013840-orf-1 ID=SMED30013840-orf-1|Name=SMED30013840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MASVTKPAMKYQPADWHTNSFAISTNSERMQQASHDIRQEARFLRNETDV
KTKWDQYDNTTRLADRIDAIRLWKEILEEDKEKLDKEIENLNNAKDELEK
RLEALNVPTDVVNECLTLRDARTSIDNVEDEPEHMLLKEQELISKCKLRL
QQKIDEAFEQMTLLTEARNQVLKDLQDKNIAMGIDINQYNLNENSPNISF
KPDSTRVVKGSTTPQQWEDYSRYNHQRANAELTSSQRLREAIHHTIHSVD
NDLKAQKNATDYAIRKRIHDNEKALDELNWQKKNVEDEIAAMEKDLQGVE
DSIRAKIPTAKLAQTRLENRKARPNVELCRDAPQYGLTDEVKQLEATKAA
LLEKQRQARHALDGLEKQLHRIKDDIALKEFSLATDRKCEKARERMNPRP
TTLQEDNLLMQGIIRETNKMLPA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0031514motile cilium
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000435Tektin
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0030317flagellated sperm motility
GO:0036159inner dynein arm assembly
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 74..108
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availableCOILSCoilCoilcoord: 268..302
NoneNo IPR availableCOILSCoilCoilcoord: 341..375
NoneNo IPR availableCOILSCoilCoilcoord: 147..167
NoneNo IPR availablePFAMPF03148Tektincoord: 16..396
e-value: 3.7E-126
score: 421.0
NoneNo IPR availablePANTHERPTHR19960:SF7TEKTIN-2coord: 5..405
IPR000435TektinPRINTSPR00511TEKTINcoord: 301..317
score: 44.12
coord: 374..386
score: 46.15
coord: 320..340
score: 66.67
IPR000435TektinPANTHERPTHR19960TEKTINcoord: 5..405