acetyl-CoA acetyltransferase, mitochondrial

Overview
Nameacetyl-CoA acetyltransferase, mitochondrial
Smed IDSMED30013833
Length (bp)1514
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of acetyl-CoA acetyltransferase, mitochondrial (SMED30013833) t-SNE clustered cells

Violin plots show distribution of expression levels for acetyl-CoA acetyltransferase, mitochondrial (SMED30013833) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of acetyl-CoA acetyltransferase, mitochondrial (SMED30013833) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for acetyl-CoA acetyltransferase, mitochondrial (SMED30013833) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013833

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013833SMESG000056408.1 Contig7115uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013833SMESG000056408.1 Contig7115newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30013833SMESG000056408.1 dd_Smed_v4_1377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013833SMESG000056408.1 dd_Smed_v4_1377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013833SMESG000056408.1 dd_Smed_v4_1377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013833SMESG000056408.1 dd_Smed_v4_1377_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013833SMESG000056408.1 Contig24134uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013833SMESG000056408.1 Contig24134newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Match: ACAT1 (acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:93])

HSP 1 Score: 437.958 bits (1125), Expect = 1.719e-150
Identity = 215/387 (55.56%), Postives = 285/387 (73.64%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            KEV I++  RTPIGSF   L+ L A +LG+I I+  + +       + E  MG V QG  GQAP RQA L +GLP S  CTTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIGMSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:   40 KEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 425          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Match: ACAT1 (acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:93])

HSP 1 Score: 430.639 bits (1106), Expect = 1.957e-147
Identity = 215/394 (54.57%), Postives = 285/394 (72.34%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIG-------MSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            KEV I++  RTPIGSF   L+ L A +LG+I I+  + +       + E  MG V QG  GQAP RQA L +GLP S  CTTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIG       MSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:   40 KEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGKCFLNFRMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 432          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Match: ACAT1 (acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:93])

HSP 1 Score: 405.601 bits (1041), Expect = 4.848e-139
Identity = 196/336 (58.33%), Postives = 257/336 (76.49%), Query Frame = 3
Query:  276 MGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            MG V QG  GQAP RQA L +GLP S  CTTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIGMSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:    1 MGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 335          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Match: ACAT1 (acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:93])

HSP 1 Score: 405.601 bits (1041), Expect = 4.848e-139
Identity = 196/336 (58.33%), Postives = 257/336 (76.49%), Query Frame = 3
Query:  276 MGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            MG V QG  GQAP RQA L +GLP S  CTTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIGMSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:    1 MGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 335          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Match: ACAT1 (acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:93])

HSP 1 Score: 335.495 bits (859), Expect = 4.646e-112
Identity = 161/283 (56.89%), Postives = 218/283 (77.03%), Query Frame = 3
Query:  435 INDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            + DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIGMSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:   23 VQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 304          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Match: kat-1 (Acetyl-CoA acetyltransferase homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q22100])

HSP 1 Score: 417.542 bits (1072), Expect = 4.216e-143
Identity = 200/385 (51.95%), Postives = 272/385 (70.65%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            K  +I+   RTPIGSFR  L+S+TAP+L ++ IK  L R A     I EV +GQVCQ  +GQAPARQAAL +GL  SV+ TT+NKVC+SG+K++++  Q I     D  I GG ESMS VPFY  R E  YGG  +IDGIV DGLTD Y+K HMG C E T+  + I+R  QD++AI+SY+KS  + + G    E+V V++K+KK   I+++DEE+ +VNFDKF SL+  F+ +GT+TAANAS+LNDGAA++++ S +A+ +  L P+A+I+ + DAA  P+DF +AP     K+L+       D+A WE+NEAFS V LA +K + G+ P  VN HGGAVS+GHPIGMSGARLI HL + LK  ++GVA+ICNGGGG+S ++I+
Sbjct:   22 KHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYVQRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTKVNFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGVKQSDVAQWEVNEAFSCVPLAFIKKL-GVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLKSGQIGVAAICNGGGGSSGMVIQ 405          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Match: kat-1 (Acetyl-CoA acetyltransferase homolog, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q22100])

HSP 1 Score: 417.542 bits (1072), Expect = 4.216e-143
Identity = 200/385 (51.95%), Postives = 272/385 (70.65%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            K  +I+   RTPIGSFR  L+S+TAP+L ++ IK  L R A     I EV +GQVCQ  +GQAPARQAAL +GL  SV+ TT+NKVC+SG+K++++  Q I     D  I GG ESMS VPFY  R E  YGG  +IDGIV DGLTD Y+K HMG C E T+  + I+R  QD++AI+SY+KS  + + G    E+V V++K+KK   I+++DEE+ +VNFDKF SL+  F+ +GT+TAANAS+LNDGAA++++ S +A+ +  L P+A+I+ + DAA  P+DF +AP     K+L+       D+A WE+NEAFS V LA +K + G+ P  VN HGGAVS+GHPIGMSGARLI HL + LK  ++GVA+ICNGGGG+S ++I+
Sbjct:   22 KHAFIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAPARQAALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVPFYVQRGEIPYGGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEVVPVNVKSKKGVTIVDKDEEFTKVNFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEAVSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGVKQSDVAQWEVNEAFSCVPLAFIKKL-GVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLKSGQIGVAAICNGGGGSSGMVIQ 405          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Match: T02G5.7 (pep chromosome:WBcel235:II:7075614:7077188:1 gene:WBGene00020166.1 transcript:T02G5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02G5.7)

HSP 1 Score: 332.028 bits (850), Expect = 6.743e-110
Identity = 167/387 (43.15%), Postives = 247/387 (63.82%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            K+V+I++G RTPIG++R    +  A +LG +  K  + R       I+EV+ G V     GQ   RQ +L +GLP +    T+NKVC+S MK+++     I     D ++  G E+MS VPFY PR E  +GG  + DGI  DGL D+  K  MG+CAE T     I+R+ QD +AI SY+K+ ++  +  F +E+V VS+K  + E++I EDEEY ++   K  SLKP F     GT+T ANASSLNDGA + +++  +AL +    P+A+++ FA+A   P+DF +AP +++R LLK       DIA+WE+NEAF+V VLA +K +  + P  VN+ GGAV++GHP+GMSG R++  LAY+L   +LGVA+ICNGGG A++++I+
Sbjct:    4 KKVFILSGARTPIGAYRGSFANFGAVELGTVAAKAAIERSGVAPEKIEEVIGGCVLPAGLGQNVTRQISLSAGLPVTTQAVTVNKVCSSSMKALVTAAVEIKAGYYDTILVVGTENMSQVPFYVPRGEIPFGGIQMTDGISKDGLEDIKEKGPMGLCAEKTVKDYGITREEQDAYAIESYKKASNAWSSEKFSEEVVPVSVKTSRSEVVITEDEEYKKLIESKVSSLKPVFVRDGTGTITPANASSLNDGAVATVVVGENALPQ-GAHPLAELVAFAEAGRAPIDFTVAPVDAVRLLLKKSGLQVSDIALWELNEAFAVTVLAFIKELN-IEPSVVNVKGGAVAIGHPLGMSGLRIVNSLAYSLAPGQLGVAAICNGGGEATAVLIK 388          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Match: acaa-2 (ACetyl-CoA Acyltransferase 2 homolog [Source:UniProtKB/TrEMBL;Acc:O45552])

HSP 1 Score: 229.95 bits (585), Expect = 2.324e-70
Identity = 130/391 (33.25%), Postives = 214/391 (54.73%), Query Frame = 3
Query:  120 GKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQV-CQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNEL--GVASICNGGGGASSIMIE 1277
            GK V+I+   RT  G+F   L  L+A  LG +  +  L         +D V+ G V      G   +R   L SG+P +V   T+N++C SG ++V+   Q+I    +++V+AGG E+MS VPF     R   + G     + +++D L+D Y K  MG  AE   +   ++R   D+FA+ S    + + + G++K EIV ++IK +K E     DE       +    LKP F+ +G V A NAS ++DGAA+L++   D++K   L P+A+++ ++     P    I PA +IR++LK       DI ++E+NEAF+   LA  + + G+  +K+N++GGA+++GHP+  SGAR+  H+ + L +  +  G+ S C GGG   +I+ E
Sbjct:    3 GKCVFIVGAKRTAFGTFGGKLKGLSATDLGVVASQAALKHANVGADAVDHVIFGNVVASSRDGIYLSRHIGLKSGVPQNVGALTVNRLCGSGFQAVVNAAQAIKLGESNIVLAGGTENMSMVPFAVRDIRFGTALGKKYEFEDMLWDSLSDPYAKLAMGQTAEKLGAQYKVTRQEADEFALRSQTLWKKAQEAGVYKNEIVGITIKGRKGEESFEIDEHPRATTAESLAKLKPVFQKDGLVNAGNASGISDGAAALVVAGEDSVKSKNLKPLARVVAYSAVGCDPTIMGIGPAPAIREVLKKSGLKIGDIDIFEVNEAFAPQALAVQREL-GIPMEKLNVNGGAIALGHPLAASGARISTHIVHELHRRNVKYGIGSACIGGGQGIAILFE 392          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Match: acaa-2 (ACetyl-CoA Acyltransferase 2 homolog [Source:UniProtKB/TrEMBL;Acc:O45552])

HSP 1 Score: 229.95 bits (585), Expect = 2.324e-70
Identity = 130/391 (33.25%), Postives = 214/391 (54.73%), Query Frame = 3
Query:  120 GKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQV-CQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNEL--GVASICNGGGGASSIMIE 1277
            GK V+I+   RT  G+F   L  L+A  LG +  +  L         +D V+ G V      G   +R   L SG+P +V   T+N++C SG ++V+   Q+I    +++V+AGG E+MS VPF     R   + G     + +++D L+D Y K  MG  AE   +   ++R   D+FA+ S    + + + G++K EIV ++IK +K E     DE       +    LKP F+ +G V A NAS ++DGAA+L++   D++K   L P+A+++ ++     P    I PA +IR++LK       DI ++E+NEAF+   LA  + + G+  +K+N++GGA+++GHP+  SGAR+  H+ + L +  +  G+ S C GGG   +I+ E
Sbjct:    3 GKCVFIVGAKRTAFGTFGGKLKGLSATDLGVVASQAALKHANVGADAVDHVIFGNVVASSRDGIYLSRHIGLKSGVPQNVGALTVNRLCGSGFQAVVNAAQAIKLGESNIVLAGGTENMSMVPFAVRDIRFGTALGKKYEFEDMLWDSLSDPYAKLAMGQTAEKLGAQYKVTRQEADEFALRSQTLWKKAQEAGVYKNEIVGITIKGRKGEESFEIDEHPRATTAESLAKLKPVFQKDGLVNAGNASGISDGAAALVVAGEDSVKSKNLKPLARVVAYSAVGCDPTIMGIGPAPAIREVLKKSGLKIGDIDIFEVNEAFAPQALAVQREL-GIPMEKLNVNGGAIALGHPLAASGARISTHIVHELHRRNVKYGIGSACIGGGQGIAILFE 392          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Match: CG10932 (gene:FBgn0029969 transcript:FBtr0071143)

HSP 1 Score: 464.537 bits (1194), Expect = 1.966e-161
Identity = 233/404 (57.67%), Postives = 297/404 (73.51%), Query Frame = 3
Query:   78 RFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNR--VARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            R+   RN+SS      EV +++  RTPIGSF+  L  LTA QLGA  I+  + +  +A+ D+   EV+MG V     GQAPARQAA+F+GLP++V CTT+NKVC+SGMK+VM+G QS+M    DVV+AGG ESMSNVP+Y  R    YGG +L DGIVFDGL DVYNK HMG CAENTA  L I+R  QD FAI SY++S ++    +F+ EI  V I+ K K E++I+EDEEY RVNFDKF  L   F + NGTVTA NAS+LNDG A+++++S +A +K  + P+A+I+ F DA   P+DFPIAPA +I KLLK      ED+AMWE+NEAFS+VVLAN+K +  + P KVN+HGGAVS+GHPIGMSGARL+ HL+++LKK ELG ASICNGGGGASSI+IE
Sbjct:   11 RWSAHRNYSSKIA---EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDV--QEVIMGNVVSAGLGQAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVPYYLKRGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVFQDEIAPVKIQQKRKPEIVISEDEEYKRVNFDKFGQLATVFQRENGTVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLLKRAGVRKEDVAMWEVNEAFSLVVLANIKKLD-VDPAKVNVHGGAVSIGHPIGMSGARLVAHLSHSLKKGELGCASICNGGGGASSILIE 408          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Match: CG10932 (gene:FBgn0029969 transcript:FBtr0345982)

HSP 1 Score: 464.537 bits (1194), Expect = 1.966e-161
Identity = 233/404 (57.67%), Postives = 297/404 (73.51%), Query Frame = 3
Query:   78 RFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNR--VARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            R+   RN+SS      EV +++  RTPIGSF+  L  LTA QLGA  I+  + +  +A+ D+   EV+MG V     GQAPARQAA+F+GLP++V CTT+NKVC+SGMK+VM+G QS+M    DVV+AGG ESMSNVP+Y  R    YGG +L DGIVFDGL DVYNK HMG CAENTA  L I+R  QD FAI SY++S ++    +F+ EI  V I+ K K E++I+EDEEY RVNFDKF  L   F + NGTVTA NAS+LNDG A+++++S +A +K  + P+A+I+ F DA   P+DFPIAPA +I KLLK      ED+AMWE+NEAFS+VVLAN+K +  + P KVN+HGGAVS+GHPIGMSGARL+ HL+++LKK ELG ASICNGGGGASSI+IE
Sbjct:   11 RWSAHRNYSSKIA---EVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDV--QEVIMGNVVSAGLGQAPARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVPYYLKRGATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVFQDEIAPVKIQQKRKPEIVISEDEEYKRVNFDKFGQLATVFQRENGTVTAGNASTLNDGGAAVVLMSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLLKRAGVRKEDVAMWEVNEAFSLVVLANIKKLD-VDPAKVNVHGGAVSIGHPIGMSGARLVAHLSHSLKKGELGCASICNGGGGASSILIE 408          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Match: CG9149 (gene:FBgn0035203 transcript:FBtr0072667)

HSP 1 Score: 296.975 bits (759), Expect = 3.815e-96
Identity = 154/388 (39.69%), Postives = 240/388 (61.86%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP-RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEY-ARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            +V+I++  RTPIGSF   L+ L A  LG++ I+E L R       ++EV++GQ      GQ PARQA+L +GLP  V    IN +C SG+K+V +G Q+I      +V+AGGQESMS  P     R     G  +++D ++ DGLTD     HMGI AEN A   NISR+AQD +A+ S  +++ + K G F KEIV V IK++K     ++DE   A    +  + L+ AFK  G++TA NAS +ND AA++L++S + + +  L P+A+I+G+  + ++P    + P  ++  LL+  N   E++ ++E+NEAF+   LA L+ ++ +   KVN++GGA+++GHPIG SGAR+++ L Y L++     G+AS+C GGG   ++ +E
Sbjct:    3 DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQGVKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVLQDLQ-LDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVE 389          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Match: yip2 (gene:FBgn0040064 transcript:FBtr0079876)

HSP 1 Score: 218.009 bits (554), Expect = 1.538e-65
Identity = 132/392 (33.67%), Postives = 209/392 (53.32%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFS--GQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNEL--GVASICNGGGGASSIMIE 1277
            K +YI+   RT  G+F   L  +   QL     K  L+        +D V++G V    S  G    R   L  G+P       IN++C SG +S++ G Q I+     + + GG E+MS  PF     R   + G S  ++  ++ GLTD Y K  M + AEN A    ISR+  D+F++ S +  +   K G F  EI  + +K K +E+    DE    +   +    L   FK NG VTA  AS + DGA+++++ S +ALK+Y L P+A+++ F+   ++P    I P  +I+ +LK+  K  EDI + EINEAF+   LA    +K +   K+N++GGA+++GHP+G SG+R+  HL + L++ +L  G+ S C GGG   ++++E
Sbjct:    6 KGIYIVAAKRTAFGTFGGSLKGINQTQLQTTAAKAALDAAGLKGEQVDTVIVGNVIASSSTDGIYVPRHVGLNCGVPIEKPALGINRLCGSGFQSIVNGAQDILVGGAKIALTGGVENMSQSPFIARNVRFGTTLGASYNLEDALWAGLTDTYCKLPMALTAENLADQYKISRERVDEFSLLSQKNWEKGQKEGAFNAEITPIKLKVKGKEVDFVVDEHPRPKTTIEGLNKLPSLFKKNGVVTAGTASGICDGASAVIVASEEALKEYNLKPLARLVAFSFVGVKPEIMGIGPVPAIQNVLKVSGKKLEDIDLIEINEAFAAQTLACADALK-LDTSKLNVNGGAIALGHPLGASGSRITGHLVHELQRKKLKYGIGSACIGGGQGIALLLE 396          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Match: Mtpbeta (gene:FBgn0025352 transcript:FBtr0072226)

HSP 1 Score: 161.77 bits (408), Expect = 8.636e-44
Identity = 126/427 (29.51%), Postives = 203/427 (47.54%), Query Frame = 3
Query:  111 NKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSY-----------GGSSLIDGIVFDGLT-------DVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMD-FPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVK---------GMH-----PD--KVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNE--LGVASICNGGGGASSIMIE 1277
             K  + + +++G RTP  +     + L   +L   ++   L +   +  +ID ++ G V Q       AR+AAL +G  +     T+   C S   ++  G   I  +  DV++AGG E MS+VP    R   S               +L+     D L        +  +   MG  A+  AS  N+SR  QD++A+ S+  ++ + + G F      V  K    + I+++D      + +    L+PAF K  GTVTAANAS L DGA++ +I++ +  K+  L P A +  F   +  P++   + PA  I KLLK      +DI  WEI+EAF+  ++ANLK +          G++     PD  K N  GG++S+GHP   +G RL +H A  L + +  LGV + C  GG   +++IE
Sbjct:   38 QKNSQNIVLVDGVRTPFLTSGTTYSKLMPHELARHSLLSLLQKNRLDKELIDYIVYGSVIQEVKTSNIAREAALAAGFSNKTPAHTVTMACISSNAAITTGMGLIATNTYDVIVAGGVEFMSDVPIRHSRKMRSLLLKANKAKTLGQRLALLSTFRPDFLAPELPAVAEFSSGETMGHSADRLASAFNVSRSEQDEYALRSHTLAKEAQEKGYFTD---LVPFKVSGVDQIVDKDNGIRVSSPESLAKLRPAFVKPYGTVTAANASFLTDGASACIIMTEEKAKQLGLKPKAYLRDFLFVSQDPVNQLLLGPAYGIPKLLKKAGLTLKDIDSWEIHEAFAGQIVANLKALDSDWFCKTYLGLNEKVGTPDLSKWNNWGGSLSIGHPFAATGVRLCMHTANRLVREDGKLGVVAACAAGGQGVAMLIE 461          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:445290])

HSP 1 Score: 445.277 bits (1144), Expect = 1.354e-153
Identity = 226/417 (54.20%), Postives = 296/417 (70.98%), Query Frame = 3
Query:   57 SRTFTNSRFLIIRNFS--------SINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            SR   ++R  + R+ +        S      EV I++  RTPIGSF+  L++L A +LG+I IK  +++       + EV MG V Q   GQAP RQA L +GLP S   TTINKVCASGMKS+M+  QS+MC   DV++AGG ESMS VP+   R  P YGG  + D IV DGLTDVYNK HMG CAENTA   +ISR+ QD FAI SY  S+++ ++GI  KE+V VSI  + K ++++ EDEEY +V+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA ++  +TP+AKI+ FADAA+ P+DFPIAPA ++ K+LK      EDIAMWEINEAFSVVVLAN+K++  + PD+VNI+GGAVS+GHPIGMSGAR++ H+ +NLK  + G+A ICNGGGGASSI+I+
Sbjct:    3 SRALYSTRSQLCRHLAHKYLSRSYSTRPSLNEVVIVSAVRTPIGSFKGSLSTLPATKLGSIAIKGAIDKAGIPVEEVKEVYMGNVLQAGEGQAPTRQALLGAGLPLSTPATTINKVCASGMKSIMLASQSLMCGHQDVMVAGGMESMSQVPYIMAREAPPYGGVKMEDLIVKDGLTDVYNKFHMGNCAENTAKNSSISREEQDAFAIKSYTLSKAAWESGILAKEVVPVSIPQRGKPDVVVKEDEEYRKVDFSKVPKLKAVFLKENGTVTAANASTLNDGAAALVLMTADAAQRLNVTPLAKIVAFADAAVAPIDFPIAPAFAVPKVLKAAGIKKEDIAMWEINEAFSVVVLANIKMLD-IDPDRVNINGGAVSLGHPIGMSGARIVGHMVHNLKSGQYGLAGICNGGGGASSIVIQ 418          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Match: acat2 (acetyl-CoA acetyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-990714-22])

HSP 1 Score: 291.967 bits (746), Expect = 6.004e-94
Identity = 161/393 (40.97%), Postives = 241/393 (61.32%), Query Frame = 3
Query:  129 VYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP-RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYAR--VNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAF---SVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            + I++  RTPIG+F   L+S+   +LG + IK+ L RV      + EV+MG V     GQ PARQA++ +G+P SV   +   +C SG+KSV +G QSIM   + +V+AGG ESMS  P     R+    G ++L D I+ DGLTD +   HMGI AEN A    +SR+AQDQ A++S  +++++ K G F KEIV V++ ++K  + +  D E+ R   N D    LKP F    +GTVTA NAS +NDGAA+ +++S    ++  L PMA+I  +A A L P      P  +IRK ++      +++ ++EINEAF   S+ V+ +L    G++PDKVN+ GGA+S+GHP+GMSG R+++ L + L++     GVAS+C GGG   ++ +E
Sbjct:    6 IVIVSAARTPIGAFNGTLSSVPLHELGTLVIKDVLKRVNVKPEEVSEVIMGHVLTAGHGQNPARQASVGAGVPYSVPAWSCQMICGSGLKSVCLGAQSIMTKESTIVVAGGMESMSRAPHIVQMRSGVKMGDATLQDTILTDGLTDAFYNYHMGITAENVAKQWGVSREAQDQLAVTSQNRTEAAQKAGYFDKEIVPVTVPSRKGPVEVKVD-EFPRHGSNIDAMSKLKPCFVKDGSGTVTAGNASGINDGAAATVLMSQSEAQRRGLKPMARITSWAQAGLDPSVMGTGPIPAIRKAIEKARWKLDEVDLFEINEAFASQSIAVVQDL----GLNPDKVNVCGGAISLGHPLGMSGCRVLVTLLHALQRTGGRKGVASLCIGGGMGIAMCVE 393          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Match: acaa2 (acetyl-CoA acyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1996])

HSP 1 Score: 226.098 bits (575), Expect = 1.567e-68
Identity = 135/392 (34.44%), Postives = 221/392 (56.38%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAP--ARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            + V+I++  RTP G++   L   +A  L     K  L        +++ V++G V Q  S  AP  AR   L  G+P  V   T+N++C SG +S++ G Q I    ++VV+ GG ESMS  P+     R    +G    ++  ++ GLTD+  K  MGI AEN A    ISR+  DQ++  + Q+ +++ + G F  EI  + +K KK ++ +  DE    +   ++   L   FK  GTVTAANAS ++DGAA+++I S DA+K ++LTP+A+I+ +  +   P    I P  +I + LK    + +D+ + E+NEAF+   L+  K + G+ P+K N++GGA+++GHP+G SG R+  HL + L++   +  V S C GGG   ++++E
Sbjct:    5 RGVFIVSAKRTPFGTYGGVLKDHSATDLAEHAAKAALAAGNVAPELVNSVIIGNVMQS-SADAPYIARHVGLRCGVPIPVPALTVNRLCGSGFQSIINGAQEICLKESEVVLCGGSESMSQAPYAVRNIRFGTKFGVDLKLEDTLWAGLTDLNIKLPMGITAENLAEKYQISREECDQYSHQTQQRWKAAHEAGYFNAEIAPIEVKAKKGKVSMTFDEHPRPQTTLEQMAKLPTVFKKGGTVTAANASGVSDGAAAVIIASEDAVKAHKLTPLARIVSYHTSGCDPSIMGIGPVPAITEALKKAGLSIKDMDLVEVNEAFAPQYLSVAKSL-GLDPEKTNVNGGAIAIGHPLGASGTRITAHLVHELRRRGGKYAVGSACIGGGQGIAVILE 394          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040704-48])

HSP 1 Score: 185.652 bits (470), Expect = 4.348e-53
Identity = 136/420 (32.38%), Postives = 215/420 (51.19%), Query Frame = 3
Query:   54 LSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAP-QLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKC--HMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIK----NKKEELIINEDEEYAR--VNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNE---LGVASICNGGGGASSIMIE 1277
            LS   T++R + +R  S+      ++ +++G RT IG  ++G    T P +L +  +   +  V     ++ +V +G V Q  +G   AR A  FSG P SV   T+N+ C+SG++++      I     D+ +A G ESMS      P   P      L+D        +    C   MGI +EN A    I+R+ QD+FA+SS QK+  + K GIF +EI  V+ K    N  E  I    ++  R     +    L+PAFK  G+ TA NAS ++DGAA++LI    A++K  L     +   A   + P    I PA +I + LK+     +DI ++EINEAF+   +  ++ + G+  +KVN +GGA++ GHP+G +GAR ++ L   LK+      GV S+C G G  ++ + E
Sbjct:    7 LSGHLTSNRRMGLRQCSATAANPNDIVVVHGLRTAIGRAKRGSFKDTTPDELLSAVMSAVIKDVGLKPSLLGDVCVGNVLQPGAGALMARVAHFFSGFPESVPVYTVNRQCSSGLQALFNIAGGIRGGSYDLGLACGVESMS---LRSP-NNPGDISPRLMD-------NEKARDCIIPMGITSENVAERFGITREKQDRFALSSQQKAAMAQKNGIFDQEITPVTTKFVEENGTERTITVTKDDGIRPGTTLEGLAKLRPAFKDTGSTTAGNASQVSDGAAAVLIGRRSAVEKLGLPVFGVLRASAVVGVPPDVMGIGPAYAIPEALKLAGLTVDDIDVFEINEAFASQAVYCVEKL-GIPMEKVNPNGGAIAFGHPLGCTGARQVVTLLNELKRRRKRGFGVVSMCIGTGMGAAAVFE 414          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Match: CABZ01065076.1 (3-ketoacyl-CoA thiolase, mitochondrial-like [Source:NCBI gene;Acc:103910030])

HSP 1 Score: 164.081 bits (414), Expect = 5.946e-47
Identity = 86/238 (36.13%), Postives = 144/238 (60.50%), Query Frame = 3
Query:  582 MGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIEGCR 1286
            MGI AEN A    ISR+  DQ++  + Q+ +++ + G F  EI  + +K KK ++ +  DE    +   ++   L   FK  GTVTAANAS ++DGAA+++I S DA+K ++LTP+A+I+ +  +   P    I P  +I + LK    + +D+ + E+NEAF+   L+  K + G+ P+K N++GGA+++GHP+G SG R+  HL + L++   +  V S C GGG   ++++E  +
Sbjct:    1 MGITAENLAEKYQISREECDQYSHQTQQRWKAAHEAGYFSAEIAPIEVKAKKGKVSMTFDEHPRPQTTLEQMAKLPTVFKKGGTVTAANASGVSDGAAAVIIASEDAVKAHKLTPLARIVSYHTSGCDPSIMGIGPVPAITEALKKAGLSIKDMDLVEVNEAFAPQYLSVAKSL-GLDPEKTNVNGGAIAIGHPLGASGTRITAHLVHELRRRGGKYAVGSACIGGGQGIAVILENIK 237          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:594960])

HSP 1 Score: 439.499 bits (1129), Expect = 2.042e-151
Identity = 220/387 (56.85%), Postives = 284/387 (73.39%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   15 QEVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 400          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:594960])

HSP 1 Score: 439.884 bits (1130), Expect = 2.133e-151
Identity = 221/388 (56.96%), Postives = 284/388 (73.20%), Query Frame = 3
Query:  120 GKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            G EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   27 GLEVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 413          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:594960])

HSP 1 Score: 439.499 bits (1129), Expect = 2.139e-151
Identity = 220/387 (56.85%), Postives = 284/387 (73.39%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   23 QEVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 408          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:594960])

HSP 1 Score: 438.728 bits (1127), Expect = 4.868e-151
Identity = 220/387 (56.85%), Postives = 284/387 (73.39%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   20 QEVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 405          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:594960])

HSP 1 Score: 438.343 bits (1126), Expect = 8.114e-151
Identity = 220/386 (56.99%), Postives = 283/386 (73.32%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   27 EVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 411          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Match: Acat1 (acetyl-Coenzyme A acetyltransferase 1 [Source:MGI Symbol;Acc:MGI:87870])

HSP 1 Score: 421.779 bits (1083), Expect = 2.412e-144
Identity = 215/386 (55.70%), Postives = 279/386 (72.28%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            EV I++  RTPIGSF   L S  A +LG   I+  + +       + EV MG V QG  GQAP RQA L +GLP S  CTT+NKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  +NISR  QD +A+SSY +S+ +   G F  EI  ++I  K K ++++ EDEEY RV+F K   LK  F K NGT+TAANAS+LNDGAA+L++++ +A ++  + P+A+I  FADAA+ P+DFP+APA ++ K+LK      EDIAMWE+NEAFSVVVLAN+K+++ + P KVNIHGGAVS+GHPIGMSGAR+++H+A+ LK  E G+ASICNGGGGAS+++IE
Sbjct:   38 EVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFASEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANASTLNDGAAALVLMTAEAAQRLNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLANIKMLE-IDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALKPGEFGLASICNGGGGASALLIE 422          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Match: Acat3 (acetyl-Coenzyme A acetyltransferase 3 [Source:MGI Symbol;Acc:MGI:109182])

HSP 1 Score: 260.381 bits (664), Expect = 9.599e-82
Identity = 143/389 (36.76%), Postives = 230/389 (59.13%), Query Frame = 3
Query:  108 INKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVP-FYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK--EELIINEDEEYARVNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKK--NELGVASICNGGG 1253
            +N     V I++  RT IGSF   L+++   ++G   IKE L R       + EV+ G V     GQ P RQA++ +G+P SV   +   +C SG+K+V +  QSI    + +V+AGG E+MS  P     RT    G   L D I+ DGLTD ++  HMGI AEN A    +SR+AQD+ A+ S  +++ + K G F KEIV V + ++K   E+ I+E   +   N +    LKP F     GTVT ANA+ +NDGAA+++++     ++  L P+A+I+ ++ A ++P    + P  +I++ +     + ED+ ++EINEA++ + +A  K + G++P+KVNI+GGA+++GHP+G SG R+++ L + L++     GVA++C GGG
Sbjct:    1 MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGS-NLEAMGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSVAIAKEL-GLNPEKVNINGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGG 387          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Match: Acat3 (acetyl-Coenzyme A acetyltransferase 3 [Source:MGI Symbol;Acc:MGI:109182])

HSP 1 Score: 260.381 bits (664), Expect = 9.599e-82
Identity = 143/389 (36.76%), Postives = 230/389 (59.13%), Query Frame = 3
Query:  108 INKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVP-FYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK--EELIINEDEEYARVNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKK--NELGVASICNGGG 1253
            +N     V I++  RT IGSF   L+++   ++G   IKE L R       + EV+ G V     GQ P RQA++ +G+P SV   +   +C SG+K+V +  QSI    + +V+AGG E+MS  P     RT    G   L D I+ DGLTD ++  HMGI AEN A    +SR+AQD+ A+ S  +++ + K G F KEIV V + ++K   E+ I+E   +   N +    LKP F     GTVT ANA+ +NDGAA+++++     ++  L P+A+I+ ++ A ++P    + P  +I++ +     + ED+ ++EINEA++ + +A  K + G++P+KVNI+GGA+++GHP+G SG R+++ L + L++     GVA++C GGG
Sbjct:    1 MNTRSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRVGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGS-NLEAMGKLKPYFLTDGTGTVTTANATGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAYAALSVAIAKEL-GLNPEKVNINGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGG 387          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Match: Acat2 (acetyl-Coenzyme A acetyltransferase 2 [Source:MGI Symbol;Acc:MGI:87871])

HSP 1 Score: 257.299 bits (656), Expect = 1.565e-80
Identity = 147/389 (37.79%), Postives = 229/389 (58.87%), Query Frame = 3
Query:  108 INKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVP-FYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK--EELIINEDEEYARVNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKK--NELGVASICNGGG 1253
            +N G   V I++  RT IGSF   L+++   ++G   IKE L R       + EV+ G V     GQ P RQA++ +G+P SV   +   +C SG+K+V +  QSI    + +V+AGG E+MS  P     RT    G   L D I+ DGLTD ++  HMGI AEN A    +SR+AQD+ A+ S  +++ + K G F KEIV V + ++K   E+ I+E   +   N +    LKP F     GTVT ANAS +NDGAA+++++     ++  L P+A+I+ ++ A ++P    + P  +I++ +     + ED+ ++EINEAF+ V  A  K + G++P+KVNI GGA+++GHP+G SG R+++ L + L++     GVA++C GGG
Sbjct:    1 MNAGSDPVVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRMGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGS-NLEAMGKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAFAAVSAAIAKEL-GLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGG 387          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Match: Acat2 (acetyl-Coenzyme A acetyltransferase 2 [Source:MGI Symbol;Acc:MGI:87871])

HSP 1 Score: 236.884 bits (603), Expect = 4.810e-73
Identity = 136/357 (38.10%), Postives = 211/357 (59.10%), Query Frame = 3
Query:  204 LGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVP-FYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK--EELIINEDEEYARVNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKK--NELGVASICNGGG 1253
            +G   IKE L R       + EV+ G V     GQ P RQA++ +G+P SV   +   +C SG+K+V +  QSI    + +V+AGG E+MS  P     RT    G   L D I+ DGLTD ++  HMGI AEN A    +SR+AQD+ A+ S  +++ + K G F KEIV V + ++K   E+ I+E   +   N +    LKP F     GTVT ANAS +NDGAA+++++     ++  L P+A+I+ ++ A ++P    + P  +I++ +     + ED+ ++EINEAF+ V  A  K + G++P+KVNI GGA+++GHP+G SG R+++ L + L++     GVA++C GGG
Sbjct:    1 MGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRMGEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEIVPVLVSSRKGLTEVKIDEFPRHGS-NLEAMGKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKTEAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAFAAVSAAIAKEL-GLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGG 355          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6AZA0|THIL_DANRE (Acetyl-CoA acetyltransferase, mitochondrial OS=Danio rerio OX=7955 GN=acat1 PE=2 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 1.022e-152
Identity = 226/417 (54.20%), Postives = 296/417 (70.98%), Query Frame = 3
Query:   57 SRTFTNSRFLIIRNFS--------SINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            SR   ++R  + R+ +        S      EV I++  RTPIGSF+  L++L A +LG+I IK  +++       + EV MG V Q   GQAP RQA L +GLP S   TTINKVCASGMKS+M+  QS+MC   DV++AGG ESMS VP+   R  P YGG  + D IV DGLTDVYNK HMG CAENTA   +ISR+ QD FAI SY  S+++ ++GI  KE+V VSI  + K ++++ EDEEY +V+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA ++  +TP+AKI+ FADAA+ P+DFPIAPA ++ K+LK      EDIAMWEINEAFSVVVLAN+K++  + PD+VNI+GGAVS+GHPIGMSGAR++ H+ +NLK  + G+A ICNGGGGASSI+I+
Sbjct:    3 SRALYSTRSQLCRHLAHKYLSRSYSTRPSLNEVVIVSAVRTPIGSFKGSLSTLPATKLGSIAIKGAIDKAGIPVEEVKEVYMGNVLQAGEGQAPTRQALLGAGLPLSTPATTINKVCASGMKSIMLASQSLMCGHQDVMVAGGMESMSQVPYIMAREAPPYGGVKMEDLIVKDGLTDVYNKFHMGNCAENTAKNSSISREEQDAFAIKSYTLSKAAWESGILAKEVVPVSIPQRGKPDVVVKEDEEYRKVDFSKVPKLKAVFLKENGTVTAANASTLNDGAAALVLMTADAAQRLNVTPLAKIVAFADAAVAPIDFPIAPAFAVPKVLKAAGIKKEDIAMWEINEAFSVVVLANIKMLD-IDPDRVNINGGAVSLGHPIGMSGARIVGHMVHNLKSGQYGLAGICNGGGGASSIVIQ 418          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6NU46|THILA_XENLA (Acetyl-CoA acetyltransferase A, mitochondrial OS=Xenopus laevis OX=8355 GN=acat1-a PE=2 SV=1)

HSP 1 Score: 442.965 bits (1138), Expect = 8.538e-152
Identity = 225/397 (56.68%), Postives = 287/397 (72.29%), Query Frame = 3
Query:   93 RNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            RNF+S  +   EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKSVM+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA   +ISR+ QD FAI SY +S+++  +G+   EI  V+I  K K ++I+ EDEEY RV+F KF  LK  F K NGTVTAAN+S+LNDGAA+LL+++ +A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++ G+ P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   24 RNFAS-QRTLNEVVIASAARTPIGSFQGTLSSLPATKLGSIAIKAAVERAGIPADEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSVMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKFSISREEQDSFAIHSYTRSKAAWDSGLIANEIAPVTIAQKGKPDIIVQEDEEYKRVDFSKFPKLKTVFQKDNGTVTAANSSTLNDGAAALLLMTTEAANRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANIKML-GIDPARVNMNGGAVSLGHPIGMSGARIVGHMAHALKKGQFGIAGICNGGGGASAVLIE 418          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q5BKN8|THIL_XENTR (Acetyl-CoA acetyltransferase, mitochondrial OS=Xenopus tropicalis OX=8364 GN=acat1 PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 5.116e-150
Identity = 220/386 (56.99%), Postives = 283/386 (73.32%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKS+M+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EIV+V+I  K + ++I+ EDEEY RV+F KF  LK  F K NGTVTAANAS+LNDGAA+L++++  A  +  +TP+A+I+ FADAA+ P+DFPIAPA ++ KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ LKK + G+A ICNGGGGAS+++IE
Sbjct:   34 EVVIASAARTPIGSFQGSLSSLPATKLGSIAIKAAVERAGIPGDEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSIMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDSFAINSYTRSKAAWDSGLIANEIVSVTISQKGRPDIIVQEDEEYKRVDFSKFSKLKTVFQKDNGTVTAANASTLNDGAAALVLMTAGAASRLNVTPLARIVAFADAAVDPIDFPIAPAYAVPKLLSEAGLKKEDIAMWEINEAFSVVVLANVKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHVLKKGQFGIAGICNGGGGASAVLIE 418          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|P24752|THIL_HUMAN (Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 8.254e-150
Identity = 215/387 (55.56%), Postives = 285/387 (73.64%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            KEV I++  RTPIGSF   L+ L A +LG+I I+  + +       + E  MG V QG  GQAP RQA L +GLP S  CTTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  LNI+R+ QD +AI+SY +S+++ + G F  E++ V++  K + ++++ EDEEY RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++ DA K+  +TP+A+I+ FADAA++P+DFPIAP  +   +LK      EDIAMWE+NEAFS+VVLAN+K+++ + P KVNI+GGAVS+GHPIGMSGAR++ HL + LK+ E G+ASICNGGGGAS+++I+
Sbjct:   40 KEVVIVSATRTPIGSFLGSLSLLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCTTINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADAAKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVVLANIKMLE-IDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGASAMLIQ 425          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q6GN02|THILB_XENLA (Acetyl-CoA acetyltransferase B, mitochondrial OS=Xenopus laevis OX=8355 GN=acat1-b PE=2 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 1.848e-149
Identity = 227/413 (54.96%), Postives = 295/413 (71.43%), Query Frame = 3
Query:   51 TLSRTFTNSRFL--IIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            T +R   ++R L    R+F+S  +   EV I +  RTPIGSF+  L+SL A +LG+I IK  + R       + EV MG V Q   GQAP+RQA L +GL  S   TTINKVCASGMKSVM+  QS+MC    V++AGG ESMSNVP+   R    YGG  L D IV DGLTDVYNK HMG CAENTA  L+ISR+ QD FAI+SY +S+++  +G+   EI  V+I  K K ++I+ EDEEY RV+F KF  LK  F K NGTVTAAN+S+LNDGAA+L++++ +A  +  +TP+A+I+ FADAA+ P+DFPIAPA +I KLL       EDIAMWEINEAFSVVVLAN+K++  + P +VN++GGAVS+GHPIGMSGAR++ H+A+ L+K + G+A ICNGGGGAS+++IE
Sbjct:    8 TAARLSHSTRALHYTHRSFAS-PRTLNEVVIASAARTPIGSFQGTLSSLPATKLGSIAIKAAVERAGIPADEVKEVYMGNVLQAGQGQAPSRQATLGAGLAISTPTTTINKVCASGMKSVMLAAQSLMCGHQQVMVAGGMESMSNVPYCMSRGATPYGGVKLEDIIVKDGLTDVYNKFHMGNCAENTAKKLSISREEQDGFAITSYTRSKAAWDSGLIANEIAPVTIAQKGKPDIIVQEDEEYKRVDFSKFPKLKTVFQKDNGTVTAANSSTLNDGAAALVLMTAEAANRLNVTPLARIVAFADAAVDPIDFPIAPAYAIPKLLSEAGLKKEDIAMWEINEAFSVVVLANIKMLD-IDPARVNVNGGAVSLGHPIGMSGARIVGHMAHALRKGQFGIAGICNGGGGASAVLIE 418          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Match: A0A0A9YVD6 (Acetyl-CoA acetyltransferase A, mitochondrial OS=Lygus hesperus OX=30085 GN=acat1-a PE=3 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 4.785e-171
Identity = 245/399 (61.40%), Postives = 302/399 (75.69%), Query Frame = 3
Query:   90 IRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK--KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +RN+SS  K   EV+I++G RTP+GSFR  L SL+AP+LGA  I+E + R   +  ++DEV MG VCQG  GQAPARQA +F+GL  +  CTT+NKVCASGMKSVM+G QS+M     V++AGG ESMSN PFY  R +  YGG  L D I++DGLTDVYNKCHMG CAENTA    ISR+ QD FAI+SY+KS  + K G+FK EIV V +  K  KE+LI+ EDEEY +VNFDKF  L   F K  GTVTA NAS+LNDG A+++++S  ALK+ + TP+A+I+GFAD   +P+DFPIAPA +I KLLK      ED+A+WEINEAFSVVVLAN+K++ G+ P KVN+HGGAVS+GHPIGMSGARLILHL Y LK  + GVASICNGGGGASS+MIE
Sbjct:   16 LRNYSS--KVVDEVFIVSGARTPMGSFRSSLASLSAPRLGAAAIQEAVKRANIDKGLVDEVYMGNVCQGGVGQAPARQATIFAGLSENTVCTTVNKVCASGMKSVMLGAQSLMLGHQRVIVAGGMESMSNSPFYMMRGDSPYGGIKLHDAIIYDGLTDVYNKCHMGNCAENTAKVQKISREEQDNFAIASYKKSAEAVKAGLFKDEIVPVRVPQKRGKEDLIVEEDEEYKKVNFDKFSKLSTVFQKEGGTVTAGNASTLNDGGAAMVLMSGQALKEAKATPIARIVGFADGETKPIDFPIAPAFAIPKLLKQTGVKTEDVALWEINEAFSVVVLANIKML-GLDPSKVNVHGGAVSLGHPIGMSGARLILHLCYALKAGQKGVASICNGGGGASSVMIE 411          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Match: A0A2R7VSH8 (Acetyl-CoA acetyltransferase OS=Oncopeltus fasciatus OX=7536 GN=OFAS_OFAS001173 PE=3 SV=1)

HSP 1 Score: 492.656 bits (1267), Expect = 5.710e-169
Identity = 240/415 (57.83%), Postives = 308/415 (74.22%), Query Frame = 3
Query:   48 MTLSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK--KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIEGC 1283
            M L+   T   FL  R++SS      +V+I++G RTP+GSFR  L+SL AP+LGA+ I+  + R   +   +DEV MG VCQG  GQAPARQAALF+GLP S+ CTTINKVCASGMKS+M   QS+      V IAGG ESMSN P+Y  R E  YGG +L D I++DGLTDVYNKCHMG CAENTA   NISR+AQD+FA+ SY++S  + K G+   EIV VS+  K  K +L++NEDEEY RVN +KFK L   F +  GTVTA NAS+LNDGAA+L++++ DA+K++ + P+A+I+ FAD A +P+DFPIAPA ++ KLLK      EDI +WEINEAFSVVVLAN+K++  + P KVN+HGGAVS+GHPIGMSGAR++LHLAY LK  + G+ASICNGGGGAS++++E C
Sbjct:    1 MKLNFLKTIPVFLQSRSYSS----PADVFIVSGARTPMGSFRSSLSSLPAPRLGAVAIQGAIERAGISKETVDEVFMGNVCQGGVGQAPARQAALFAGLPESIICTTINKVCASGMKSIMFASQSLQLGHQQVAIAGGMESMSNAPYYMFRGESPYGGVTLHDAILYDGLTDVYNKCHMGNCAENTAKVQNISREAQDEFALQSYRRSAEAVKAGLLSPEIVPVSVPQKKGKPDLVVNEDEEYKRVNIEKFKKLATVFQREGGTVTAGNASTLNDGAAALVLMNEDAVKRHGVKPLARIVAFADGATKPIDFPIAPAFAVPKLLKASGLKKEDIDLWEINEAFSVVVLANMKLLD-IDPQKVNVHGGAVSLGHPIGMSGARIVLHLAYALKPGQKGIASICNGGGGASAVLVEKC 410          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Match: A0A0V0G3Z1 (Putative 3-oxoacyl coa thiolase OS=Triatoma dimidiata OX=72491 PE=3 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 1.375e-163
Identity = 237/399 (59.40%), Postives = 301/399 (75.44%), Query Frame = 3
Query:   93 RNFS-SINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK--KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            R FS S+N    EV+I++G RTP+GSFR  L +L+A +LG++ I+  + +       +DE+ MG VCQG +GQAPARQAALF+GL   V CTT+NKVCASGMKSVM+  Q +MC    V+IAGG ESMSNVP+Y  R +  YGG SL DGI+ DGLTDVYNK HMG CAENTA  L ISRD QD FA+ SY+KS  ++K+G+FK EIV VS+  K  K ++++  DEE+ RVNF+KF  L   F K  GTVTA NAS+LNDGAA+L+++S +A+K + + P+A+++ FAD A +P+DFPIAPA ++ KLLK      EDIA+WEINEAFSVVVLAN+K++  + P+KVNIHGGAVS+GHPIGMSGAR++LHL   LK  E GVASICNGGGGASS+MIE
Sbjct:   16 RKFSTSLN----EVFIVSGARTPMGSFRSSLAALSATKLGSVAIQGAIEKSGIKKDDVDEIFMGNVCQGGAGQAPARQAALFAGLKEGVICTTVNKVCASGMKSVMLASQVLMCGHQKVIIAGGMESMSNVPYYMFRGDSPYGGVSLHDGILLDGLTDVYNKFHMGNCAENTAKQLKISRDDQDNFAVQSYKKSSDASKSGVFKDEIVPVSVPQKKGKPDVVVAVDEEFTRVNFEKFNKLSTVFQKDGGTVTAGNASTLNDGAAALILMSGEAVKSFGVKPLARVVAFADGATKPIDFPIAPAVAVPKLLKDSGVKKEDIALWEINEAFSVVVLANIKLMD-LDPNKVNIHGGAVSLGHPIGMSGARIVLHLVTALKPGEKGVASICNGGGGASSVMIE 409          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Match: A0A1S3HB28 (acetyl-CoA acetyltransferase, mitochondrial OS=Lingula unguis OX=7574 GN=LOC106153726 PE=3 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 1.488e-163
Identity = 229/396 (57.83%), Postives = 302/396 (76.26%), Query Frame = 3
Query:   93 RNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK-EELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            R+ S +  G  EV I+N  RTPIGSFR  L ++ A +LG++ I+  L++       + EV MG VCQ  +GQAPARQAAL +G+P++V C T+NKVCASGMK+VM+  QS+MC   DV++AGG ESMSNVP+Y  R E  YGG +L DGIV DGL DVYN+ HMG CAENTA    I+R+ QD FA+ SY +SQ +A++G++KKEIV V+I  KK +++++ EDEEY +VNF+KFK+L+ AF+ +GTVTAANAS+LNDGAA+LL+++  A  K  +TP+A+IIGFADAA  P+DF IAP  +++K+L + +   EDIAM+EINEAFSVV LAN+K++  + P KVNIHGGAVS+GHPIGMSGAR+  HL +NLK  E G+A ICNGGGGAS+I+IE
Sbjct:   22 RHLSQLT-GLNEVVIVNAARTPIGSFRSSLAAVPATKLGSVAIQGALHKAGVAPDAVQEVYMGNVCQASNGQAPARQAALGAGIPNTVPCCTVNKVCASGMKAVMMAAQSLMCGSQDVMVAGGMESMSNVPYYLKRGETPYGGVTLTDGIVLDGLWDVYNQIHMGSCAENTAKVQGITREEQDAFAVESYTRSQRAAESGVYKKEIVPVTIPQKKGDDIVVTEDEEYMKVNFEKFKTLRTAFQKDGTVTAANASTLNDGAAALLLMTEKAAAKLNVTPLARIIGFADAATAPIDFTIAPVSAMQKVLSMTSVTKEDIAMFEINEAFSVVALANIKLLD-LDPSKVNIHGGAVSIGHPIGMSGARITGHLVHNLKAGEKGLAGICNGGGGASAILIE 415          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Match: A0A1B6E2E7 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.19017 PE=3 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 3.559e-163
Identity = 236/387 (60.98%), Postives = 295/387 (76.23%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK--KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +VYI++G RTP+GSF   L+ L+A +LGAI I+  L R A +   + EV MG VCQG  GQAPARQAA+F+GLP S  C+TINKVCASGMK++ +G Q++MC   DV+IAGG ESMSNVPFY  R E SYGG +L+DGIVFDGLTDVYNK HMG CAENTA  + ISR  QDQFAI+SY+KS  +  +G    E+V+VS+  K  K ++I+ EDEE+ RVNF+KF  L   F K  GTVTA NAS+LNDGAA+ L+++ +A+K+   TP+A+I+GF DAA  P+DFPIAPA ++ KLL+      EDIA+WEINEAFSVVVLAN+K +  + PD VN+HGGAVS+GHPIGMSGAR+++HL Y LK  E G ASICNGGGGASSI+IE
Sbjct:   25 DVYIVSGARTPMGSFLGSLSPLSATKLGAIAIQAVLERAAVSKDEVKEVYMGNVCQGNVGQAPARQAAIFAGLPKSTECSTINKVCASGMKAIQLGAQNLMCGHQDVMIAGGMESMSNVPFYMKRGETSYGGVNLVDGIVFDGLTDVYNKIHMGNCAENTAKNMKISRQEQDQFAINSYKKSALAYNSGAISTELVSVSVPQKKGKPDVIVTEDEEFKRVNFEKFTKLPTVFQKDGGTVTAGNASTLNDGAAACLLMTGEAVKRLNCTPVARILGFHDAATDPIDFPIAPAFAVPKLLEKTGVRKEDIALWEINEAFSVVVLANIKKLD-IDPDLVNVHGGAVSLGHPIGMSGARIVVHLLYALKPGEKGCASICNGGGGASSILIE 410          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:103040735])

HSP 1 Score: 440.269 bits (1131), Expect = 1.119e-151
Identity = 223/410 (54.39%), Postives = 297/410 (72.44%), Query Frame = 3
Query:   54 LSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            L R  T+ +FL  R+F+S      EV I++  RTPIGSFR  L S+ A +LG+I IK  + +       + EV MG V Q   GQAP RQA L +GLP S   TTINKVCASGMKSVM+  QS+MC   DV++AGG ESMS VP+   R  P YGG  + D IV DGLTDVYNK HMG CAENTA   +ISR+ QD +AI+SY +S+++ ++GI  KE++ VSI  + K ++++ EDEE+ +V+F K   LK  F + NGTVTAANAS+LNDGAA++++++ DA K+  + P+A+I+ FADAA+ P+DFPIAPA ++ K+L+      +DIAMWEINEAFSVVVLAN+K++  + P KVN++GGAVS+GHPIGMSGAR++ H+A+NLK  + G+A ICNGGGGASSI+I+
Sbjct:   11 LGRQLTH-KFLC-RSFAS-RPSLNEVVIVSAVRTPIGSFRGSLASVPATKLGSIAIKGAVEQAGIPLEEVKEVYMGNVLQAGEGQAPTRQALLGAGLPLSTPATTINKVCASGMKSVMLASQSLMCGHQDVMVAGGMESMSQVPYVMSREAPPYGGVKMEDLIVKDGLTDVYNKFHMGNCAENTAKNSSISREEQDAYAINSYTRSKAAWESGILAKEVIPVSIPQRGKPDIVVKEDEEWRKVDFSKVPKLKAVFQRENGTVTAANASTLNDGAAAVILMTADAAKRLNVKPLARIVAFADAAVAPIDFPIAPAYAVPKVLEAAGVKKDDIAMWEINEAFSVVVLANIKMLD-IDPSKVNVNGGAVSLGHPIGMSGARIVGHMAHNLKSGQYGLAGICNGGGGASSIIIQ 416          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Match: acat2 (acetyl-CoA acetyltransferase 2 [Source:NCBI gene;Acc:103038320])

HSP 1 Score: 295.049 bits (754), Expect = 2.638e-95
Identity = 160/392 (40.82%), Postives = 243/392 (61.99%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP-RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYAR--VNFDKFKSLKPAF--KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            + V I++  RTPIGSF   L+++    LGA+ IK+ L R +     + EV+MG V     GQ P RQA++ +G+P  V   +   VC SG+K+V +G QSIM   ++VV+AGG ESMS  P     R     G +SL D IV DGLTD ++ CHMGI AEN A    +SR+AQDQ+A++S  +++++ K G F +EIV+V + ++K  + +  D E+ R   N D    LKP F    +G+VTA NAS +NDGAA+ +++S    ++  L PMAKI+ +A   L P      P  +IRK  +       ++ ++EINEAF+   +A ++ + G++PDKVNI+GGA+S+GHP+GMSG R+++ L + L++   + GVA++C GGG   ++ +E
Sbjct:    4 EPVVIVSAARTPIGSFNGALSTVPLNDLGAVVIKDVLKRASIKPEEVSEVIMGHVLTAGHGQNPTRQASVEAGIPYPVPAWSCQMVCGSGLKAVCLGAQSIMMGESNVVVAGGMESMSRAPHTVQMRAGVKMGDASLQDSIVADGLTDAFHNCHMGITAENVAKQWTVSREAQDQYAVTSQNRTEAAQKAGHFNQEIVSVIVPSRKGPVEVKVD-EFPRHGSNIDAMSKLKPCFVKDGSGSVTAGNASGINDGAAATVLMSQSEAQRRGLRPMAKIVSWAQTGLDPSIMGTGPISAIRKATEKAGWQLAEVDLYEINEAFAAQCVAVVQDL-GLNPDKVNINGGAISLGHPLGMSGCRVLVTLLHALQRTGGKKGVAALCIGGGMGIAMCVE 393          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Match: acaa2 (acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc:103039096])

HSP 1 Score: 221.861 bits (564), Expect = 4.870e-67
Identity = 130/379 (34.30%), Postives = 208/379 (54.88%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAP-ARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASIC 1241
            + V+I++  RTP G++   L   TA  L     K  L        ++D V++G V Q  +  A  AR   L  G+P      T+N++C SG +S++ G   I    ++VV+ GG ESMS  P+     R     G    ++  ++ GLTD++ K  MG+ AEN A    ISR+  DQ+A  + Q+ +++ + G +  EI  + +K KK ++ +  DE    +   ++   L   FK  GTVTAANAS ++DGA +++I S DALK+++LTP+A+I+ +  +   P    I P  +I   LK    + +D+ + E+NEAF+   LA  K + G+ P K N++GGA+++GHP+G SG R+I HL + L++      V S C
Sbjct:    5 RGVFIVSAKRTPFGTYGGVLKDHTATDLAEHAAKAALAAGKVAPEIVDSVIVGNVMQSSADAAYIARHVGLRCGVPIPTPALTVNRLCGSGFQSIINGAHEICLKESEVVLCGGSESMSQAPYAARNIRFGTRLGLDLKLEDTLWAGLTDLHIKTPMGVTAENLAEKYQISREDCDQYAYQTQQRWKAAHEAGYYTAEIEPIEVKGKKGKVPMTHDEHPRPQTTLEQMAKLPSVFKKGGTVTAANASGVSDGAGAVVIASEDALKEHKLTPLARIVAYHASGCDPSIMGIGPVPAITAALKKAGLSLKDMDLVEVNEAFAPQYLAVAKAL-GLDPAKSNVNGGAIALGHPLGASGTRIIAHLVHELRRRGGRYAVGSAC 382          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:NCBI gene;Acc:103044652])

HSP 1 Score: 167.548 bits (423), Expect = 2.298e-46
Identity = 128/396 (32.32%), Postives = 202/396 (51.01%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAP-QLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKC--HMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIK----NKKEELIINEDEEYAR--VNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLK---KNELGVASICNGGGGASSIMIE 1277
            +V +++G RTPIG  ++G    T P +L +  +   L  +  +   + +  +G V Q   G   AR A   SG P +V   T+N+ C+SG++++      I     D+ +A G ESMS          P    S L+D        +    C   MGI +EN A    ISR+ QD FA SS QK+  + K G+F++EIV V+ K    N  E  I    ++  R     +    L+PAFK +G+ TA NAS ++DGAA++L+     ++   L  +  + G A   + P    I PA +I + LK      +D+ ++EINEAF+   +  ++ + G+   KVN +GGA+++GHP+G +GAR ++ L   LK   K   GV S+C G G  ++ + E
Sbjct:   33 DVVVVHGLRTPIGRAKRGSFKDTTPDELLSAAMSAVLKDLGLSPEKVGDTCVGNVLQPGGGALVARIAQFLSGFPETVPVHTVNRQCSSGLQALFNIAGGIRNGSFDLGLACGVESMS----LRSVGNPGDLSSRLMD-------VEKARDCIIPMGITSENVAERFGISREKQDSFAFSSQQKAAQAQKQGLFEQEIVPVTTKFVDENGTERTITVTKDDGIRPGTTMEGLAKLRPAFKEDGSTTAGNASQVSDGAAAVLVGRRSTVEALGLPVLGILRGSAVVGVPPDVMGIGPAYAIPEALKQAGLTVDDVDVFEINEAFASQAVYCVEKL-GIPLRKVNPNGGAIALGHPLGCTGARQVVTLLNELKRRRKRSYGVVSMCIGTGMGAAAVFE 416          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Match: hadhb (hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta [Source:NCBI gene;Acc:103046325])

HSP 1 Score: 154.066 bits (388), Expect = 5.812e-41
Identity = 122/425 (28.71%), Postives = 193/425 (45.41%), Query Frame = 3
Query:  117 GGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPR----------TEPSYGGS-SLIDGIVFDGLT-------DVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMD-FPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVK---------------GMHP-DKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            G K V ++ G RTP          L    L    ++  L+R       +D ++ G V Q       AR+AAL +G        T+   C S  +++      I     D V+AGG E MS+VP    R             + G   SL+  I    L+       +      MG  A+  A+   +SR  QD+FA+ S+  ++ +   G+   +IV   +  K    I+++D        ++   LKPAF K +GTVTAAN+S L DGA+++LI+S +        P A +  F   +  P D   + P  +  K+L+       DI ++E +EAF+  +LANLK ++               G  P DK N+ GG++S+GHP   +G RL+  +A+ LKK   + G+ + C  GG   +++IE
Sbjct:   47 GVKNVVLVEGVRTPFLQSGTTYADLMPHDLARAALQGLLHRTGLPKEAVDYIVYGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISSNQAMTTAVGLIAAGQCDAVVAGGVEFMSDVPIRHSRKMRKTMLSLNKAKTLGARLSLLGSIRLAHLSPELPAVAEFSTAETMGHSADRLAAAFGVSRQEQDEFALRSHTLAKKAQDEGLL-SDIVGFKVPGKD---IVSKDNGIRPSTMEQMAKLKPAFVKPHGTVTAANSSYLTDGASAVLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATPKVLERSGLTLADIDVFEFHEAFAGQILANLKAMESDWFAQNCMGRKAKVGAPPLDKFNMWGGSLSLGHPFAATGCRLVTTVAHRLKKEGGQYGLVAACAAGGQGHAMVIE 467          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:445290])

HSP 1 Score: 425.631 bits (1093), Expect = 7.357e-147
Identity = 217/387 (56.07%), Postives = 290/387 (74.94%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCS-INDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            EV I++   +P+GSFR  L+S++AP+LG+I I+  + +       + EV MG V QG  GQAPARQA + +GLP S   TTINKVCASGMK++M+  QS+MC    DV++AGG ESMSNVPF   R +P YG  SL D IV DGLTDVYNK HMG CAENTA    +SR+AQDQ+AISSYQ+SQ + ++G   KE+V V+I  K K +++++EDEE+ RV+F K   LK  F K NGTVTAANAS+LNDGAA+L++++  A K+  +TP+A++ GF DAA+ P+DFPIAPA ++ K L+      E+IAMWEINEAFSVVVLAN+K+++ + P +VNI+GGAV++GHPIGMSGAR++ H+ + LK  E G+A+ICNGGGGAS+++IE
Sbjct:   16 EVVIVSAVLSPVGSFRSSLSSISAPKLGSIAIQAAVQKSGIRPEDVQEVYMGNVLQGGEGQAPARQALIAAGLPISTPATTINKVCASGMKAIMMASQSLMCGHQQDVMVAGGMESMSNVPFIMRREDPPYGRVSLEDLIVHDGLTDVYNKIHMGNCAENTARKFGLSREAQDQYAISSYQRSQKAWESGKLLKEVVPVTITKKGKPDVVVSEDEEFRRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTAQAAKRLGVTPLARVAGFGDAAVDPIDFPIAPAYAVPKALEHGGIKKENIAMWEINEAFSVVVLANIKILE-IDPARVNINGGAVALGHPIGMSGARIVGHMVHALKAGEYGMAAICNGGGGASALLIE 401          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: acaa2 (acetyl-CoA acyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1996])

HSP 1 Score: 213.386 bits (542), Expect = 1.853e-64
Identity = 131/391 (33.50%), Postives = 218/391 (55.75%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAP-ARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            + V+++   RTP G++   L  L+A  L     +  L     +   ID V++G V Q  S  A  AR   L  G+P      T+N++C SG ++V+ G Q I     +VV+  G E+MS  P+     R     G    ++  +++GLTD + K  MGI AEN A    +SR+  D+ A+ S Q+  ++ + G FK+E+  + IK KK + ++++DE     V  ++   L   FK  G VTA NAS ++DGAA++LI S +A+KK +LTP+A+I+ +  +   P    I P  +I+  LK    + +D+ + +INEAF+   L+  + + G+ P+K N++GGA+++GHP+G SG R+  +L + L++   +  V S C GGG   +I+++
Sbjct:    5 RGVFVVAAKRTPFGAYGGSLKDLSATDLAEHASRAALAAAKLSPESIDSVIVGNVIQSSSDAAYLARHVGLRIGVPIPAPALTLNRLCGSGFQAVISGTQEICVRDAEVVLCSGTENMSQSPYAVRDIRFGTRLGMDLKMEDTLWNGLTDQHIKMPMGITAENLAEKYKLSREDCDRHALQSQQRWLAAHEGGHFKEEMAPIEIKVKKGKQMMDKDEHPRPTVTLEQLGKLPNVFKKGGAVTAGNASGVSDGAATVLIASEEAVKKLKLTPLARIVAYHVSGCDPNIMGIGPVSAIQGALKKAGLSIKDMDLVDINEAFAPQYLSCAREL-GLDPEKSNVNGGAIALGHPLGASGTRITANLVHELRRRGGKYAVGSACIGGGQGIAIVLQ 394          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: acaa1 (acetyl-CoA acyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040704-48])

HSP 1 Score: 164.851 bits (416), Expect = 6.031e-46
Identity = 113/394 (28.68%), Postives = 203/394 (51.52%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVAR-NDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVM-IGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVS----IKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLK---KNELGVASICNGGGGASSIMIE 1277
            ++ +++G RTP G  ++G+   T      I +   L +  +     + ++ +G V Q  +G   AR A   SG+P +V    +N+ C+SG+++ + I    I     D+ +A G E MS      P+         + D    D L        MG+ +EN A    I+R+ QD  A++S+QK+  + K G+F++EIV V+    + ++++ + + +DE      + +    L+P FK NGT TA N+S ++DGAA++L+    A ++  L  +  +  +A   + P    I PA +I   L       +D+ ++EINEAF+      +K + G+  +K+N +GGA+++GHP+G +G R I+ L + L+   +   GV S+C G G  ++ + E
Sbjct:   40 DIVVVHGVRTPFGRAKRGVFKDTMVDELLIAVMTGLLKATKLQPSQLGDICVGNVLQPGAGAVIARIAQFLSGIPETVPVYCVNRQCSSGLQAFINIAGSGIRNGSYDIGMACGVELMSRGSPGDPKNVGDVSSRMMDDDKARDCLIP------MGVTSENVAERYGITREVQDALAVASHQKAARATKLGLFQEEIVPVTTVVLLGDEEKTITVTQDEGIRPDTSMEGLARLRPVFKENGTTTAGNSSQVSDGAAAVLVARRRAARELGLPVLGVLRSYAVVGVPPDVMGIGPALAIPAALSQAGLTIDDVDVFEINEAFASQAAYCVKRL-GIPAEKLNPNGGAIALGHPLGCTGTRQIITLLHELRRRGRRAYGVVSMCIGTGMGAAAVFE 426          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Sea Lamprey
Match: hadhb (hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta [Source:ZFIN;Acc:ZDB-GENE-030131-8550])

HSP 1 Score: 125.561 bits (314), Expect = 1.444e-31
Identity = 111/420 (26.43%), Postives = 185/420 (44.05%), Query Frame = 3
Query:  117 GGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPR----TEPSYGGSSLIDGIVFDGLTDVYNKCH----------------MGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMD-FPIAPAESIRKLLKICNKNAEDIAMWEINE-AFSVVVLANLKVVK---------------GMHP-DKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGG 1253
            G K V +++G RTP          L    L    ++  L+R       +D +++G V Q       AR+AAL +G    +   T+   C S  +++  G   I     DVV+AGG E MS+VP    R    T  S   +  +   +   L       H                MG  A+  A+   +SR  QD+FA+ S+  ++ + + G+   ++V + +  K     + +D      + ++   LKPAF K +GTVTAAN+S L DGA+++LI+S +        P A +  F   +  P D   + P  +  +LL     +  DI +   +E   +  +LAN++ +                G  P +K N+ GG++S+GHP G +G RL+   A+ L +   +  + + C  GG
Sbjct:   48 GVKNVVLVDGVRTPFLMSGTSYIDLMPHDLARGALQGLLSRTGVPTDAVDYIVLGTVIQEVKTSNVAREAALGAGFSDRIPAHTVTMACISSNQAMTTGFGLIAAGQCDVVVAGGVEFMSDVPIRHSRKMRKTMLSLNKAKTVGQRL--ALASSLRPAHFVPELPAVAEFSTSETMGHSADRLAAAFGVSRAEQDEFALRSHSYAKQAQEQGLL-SDLVPLKVPGKD---TVAKDNGIRPSSMEQMARLKPAFIKPHGTVTAANSSFLTDGASAVLIMSEEKALAMGYKPKAYLRDFVYVSQDPKDQLLLGPTYATARLLAKSGLSLGDIDVLNSHELRLAGQILANMRAMDSDWFAQNYVGLKSKVGAPPAEKFNLWGGSLSLGHPFGATGCRLVTTAAHRLHREGGQYALVAACAAGG 461          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Yeast
Match: ERG10 (Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA thiolase); cytosolic enzyme that transfers an acetyl group from one acetyl-CoA molecule to another, forming acetoacetyl-CoA; involved in the first step in mevalonate biosynthesis; human ACAT1 functionally complements the growth defect caused by repression of ERG10 expression [Source:SGD;Acc:S000005949])

HSP 1 Score: 351.673 bits (901), Expect = 3.970e-118
Identity = 194/397 (48.87%), Postives = 267/397 (67.25%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIV--IDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIK--NKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDI---AMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            + VYI++  RTPIGSF+  L+S TA +LGA+ +K  L +V   D     DE++ G V     GQAPARQ AL +GL + +  +T+NKVCAS MK++++G QSI C   DVV+AGG ESM+N P+Y P  R    +G + L+DG+  DGL D Y+   MG+ AE  A   +I+R+ QD FAI SYQKSQ S K G F  EIV V+IK    K +  + +DEE AR++ +K +S +  F K NGTVTAANAS +NDGAA+++++S   LK+  L P+A I G+ +AA QP DF  AP+ ++ K LK  +   EDI     +E NEAFSVV L N K++K + P KVN++GGAV++GHP+G SGAR+++ L   L++   ++GVA+ICNGGGGASSI+IE
Sbjct:    3 QNVYIVSTARTPIGSFQGSLSSKTAVELGAVALKGALAKVPELDASKDFDEIIFGNVLSANLGQAPARQVALAAGLSNHIVASTVNKVCASAMKAIILGAQSIKCGNADVVVAGGCESMTNAPYYMPAARAGAKFGQTVLVDGVERDGLNDAYDGLAMGVHAEKCARDWDITREQQDNFAIESYQKSQKSQKEGKFDNEIVPVTIKGFRGKPDTQVTKDEEPARLHVEKLRSARTVFQKENGTVTAANASPINDGAAAVILVSEKVLKEKNLKPLAIIKGWGEAAHQPADFTWAPSLAVPKALK--HAGIEDINSVDYFEFNEAFSVVGLVNTKILK-LDPSKVNVYGGAVALGHPLGCSGARVVVTLLSILQQEGGKIGVAAICNGGGGASSIVIE 396          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Yeast
Match: POT1 (3-ketoacyl-CoA thiolase with broad chain length specificity; cleaves 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA during beta-oxidation of fatty acids [Source:SGD;Acc:S000001422])

HSP 1 Score: 171.014 bits (432), Expect = 1.407e-48
Identity = 131/408 (32.11%), Postives = 207/408 (50.74%), Query Frame = 3
Query:   93 RNFSSINKGGKEVYIINGCRTPIGS-FRKGLNSLTAPQLGAITIKETLNRVA---RNDI-VIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTD--VYNKC--HMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNF--DKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGG-GASSIMIE 1277
            R  S + K  ++V I+   R+ IG  F+     +    L    + E + R     R D+ +I+EV  G V    +G    R A L SG+P S     +N+ C+SG+ +V      I     D+ +A G ESM+N          +Y   + +  I  + L       KC   MGI  EN A+   ISR  QD+FA +SYQK+  +   G+F+ EI+ + + +      I + +E  R N   +   S++PAF K  GT TA NAS ++DG A +L+       +  L  + + I F    + P    + PA +I K+L+      +DI ++EINEAF+   L  +  + G+  +KVN  GGA+++GHP+G +GAR +  +   LKK+++GV S+C G G GA++I I+
Sbjct:   24 RKNSLLEKRPEDVVIVAANRSAIGKGFKGAFKDVNTDYLLYNFLNEFIGRFPEPLRADLNLIEEVACGNVLNVGAGATEHRAACLASGIPYSTPFVALNRQCSSGLTAVNDIANKIKVGQIDIGLALGVESMTN----------NYKNVNPLGMISSEELQKNREAKKCLIPMGITNENVAANFKISRKDQDEFAANSYQKAYKAKNEGLFEDEILPIKLPDGS----ICQSDEGPRPNVTAESLSSIRPAFIKDRGTTTAGNASQVSDGVAGVLLARRSVANQLNLPVLGRYIDFQTVGVPPEIMGVGPAYAIPKVLEATGLQVQDIDIFEINEAFAAQALYCIHKL-GIDLNKVNPRGGAIALGHPLGCTGARQVATILRELKKDQIGVVSMCIGTGMGAAAIFIK 416          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO46656 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB4])

HSP 1 Score: 456.833 bits (1174), Expect = 4.410e-159
Identity = 218/388 (56.19%), Postives = 289/388 (74.48%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK--KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +EV I++  RT IGSFR  L S+ AP+LGA+ IK  + R   +   + EV MG VC    GQAPARQAAL + LP S  CTTINKVCASGMKS+M   QS+MC   ++++AGG ESMSNVPFY  R  P+YGG  + DGI+ DGL DVYN+ HMG+CAEN AS  NI+R+ QD +AI SY+++ ++   G FK+E+V V+I  K  K +++  EDEEY +V+F+KF SLK  F K NGTVTAANAS+LNDGAA++++++ +A +K  +TP+A I+ FADAA+ P+DFPIAPA +I K+L++ +   +DI MWEINEAFS V LAN+K++  + P KVNIHGGAVS+GHP+GMSGARLI H+ YNL    LG+A+ICNGGGGAS++++ 
Sbjct:    3 EEVVIVSAARTAIGSFRSALCSVPAPKLGAVAIKHAVERAGISPEQVQEVYMGNVCAAGMGQAPARQAALGAALPISTPCTTINKVCASGMKSIMAAAQSLMCGSQEIMVAGGMESMSNVPFYVSREAPTYGGHKMEDGIIKDGLWDVYNQFHMGVCAENAASKYNITREEQDDYAIHSYRRTAAAWDAGKFKQEVVPVNIPQKKGKPDIVFEEDEEYKKVSFEKFPSLKTVFKKENGTVTAANASTLNDGAAAVVLMTREAAEKNGVTPLASIVAFADAAVAPIDFPIAPAAAIPKVLRLAHLRKDDIDMWEINEAFSAVALANIKILD-LDPSKVNIHGGAVSIGHPVGMSGARLISHMTYNLAPGALGLAAICNGGGGASAMILR 389          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO38332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD67])

HSP 1 Score: 284.263 bits (726), Expect = 1.916e-91
Identity = 152/392 (38.78%), Postives = 237/392 (60.46%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPF-YFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYAR--VNFDKFKSLKPA--FKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            ++V I    RTP+GS    L+SL A +LG+I +KE L R + +   + EV++GQV     GQ PARQAA+ +G+P+ V    +N +C SG+K+V +G Q++    +++V+AGGQESMS  P     R    +G  +LID ++ DGL D +N  HMGI AEN A    +SR+ QD FA++S Q+++++ K G F  EIV VSIK +     +N D ++ R     +  + LKP   F   GTV+A N S LNDGAA ++++         ++P+A+++ +A A + P      P  + RK L       ED+ ++E+NEAF+    A ++ + G+ P KVNI+GGA+++GHPIG SG R+++ L +NL++     GVA++C GGG   ++ +E
Sbjct:    8 RDVIIACAVRTPVGSHNGDLSSLKAHELGSIVVKEALCRASISPCDVSEVILGQVLTAGQGQGPARQAAIHAGIPACVPAYGVNMLCGSGLKAVALGYQAVAMGDSNIVVAGGQESMSQAPHCCHMRPALKFGDMTLIDTMLKDGLMDSFNNYHMGITAENVAKQWEVSREEQDNFALTSQQRTETAQKAGYFSDEIVTVSIKTRAGLTEVNSD-QFPRHGCTIEGLRKLKPCFLFDGKGTVSAGNTSGLNDGAAVVVLMPYAEANVRNVSPLARVVSWAQAGVDPSVMGTGPIPATRKALSKAGWKVEDVDLFELNEAFAAQSCAVIREL-GLDPSKVNINGGAIALGHPIGASGCRILVTLLHNLRRTGKRRGVAALCVGGGMGVAVCVE 397          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO37843 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEN0])

HSP 1 Score: 223.016 bits (567), Expect = 6.300e-68
Identity = 134/392 (34.18%), Postives = 214/392 (54.59%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQA-PARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYF--PRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKK--EELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNEL--GVASICNGGGGASSIMIE 1277
            + VYI+   RT  G+F   L   TA  LG       +     +   +D V+ G V Q  +  A  AR   + S +P +    T+N++C SG +S++ G Q I+   +D+ + GG E+MS  P+     R     G    ++  ++ GLTD+     MGI AEN A   NI+R+  DQFA+ S Q+  ++ ++G F  EIV V +K KK  E+  ++E         ++   L   FK NGTV+A NAS + DGAA+L++ S  A+K + LTP+A+++ ++   + P    I P  SI+  L+   K  +D+ + E+NEAF+   LA  K + G+   K N++GGA+++GHP+G SGARL +HL + + +  L   + S C GGG   ++++E
Sbjct:    5 RPVYIVAAKRTAFGAFGGRLKDFTATVLGEHASVAAMESGKVDPATVDSVIFGNVLQCANDAAYVARHIGIKSKVPVTTPALTVNRLCGSGFQSIISGAQEIILGESDICLVGGTENMSQAPYAVRNARFGTKLGLDLKMEDTLWQGLTDMLPGLPMGITAENLAEKYNITREECDQFALLSQQRWAAAHESGAFTAEIVPVPVKGKKGPEQFAVDEHPR-PETTIEQLAKLPAVFKKNGTVSAGNASGICDGAAALVLASEKAVKDHGLTPLARLVSYSINGVDPAIMGIGPVPSIKCALERAGKTLDDMDIIEVNEAFAPQFLAVQKDL-GLDMSKTNVNGGAIALGHPVGTSGARLTVHLTHEMMRKGLKYSIGSACIGGGQGVALVLE 394          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO27039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAD1])

HSP 1 Score: 178.718 bits (452), Expect = 1.058e-53
Identity = 88/183 (48.09%), Postives = 121/183 (66.12%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFY-FPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQK 668
            KEV I++  RTPIGSF   L+S+ AP+LGAI IK  L+++     ++ EV MG V     GQAPARQAA+F+G+P +V CTT+NKVC+SGMKS+M+  Q+I     ++V+AGG E+MS +P Y   R+   +G   + DG+  DGL D Y +  MG+CA+  A   N SR+ QD FAI SY +
Sbjct:    2 KEVVIVSVARTPIGSFMGSLSSIPAPKLGAIAIKGALDKINLQPNMVQEVFMGNVVSAGLGQAPARQAAIFAGIPDTVPCTTVNKVCSSGMKSIMLAAQTIALGDAEIVVAGGMENMSMIPHYQHARSGSKFGPIKMEDGMQKDGLVDTYEQVAMGVCADECAVEYNFSREDQDAFAIESYNR 184          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Match: EDO36127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJI9])

HSP 1 Score: 142.51 bits (358), Expect = 1.549e-37
Identity = 117/437 (26.77%), Postives = 191/437 (43.71%), Query Frame = 3
Query:   99 FSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRT------------------------EPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMD-FPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVK---------------GMHP-DKVNIHGGAVSMGHPIGMSGARLILHLAYNLKK--NELGVASICNGGGGASSIMIE 1277
            FS+   GG+ V ++ G RTP          L    L    ++  + +   +  V+D V +G V Q       AR+AAL +G P  V   T+   C S  +++  G   I     D  +AGG E MS+VP  F R                          PS+    L        + +      MG  A+  AS  ++SR  QD++A+ S+  +  + + G   K    +S +      +++ D         +   LKPAF +  GT+TAAN+S L DGA++ L++  +      L P A +  +   +  P D   + PA +  KLL+       DI ++E +EAF+  +LAN+K +                G  P +K+N  GG++S+GHP G +G RL+   A  L +   + G+ + C  GG   ++++E
Sbjct:    6 FSAKFSGGRNVVLVEGVRTPFLMSGTSYADLMPHDLQRGALQGLITKTGIDPGVVDYVCIGTVIQEVKTSNIAREAALGAGFPEKVPSHTVTMACISSNQAISSGVSMIAAGQIDSCVAGGVEFMSDVPIRFSRPLRKTLLSLNKAKTLGARLSLLSRLRPSFLAPEL------PAVAEFSTGEVMGHSADRLASAFHVSRQEQDEYALRSHTLAHQATQAG---KLTDVLSYQVPGTTTVLSADNGIRVSTPQQMAKLKPAFIRPFGTITAANSSFLTDGASACLVMCEEKALSMGLKPKAYLRDYVYVSQDPKDQLLLGPAYATPKLLEKTGLKLSDIDVFEFHEAFAGQILANMKALDSDWFSQNYMGRSSKVGAPPMEKLNTWGGSLSIGHPFGATGVRLVTTAANRLNEVGGKYGLVAACAAGGLGHAMIVE 433          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:101172558])

HSP 1 Score: 437.187 bits (1123), Expect = 1.586e-150
Identity = 214/387 (55.30%), Postives = 286/387 (73.90%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            +EV I++  RTP+GSF+  L ++ A +LG++ I+  + +       + EV MG V Q   GQAP RQA L +GL      TTINKVCASGMK++M+  QS+MC   DV++AGG ESMSNVP+   R  P+YGG  + D IV DGLTDVYNK HMG CAENTA    ISR+ QD FAISSY +S+++ + G+F KEIV VSI  K K++++++EDEE+ RV+F K   L+P F K NGTVTAANAS+LNDGAA+L++++  A  +  + P+A+I+ FADAA+ P+DFPIAPA ++ K+LK      ED++MWEINEAFSVVVLAN+K++  + P KVNI+GGAVS+GHPIGMSGAR++ H+ +NLK  + G+ASICNGGGGASSI+I+
Sbjct:   32 QEVVIVSATRTPMGSFKGCLAAVPATKLGSVAIRGAVEQAGIAPEEVKEVYMGNVLQAGQGQAPTRQALLGAGLSLGTPATTINKVCASGMKAIMMAAQSLMCGHQDVMVAGGMESMSNVPYVMARETPAYGGVKMEDLIVKDGLTDVYNKFHMGNCAENTAKNSRISREEQDAFAISSYSRSRAAYEAGVFAKEIVPVSIPQKGKQDVVVSEDEEWRRVDFSKVPKLRPVFLKENGTVTAANASTLNDGAAALVLMTAAAAGRLGVVPLARIVAFADAAVAPIDFPIAPAFAVPKVLKAAGLTKEDVSMWEINEAFSVVVLANIKMLD-IDPTKVNINGGAVSLGHPIGMSGARIVGHMVHNLKTGQFGLASICNGGGGASSILIQ 417          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Match: acat1 (acetyl-CoA acetyltransferase 1 [Source:NCBI gene;Acc:101172558])

HSP 1 Score: 355.14 bits (910), Expect = 8.391e-119
Identity = 184/386 (47.67%), Postives = 250/386 (64.77%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNK-KEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIE 1277
            EV I++  RTP+GSF+  L ++ A +LG++ I+  + +       + EV MG V Q   GQAP RQA L +GL      TTINKVCASGMK++M+  QS+MC                                                 H G CAENTA    ISR+ QD FAISSY +S+++ + G+F KEIV VSI  K K++++++EDEE+ RV+F K   L+P F K NGTVTAANAS+LNDGAA+L++++  A  +  + P+A+I+ FADAA+ P+DFPIAPA ++ K+LK      ED++MWEINEAFSVVVLAN+K++  + P KVNI+GGAVS+GHPIGMSGAR++ H+ +NLK  + G+ASICNGGGGASSI+I+
Sbjct:   45 EVVIVSATRTPMGSFKGCLAAVPATKLGSVAIRGAVEQAGIAPEEVKEVYMGNVLQAGQGQAPTRQALLGAGLSLGTPATTINKVCASGMKAIMMAAQSLMCG------------------------------------------------HQGNCAENTAKNSRISREEQDAFAISSYSRSRAAYEAGVFAKEIVPVSIPQKGKQDVVVSEDEEWRRVDFSKVPKLRPVFLKENGTVTAANASTLNDGAAALVLMTAAAAGRLGVVPLARIVAFADAAVAPIDFPIAPAFAVPKVLKAAGLTKEDVSMWEINEAFSVVVLANIKMLD-IDPTKVNINGGAVSLGHPIGMSGARIVGHMVHNLKTGQFGLASICNGGGGASSILIQ 381          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Match: acat2 (acetyl-CoA acetyltransferase 2 [Source:NCBI gene;Acc:101175699])

HSP 1 Score: 277.33 bits (708), Expect = 1.759e-88
Identity = 158/389 (40.62%), Postives = 234/389 (60.15%), Query Frame = 3
Query:  129 VYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP-RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYAR--VNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIE 1277
            V I++  RTPIG     L++L+A  L +  IK+ L R       + EV++GQV     GQ PARQA++ +G+P  V   +   VC SG+KSV +G QSI    + VV+AGG ESMS VP     R     G  SL D +V DGLTD +   HMGI AEN A    ISR+ QD+FA+ S  K++++ K G F +EIV + + ++K  + +  D E+ R   N +    LKP F K +GTVTA NAS +NDGAA+ +++ +   ++  + PMAKII +A A L P      P  +I+K ++      + + ++EINEAF+   +A +K +  ++ DKVN+ GGA+S+GHPIGMSG R+++ L + L++   + GVAS+C GGG   ++ +E
Sbjct:    6 VVIVSAARTPIGCLNGALSTLSASDLCSEVIKDVLKRAGVKPEEVSEVVLGQVLTAGQGQNPARQASVKAGIPYLVPAWSCQMVCGSGLKSVCLGAQSIQAGESTVVVAGGMESMSRVPHTVQMRAGVKMGDVSLQDSMVADGLTDAFQGYHMGITAENVAKQWGISREEQDRFAVQSQNKTEAAQKAGHFDQEIVPIMVPSRKGPVEVKVD-EFPRHGSNMESMAKLKPCFIKDSGTVTAGNASGINDGAAAAVLMGLSEAERRGIKPMAKIISWAQAGLDPSIMGTGPIPAIKKAIEKAAWQLDQVDLFEINEAFAAQSVAVVKELS-LNKDKVNVSGGAISLGHPIGMSGCRVLVTLLHGLQRTGGKRGVASLCIGGGMGIAMCVE 392          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Match: acaa2 (acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc:101171672])

HSP 1 Score: 223.787 bits (569), Expect = 8.121e-68
Identity = 141/394 (35.79%), Postives = 222/394 (56.35%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAP--ARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIEGC 1283
            + V++++  RTP G++   L   +A  L     K  L        +I+ V++G V Q  S  AP  AR   L  G+P  V   T+N++C SG +S++ G   I    ++VV+ GG ESMS  P+     R    +G    ++  ++ GLTD++ K  MGI AEN A    I+R+  D+FA  + Q+ +++ + G F  EI  V IK KK ++ + +DE    +   ++   L   FK  GTVTA NAS ++DGAA+L+I S DALK+++LTP+A+I+ +  +   P    I P  +I   LK    +  D+ + E+NEAF+   LA  K + G+ P+K N++GGA+++GHP+G SGAR+  HL + L++   +  V S C GGG   +I++E C
Sbjct:    5 RGVFVVSAKRTPFGTYGGVLKDHSATDLAEHAAKAALAAGGVAPELINSVILGNVMQS-SADAPYIARHVGLRCGVPIPVPALTVNRLCGSGFQSIINGTHEICLRESEVVLCGGSESMSQAPYAVRNIRFGTKFGLDLKLEDTLWAGLTDLHVKIPMGITAENLAEKYEITREDCDKFAYQTQQRWKAAHEGGHFTAEIAPVDIKTKKGKVPMAQDEHPRPQTTPEQMAKLPSVFKKGGTVTAGNASGVSDGAAALVIASDDALKEHKLTPLARIVAYHVSGCDPSIMGIGPVPAITGALKKSGLSLNDMDLVEVNEAFAPQFLAVSKAL-GLDPEKTNVNGGAIAIGHPLGASGARITGHLVHELRRRGGKYAVGSACIGGGQGIAIILERC 396          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Match: acaa2 (acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc:101171672])

HSP 1 Score: 193.741 bits (491), Expect = 9.463e-57
Identity = 129/392 (32.91%), Postives = 205/392 (52.30%), Query Frame = 3
Query:  123 KEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAP--ARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEE-YARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIEGC 1283
            + V++++  RTP G++   L   +A  L     K  L        +I+ V++G V Q  S  AP  AR   L  G+P  V   T+N++C SG +S++ G                                       ++  ++ GLTD++ K  MGI AEN A    I+R+  D+FA  + Q+ +++ + G F  EI  V IK KK ++ + +DE    +   ++   L   FK  GTVTA NAS ++DGAA+L+I S DALK+++LTP+A+I+ +  +   P    I P  +I   LK    +  D+ + E+NEAF+   LA  K + G+ P+K N++GGA+++GHP+G SGAR+  HL + L++   +  V S C GGG   +I++E C
Sbjct:    5 RGVFVVSAKRTPFGTYGGVLKDHSATDLAEHAAKAALAAGGVAPELINSVILGNVMQS-SADAPYIARHVGLRCGVPIPVPALTVNRLCGSGFQSIINGTH-------------------------------------LEDTLWAGLTDLHVKIPMGITAENLAEKYEITREDCDKFAYQTQQRWKAAHEGGHFTAEIAPVDIKTKKGKVPMAQDEHPRPQTTPEQMAKLPSVFKKGGTVTAGNASGVSDGAAALVIASDDALKEHKLTPLARIVAYHVSGCDPSIMGIGPVPAITGALKKSGLSLNDMDLVEVNEAFAPQFLAVSKAL-GLDPEKTNVNGGAIAIGHPLGASGARITGHLVHELRRRGGKYAVGSACIGGGQGIAIILERC 357          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000056408.1 (SMESG000056408.1)

HSP 1 Score: 847.81 bits (2189), Expect = 0.000e+0
Identity = 413/414 (99.76%), Postives = 414/414 (100.00%), Query Frame = 3
Query:   48 MTLSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIEGCRN 1289
            MTLSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEEL+INEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIEGCRN
Sbjct:    1 MTLSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELLINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIEGCRN 414          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000016312.1 (SMESG000016312.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 250/386 (64.77%), Postives = 318/386 (82.38%), Query Frame = 3
Query:  126 EVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPRTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNGGGGASSIMIEGC 1283
            +V+II GCRTPIGSFRKGL SLTAP+LGAITIKETLN+++  +++IDEVLMGQVCQ   GQAPARQAA+ + L   VSCTTINKVCASGMKSV+ G QSIMC +ND+V+AGGQESMSN+PFY PR EP+YGG SLIDG+V DGLTD +NKCHMG   E  A    I+R  QD FA  SY+++Q++AK G+F KEIV V++KNK  + +I +DEE +R NF+KF  L PAFK +GT+TAANASSL+DGAA LL+ S +A++ +QLTP+AK++GF+DAA+ P +F IAP++SI KLL+  +   +DI+MWEINEAFSV VLANL+++ G+  D+VN+HGGAVS+GHP+GMSGAR++LHLA NL+  + G+AS+CNGGGGASSI+IEGC
Sbjct:    3 DVFIITGCRTPIGSFRKGLASLTAPELGAITIKETLNKLSNENLIIDEVLMGQVCQANCGQAPARQAAILADLSPGVSCTTINKVCASGMKSVIFGSQSIMCGVNDIVLAGGQESMSNIPFYLPRKEPNYGGCSLIDGLVADGLTDAFNKCHMGTHVEGVAQDFRITRSEQDSFAKLSYERAQNAAKFGVFDKEIVGVTVKNKSGDSVIYQDEELSRANFEKFPHLSPAFKPDGTITAANASSLSDGAACLLLASGNAIENHQLTPIAKVLGFSDAAVDPKNFVIAPSKSIDKLLRKHDLRYDDISMWEINEAFSVAVLANLQLMPGISLDRVNVHGGAVSLGHPLGMSGARIVLHLAMNLQSGQKGIASVCNGGGGASSILIEGC 388          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000029717.1 (SMESG000029717.1)

HSP 1 Score: 135.191 bits (339), Expect = 2.068e-36
Identity = 77/228 (33.77%), Postives = 120/228 (52.63%), Query Frame = 3
Query:  378 VCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP--RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEI 1055
            +C SG ++++ G   I+C  +++ + GG E+MS  P+     R    +G     + I++  L D +    MGI AEN A    I+R   D++A+SS Q+ +S+    IF+ EI  V  K KK E     DE     + +    L P FK +G V+A NAS + DGA +L+I S  ALK++ L P+AKI+ ++ +  +P    I P  +I+KLL     N   I   E+
Sbjct:    1 MCGSGFQAIINGSHEILCGDSNICLVGGSENMSEAPYVVRNVRFGTKFGVDYKFEDILWTTLLDKHINTPMGITAENLAEKYGITRQQCDEYALSSQQRWKSANDKKIFQSEIAPVITKTKKGEKQFTVDEHPRETSLESLGKLPPVFKKDGVVSAGNASGVCDGAGALIIASEAALKQHNLNPLAKIVAYSVSGCEPSIMGIGPVLAIQKLLAAAKLNVSQIDHVEV 228          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000070850.1 (SMESG000070850.1)

HSP 1 Score: 130.954 bits (328), Expect = 6.673e-33
Identity = 115/430 (26.74%), Postives = 190/430 (44.19%), Query Frame = 3
Query:  117 GGKEVYIINGCRTPIGSFRKGLNSLTAPQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLPSSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFPR---------------TEPSYGGSSLIDGIVFD----GLTDVYNKCHMGICAENTASTLNISRDAQDQFAISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFKSLKPAF-KANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFADAALQPMD-FPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKVVK---------------GMHP-DKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKN--ELGVASICNGGGGASSIMIEGCRN 1289
            GGK + +I+G R P         ++    L    +    N++      +  ++ G V Q       AR+A+L +G        T+   C S   ++      + C   DV IAGG E +S+ P  F R                + +   S LI    F      + +      MG  A+  A+   I+R+ QD +AI S+  ++ ++  G F +++V + I   +    I +D      + +    LKPAF K +GT+TAAN+S L DGA++ L+ + +  K+    P A +  F   +  P D   + PA +  K+L       +DI+ +E +EAF+  +LAN+  +                G  P DK+N  GG++S+GHP G +G RL+   A  L K   +  + + C  GG   +I+IE   N
Sbjct:   31 GGKNLVLIDGVRIPFLLSGTDYKNVMPHDLARGALLGLHNKLKFPKECVGSLIFGTVIQEVKTSNIAREASLGAGFSDFTPAHTVTMACISSNIAITSSMGLLACGAVDVAIAGGVEFLSDAPIRFSRRVRSIMLDFRKAKTLAQKANLLSRLISSETFKLDLPAVAEFSTNETMGHSADRLAAAFGITREDQDNYAIRSHSFAKQASDNG-FLEDLVPIKIPGIENP--IAKDNGIRPSSKEALAKLKPAFIKPHGTITAANSSFLTDGASACLLTTEEKAKQMGWKPKAYLRDFIYVSQDPKDQLLLGPAYATPKILDKNKLTIKDISAFEYHEAFAGQILANMAAMDCDFFCKEYMKRPGKFGSIPMDKLNTWGGSLSIGHPFGATGVRLVTTAANRLIKEDGQFALVAACAAGGQGHAILIERYPN 457          
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Match: SMESG000029726.1 (SMESG000029726.1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.669e-13
Identity = 36/78 (46.15%), Postives = 54/78 (69.23%), Query Frame = 3
Query: 1050 EINEAFSVVVLANLKVVKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLK--KNELGVASICNGGGGASSIMIE 1277
            ++NEAF+   LA  K +K +   K NI+GGA+++GHP+G SGAR++ HL + L+  KN+L + S C GGG   +I+IE
Sbjct:   14 KVNEAFAAQYLAVEKELK-LERAKTNINGGAIALGHPVGASGARIMGHLTHELQRTKNKLALGSACIGGGQGIAILIE 90          
The following BLAST results are available for this feature:
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACAT11.719e-15055.56acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol... [more]
ACAT11.957e-14754.57acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol... [more]
ACAT14.848e-13958.33acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol... [more]
ACAT14.848e-13958.33acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol... [more]
ACAT14.646e-11256.89acetyl-CoA acetyltransferase 1 [Source:HGNC Symbol... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat-14.216e-14351.95Acetyl-CoA acetyltransferase homolog, mitochondria... [more]
kat-14.216e-14351.95Acetyl-CoA acetyltransferase homolog, mitochondria... [more]
T02G5.76.743e-11043.15pep chromosome:WBcel235:II:7075614:7077188:1 gene:... [more]
acaa-22.324e-7033.25ACetyl-CoA Acyltransferase 2 homolog [Source:UniP... [more]
acaa-22.324e-7033.25ACetyl-CoA Acyltransferase 2 homolog [Source:UniP... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG109321.966e-16157.67gene:FBgn0029969 transcript:FBtr0071143[more]
CG109321.966e-16157.67gene:FBgn0029969 transcript:FBtr0345982[more]
CG91493.815e-9639.69gene:FBgn0035203 transcript:FBtr0072667[more]
yip21.538e-6533.67gene:FBgn0040064 transcript:FBtr0079876[more]
Mtpbeta8.636e-4429.51gene:FBgn0025352 transcript:FBtr0072226[more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acat11.354e-15354.20acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat26.004e-9440.97acetyl-CoA acetyltransferase 2 [Source:ZFIN;Acc:ZD... [more]
acaa21.567e-6834.44acetyl-CoA acyltransferase 2 [Source:ZFIN;Acc:ZDB-... [more]
acaa14.348e-5332.38acetyl-CoA acyltransferase 1 [Source:ZFIN;Acc:ZDB-... [more]
CABZ01065076.15.946e-4736.133-ketoacyl-CoA thiolase, mitochondrial-like [Sourc... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acat12.042e-15156.85acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat12.133e-15156.96acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat12.139e-15156.85acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat14.868e-15156.85acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat18.114e-15156.99acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acat12.412e-14455.70acetyl-Coenzyme A acetyltransferase 1 [Source:MGI ... [more]
Acat39.599e-8236.76acetyl-Coenzyme A acetyltransferase 3 [Source:MGI ... [more]
Acat39.599e-8236.76acetyl-Coenzyme A acetyltransferase 3 [Source:MGI ... [more]
Acat21.565e-8037.79acetyl-Coenzyme A acetyltransferase 2 [Source:MGI ... [more]
Acat24.810e-7338.10acetyl-Coenzyme A acetyltransferase 2 [Source:MGI ... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AZA0|THIL_DANRE1.022e-15254.20Acetyl-CoA acetyltransferase, mitochondrial OS=Dan... [more]
sp|Q6NU46|THILA_XENLA8.538e-15256.68Acetyl-CoA acetyltransferase A, mitochondrial OS=X... [more]
sp|Q5BKN8|THIL_XENTR5.116e-15056.99Acetyl-CoA acetyltransferase, mitochondrial OS=Xen... [more]
sp|P24752|THIL_HUMAN8.254e-15055.56Acetyl-CoA acetyltransferase, mitochondrial OS=Hom... [more]
sp|Q6GN02|THILB_XENLA1.848e-14954.96Acetyl-CoA acetyltransferase B, mitochondrial OS=X... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A9YVD64.785e-17161.40Acetyl-CoA acetyltransferase A, mitochondrial OS=L... [more]
A0A2R7VSH85.710e-16957.83Acetyl-CoA acetyltransferase OS=Oncopeltus fasciat... [more]
A0A0V0G3Z11.375e-16359.40Putative 3-oxoacyl coa thiolase OS=Triatoma dimidi... [more]
A0A1S3HB281.488e-16357.83acetyl-CoA acetyltransferase, mitochondrial OS=Lin... [more]
A0A1B6E2E73.559e-16360.98Uncharacterized protein OS=Clastoptera arizonana O... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acat11.119e-15154.39acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat22.638e-9540.82acetyl-CoA acetyltransferase 2 [Source:NCBI gene;A... [more]
acaa24.870e-6734.30acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc... [more]
acaa12.298e-4632.32acetyl-CoA acyltransferase 1 [Source:NCBI gene;Acc... [more]
hadhb5.812e-4128.71hydroxyacyl-CoA dehydrogenase trifunctional multie... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
acat17.357e-14756.07acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acaa21.853e-6433.50acetyl-CoA acyltransferase 2 [Source:ZFIN;Acc:ZDB-... [more]
acaa16.031e-4628.68acetyl-CoA acyltransferase 1 [Source:ZFIN;Acc:ZDB-... [more]
hadhb1.444e-3126.43hydroxyacyl-CoA dehydrogenase trifunctional multie... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERG103.970e-11848.87Acetyl-CoA C-acetyltransferase (acetoacetyl-CoA th... [more]
POT11.407e-4832.113-ketoacyl-CoA thiolase with broad chain length sp... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466564.410e-15956.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383321.916e-9138.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378436.300e-6834.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270391.058e-5348.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361271.549e-3726.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acat11.586e-15055.30acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat18.391e-11947.67acetyl-CoA acetyltransferase 1 [Source:NCBI gene;A... [more]
acat21.759e-8840.62acetyl-CoA acetyltransferase 2 [Source:NCBI gene;A... [more]
acaa28.121e-6835.79acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc... [more]
acaa29.463e-5732.91acetyl-CoA acyltransferase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of acetyl-CoA acetyltransferase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056408.10.000e+099.76SMESG000056408.1[more]
SMESG000016312.10.000e+064.77SMESG000016312.1[more]
SMESG000029717.12.068e-3633.77SMESG000029717.1[more]
SMESG000070850.16.673e-3326.74SMESG000070850.1[more]
SMESG000029726.11.669e-1346.15SMESG000029726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013833 ID=SMED30013833|Name=acetyl-CoA acetyltransferase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1514bp
CACAATTTGTGTTTGTTTAGATATATATGTCAAATAGTTCTTTTTAAATG
ACTTTAAGTAGAACTTTTACCAATTCACGATTTCTGATTATTAGGAATTT
CAGTTCTATTAATAAAGGTGGAAAGGAAGTTTACATTATAAATGGCTGTA
GAACACCAATTGGATCATTTAGGAAAGGACTTAATTCATTAACAGCTCCT
CAATTAGGTGCTATAACAATAAAAGAAACTTTAAATCGTGTTGCTCGTAA
TGATATAGTCATCGATGAAGTTTTAATGGGTCAAGTTTGTCAGGGTTTTT
CTGGACAGGCTCCAGCAAGACAAGCCGCATTATTTAGTGGTTTACCTAGT
TCAGTTTCATGTACGACTATAAATAAAGTTTGTGCTAGTGGAATGAAATC
TGTTATGATTGGTTGTCAGTCTATCATGTGCAGCATTAATGACGTAGTTA
TAGCAGGTGGTCAAGAAAGTATGTCAAACGTTCCATTTTATTTCCCGCGA
ACGGAACCATCTTACGGGGGTTCAAGTTTGATCGATGGTATAGTTTTTGA
TGGATTGACAGATGTTTATAATAAATGCCACATGGGGATTTGTGCTGAAA
ATACGGCATCAACATTAAATATTAGTCGAGATGCTCAAGATCAATTTGCC
ATAAGTTCATACCAGAAAAGTCAAAGTAGTGCTAAAACTGGAATATTCAA
AAAGGAAATCGTCGCTGTTTCCATTAAAAATAAAAAAGAAGAATTAATAA
TCAATGAAGATGAGGAGTATGCGCGAGTAAATTTTGACAAATTCAAATCT
CTTAAGCCTGCGTTTAAAGCGAACGGCACCGTTACGGCTGCAAATGCTAG
CTCATTGAACGATGGAGCGGCGTCGCTATTAATTCTATCTGTAGACGCTT
TGAAAAAATACCAATTAACTCCGATGGCAAAAATAATAGGTTTCGCTGAT
GCCGCTCTGCAACCGATGGATTTTCCTATTGCGCCAGCAGAATCTATTAG
AAAGCTTTTAAAAATCTGTAATAAAAATGCCGAAGATATCGCAATGTGGG
AAATAAATGAGGCGTTTTCAGTTGTCGTGTTAGCCAATCTAAAGGTGGTC
AAAGGAATGCATCCGGATAAAGTTAATATTCACGGTGGAGCGGTGAGTAT
GGGCCATCCAATCGGAATGTCTGGTGCAAGACTGATTTTACACTTGGCTT
ATAATTTAAAGAAAAATGAGCTAGGTGTAGCATCTATTTGTAATGGTGGG
GGTGGAGCATCGTCGATAATGATTGAGGGGTGTCGAAATTGATTTCAGTT
CTAAGTGAACTGAAATTTTAGATGATGCAAGCGCTTATAACATTTATTCT
ACCAATTGATTTGCTAGATTTGTCTCTGTTGAATTTCAAGAGCAAATATA
GGTCTAATCAGAAAATTGGGTGTTTTATTGGCTAATATTCAAGTTTCTAT
GGCAACCAAGTATATGAGTTTACATATATTTTAATTTTCCAGATTTATGT
GTGAATGTAAAGAT
back to top

protein sequence of SMED30013833-orf-1

>SMED30013833-orf-1 ID=SMED30013833-orf-1|Name=SMED30013833-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=415bp
MTLSRTFTNSRFLIIRNFSSINKGGKEVYIINGCRTPIGSFRKGLNSLTA
PQLGAITIKETLNRVARNDIVIDEVLMGQVCQGFSGQAPARQAALFSGLP
SSVSCTTINKVCASGMKSVMIGCQSIMCSINDVVIAGGQESMSNVPFYFP
RTEPSYGGSSLIDGIVFDGLTDVYNKCHMGICAENTASTLNISRDAQDQF
AISSYQKSQSSAKTGIFKKEIVAVSIKNKKEELIINEDEEYARVNFDKFK
SLKPAFKANGTVTAANASSLNDGAASLLILSVDALKKYQLTPMAKIIGFA
DAALQPMDFPIAPAESIRKLLKICNKNAEDIAMWEINEAFSVVVLANLKV
VKGMHPDKVNIHGGAVSMGHPIGMSGARLILHLAYNLKKNELGVASICNG
GGGASSIMIEGCRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR016039Thiolase-like
IPR020616Thiolase_N
IPR002155Thiolase
IPR020617Thiolase_C
IPR020615Thiolase_acyl_enz_int_AS
IPR020610Thiolase_AS
IPR020613Thiolase_CS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process