Unc-5 netrin receptor B

Overview
NameUnc-5 netrin receptor B
Smed IDSMED30013824
Length (bp)3424
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Unc-5 netrin receptor B (SMED30013824) t-SNE clustered cells

Violin plots show distribution of expression levels for Unc-5 netrin receptor B (SMED30013824) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Unc-5 netrin receptor B (SMED30013824) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Unc-5 netrin receptor B (SMED30013824) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013824

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013824SMESG000040323.1 SmedASXL_016479SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013824SMESG000040323.1 dd_Smed_v4_10380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013824SMESG000040323.1 dd_Smed_v4_10380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30013824SMESG000040323.1 dd_Smed_v4_10380_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013824SMESG000040323.1 dd_Smed_v4_10380_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013824SMESG000040323.1 dd_Smed_v4_10380_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 307.76 bits (787), Expect = 2.733e-88
Identity = 286/1046 (27.34%), Postives = 452/1046 (43.21%), Query Frame = 3
Query:  300 WDSKENHEVDSKKDLVLPSE---KHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVF---LMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSD-----HYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            WD + +         VLP        E +P F+Q+P+  Y V K+ P  + C A P + +   C + ++   N+ V+  GL     D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  IC  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C     +  + N    E+S       D A+Y GL VA+ V    LM V ++  + RR    F  +     +    G   F+P                    +N    +++    N     PS   D ++++    +     Y  ++    +PM  +PLL  + P+LK++  YS S   S      GL      L + P  +  SD     H+  L  + +  S Q +  P  P      + +  T    GGR+S+  + ++L  P  +   G    ++L    +E  LP     +T+LSP V CGPT ++  +P IL +PHCA    + +W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +   G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + DL    W++     YQEIPF  +W      LHC+F   +  + +     KI V  ++        I+Q +      T L  TP GS  T  SA  +  +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA       LN+L   L +MG+ + +  +  D
Sbjct:   19 WDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV-KNKPVELRCRAFPATQIYFKC-NGEWVSQNDHVTQEGL-----DEATGLRVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASG------DAALYAGLVVAIFVVVAILMAVGVV--VYRRNCRDFDTDITDSSAALTGG---FHP--------------------VN----FKTARPSNPQLLHPSVPPDLTASAG---IYRGPVYALQDSTDKIPMTNSPLLDPL-PSLKVK-VYSSSTTGSG----PGLADGADLLGVLPPGTYPSDFARDTHFLHL-RSASLGSQQLLGLPRDP-----GSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCA-EVSARDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEPRACHILLDQLGTYVFTGESY-SRSAVKRLQLAVFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEG----QIFQLH------TTLAETPAGSLDTLCSAPGSTVT------TQLGPY------------AFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATD 942          
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Match: UNC5B (unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HGNC:12568])

HSP 1 Score: 302.753 bits (774), Expect = 1.187e-86
Identity = 283/1046 (27.06%), Postives = 449/1046 (42.93%), Query Frame = 3
Query:  300 WDSKENHEVDSKKDLVLPSE---KHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVF---LMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSD-----HYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            WD + +         VLP        E +P F+Q+P+  Y V K+ P  + C A P + +   C + ++   N+ V+  GL     D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  IC  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C   + +                 + D A+Y GL VA+ V    LM V ++  + RR    F  +     +    G   F+P                    +N    +++    N     PS   D ++++    +     Y  ++    +PM  +PLL  + P+LK++  YS S   S      GL      L + P  +  SD     H+  L  + +  S Q +  P  P      + +  T    GGR+S+  + ++L  P  +   G    ++L    +E  LP     +T+LSP V CGPT ++  +P IL +PHCA    + +W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +   G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + DL    W++     YQEIPF  +W      LHC+F   +  + +     KI V  ++        I+Q +      T L  TP GS  T  SA  +  +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA       LN+L   L +MG+ + +  +  D
Sbjct:   19 WDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV-KNKPVELRCRAFPATQIYFKC-NGEWVSQNDHVTQEGL-----DEATGLRVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQMLEA-----------------SGDAALYAGLVVAIFVVVAILMAVGVV--VYRRNCRDFDTDITDSSAALTGG---FHP--------------------VN----FKTARPSNPQLLHPSVPPDLTASAG---IYRGPVYALQDSTDKIPMTNSPLLDPL-PSLKVK-VYSSSTTGSG----PGLADGADLLGVLPPGTYPSDFARDTHFLHL-RSASLGSQQLLGLPRDP-----GSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCA-EVSARDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEPRACHILLDQLGTYVFTGESY-SRSAVKRLQLAVFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEG----QIFQLH------TTLAETPAGSLDTLCSAPGSTVT------TQLGPY------------AFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATD 931          
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 276.559 bits (706), Expect = 9.072e-78
Identity = 254/1012 (25.10%), Postives = 438/1012 (43.28%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + +        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C           +  P+S        DVA+Y+G+ +AV V L +  ++   + R+      + +   S    G Q            +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   +   V+    PQ  L +  S L   ++ SL ++  E  +  N++  +     C  +          + +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P +L + HCA + ++ +W I +L + +   Q   W+  + +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + ++ + E  ++G +L+   K    +    N+ + I D+A   W++     YQEIPF  VW      LHC+F   +  +N      K+ V  ++        I+Q N   +++   +  P      +I+  +                           S F +P   + KLC  LD+     +DWR LA  L++ R L +F+ K S T ++LDLWEAQN    +L+ L  +L +MGR + V  L  +
Sbjct:   18 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLC----------MQTAPDSD-------DVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQ-------PVNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNTSGAVT----PQDDLSEFTSKLSPQMTQSLLEN--EALSLKNQSLARQTDPSCTAF---------GSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCA-DPNTEDWKI-LLKNQAAQGQ---WEDVV-VVGEENFTTPCYIQLDAEACHILTENLSTYALVGHS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEILHLE-RQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEG----QIFQLNCTVSEEPTGIDLPLLDPANTITTVTG-------------------------PSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 887          
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 276.944 bits (707), Expect = 1.537e-77
Identity = 254/1012 (25.10%), Postives = 438/1012 (43.28%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + +        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C           +  P+S        DVA+Y+G+ +AV V L +  ++   + R+      + +   S    G Q            +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   +   V+    PQ  L +  S L   ++ SL ++  E  +  N++  +     C  +          + +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P +L + HCA + ++ +W I +L + +   Q   W+  + +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + ++ + E  ++G +L+   K    +    N+ + I D+A   W++     YQEIPF  VW      LHC+F   +  +N      K+ V  ++        I+Q N   +++   +  P      +I+  +                           S F +P   + KLC  LD+     +DWR LA  L++ R L +F+ K S T ++LDLWEAQN    +L+ L  +L +MGR + V  L  +
Sbjct:   59 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLC----------MQTAPDSD-------DVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALNGGFQ-------PVNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNTSGAVT----PQDDLSEFTSKLSPQMTQSLLEN--EALSLKNQSLARQTDPSCTAF---------GSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCA-DPNTEDWKI-LLKNQAAQGQ---WEDVV-VVGEENFTTPCYIQLDAEACHILTENLSTYALVGHS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEILHLE-RQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEG----QIFQLNCTVSEEPTGIDLPLLDPANTITTVTG-------------------------PSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 197.978 bits (502), Expect = 6.399e-52
Identity = 200/792 (25.25%), Postives = 351/792 (44.32%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESS----------TSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLI-RRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLV 2660
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + +        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C   + SFI     YP S+          +S   + DVA+Y+G+ +AV V L +  ++   + R+    F  + +   S+  NG   F P        +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   +   V+    PQ  L +  S L   ++ SL ++  E  +  N++  +     C  +          + +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P +L + HCA + ++ +W I +L + +   Q   W+  + +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + ++ + E  ++G +L+
Sbjct:   59 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHIVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLC---MQSFI-----YPISTEQRTQNEYGFSSAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDII--DSSALNG--GFQP----VNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNTSGAVT----PQDDLSEFTSKLSPQMTQSLLEN--EALSLKNQSLARQTDPSCTAF---------GSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCA-DPNTEDWKI-LLKNQAAQGQ---WEDVV-VVGEENFTTPCYIQLDAEACHILTENLSTYALVGHS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEILHLE-RQMGGQLL 745          
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 170.244 bits (430), Expect = 7.113e-43
Identity = 246/1033 (23.81%), Postives = 409/1033 (39.59%), Query Frame = 3
Query:  393 QPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIE--WFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEY--GELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTS-----------RQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRY-STTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSY---SDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGR-ISLALSDINLTCPPN--SFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDS-------PPGYAQLAKDRLFLITNQLQRFCVVGSSYRNK-RATKVLRIAAYCTGLDRRHADEQ-IVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWH----SPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSN--KLSSTEILLDLWEAQNH-SRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            QPKS Y + ++ P  + C A   + +   C+ K       E      K+I  D+   +         S+++   DV        ++C C A    +Q      V S  A ++ +Y+ K F   P  Q+V    +++L C  P++ P AE+ W K+G  +     P   +     G L++S  RL+DSGNY+C A++    R     ++ ++  G WS+WS W G C        +CP +   +            Q+R R CN     N    C G E   + C + C     W+ WS+WS CS + C + RTR CT     N G+      +    C    C    +  + S+     S  SI+I             V+ F++ +  +FC  R       P +  +  S  A GI    P    +  L +     +     +    +    LP+S   L S +S  S  S+  + G+    IQ          ++   S  K T+ +R S    SD    +TLY  M   +  S L +  S ++          D+  +  S+++       +G  +I   +   G + + LA+SD  LT  P+       +S  I +  C+      ++SA++ +L              +P +++  HCA      NW  ++        +   WQK + +  E+ ++        PG          ++T  L R  + G   RN   A K + +A +  G     A  +   +R+Y +P+    +  V   E    G+RL+     F   +E GN+ + I D+   +   S +  + +   +  H       LHCS  F  + IN +    ++ V             YQ  S              S+   +   S +   Y A   +          K +    F+LP   K +L +LLD      +DWR LA+ L   R LQFF++    S T +LLDLWEA +  S +++ +L+  LR MGR D V +LE+ L
Sbjct:    9 QPKSGYVI-RNKPLRLQCRANHATKIRYKCSSKWIDDSRIE------KLIGTDSTSGVGY----IDASVDISRIDVDTSGHVDAFQCQCYASGDDDQ----DVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVV----QPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTC------HVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSS-CHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADSSRIVISDTAVYGSVASIFI-------------VASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHST-TLRSGKSAFSGYSSTRNAGSRAALIQE-------CSSSSSGSGGKRTM-LRTSSSNCSDDDNYATLYDYM---EDKSVLGLDTSQNIV-----AAQIDSNGARLSLSK-------SGARLIVPELAVEGEKMLYLAVSD-TLTDQPHLKPIESALSPVIVIGQCDV-----SMSAHDNILR-------------RPVVVSFRHCASTFPRDNWQFTLYAD-----EGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVF--GPTEMSAYRRPFELRVYCVPETGAAMESVWKQED---GSRLLCESNDFIL-NEKGNLCICIEDVIPGF---SCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIV-------------YQKAS--------------STEPMVMEVSNEPELYDATSEER--------EKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFL 910          
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 167.548 bits (423), Expect = 4.811e-42
Identity = 248/1033 (24.01%), Postives = 410/1033 (39.69%), Query Frame = 3
Query:  393 QPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIE--WFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEI--NEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTS-----------RQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRY-STTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSY---SDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGR-ISLALSDINLTCPPN--SFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDS-------PPGYAQLAKDRLFLITNQLQRFCVVGSSYRNK-RATKVLRIAAYCTGLDRRHADEQ-IVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWH----SPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSN--KLSSTEILLDLWEAQNH-SRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            QPKS Y + ++ P  + C A   + +   C+ K       E      K+I  D+   +         S+++   DV        ++C C A    +Q      V S  A ++ +Y+ K F   P  Q+V    +++L C  P++ P AE+ W K+G  +     P   +     G L++S  RL+DSGNY+C A++    R     ++ ++  G WS+WS W G C        +CP +   +            Q+R R CN     N    C G E   + C + C     W+ WS+WS CS + C + RTR CT     N G+      +    C    C    +  + S+     S  SI+I             V+ F++ +  +FC  R       P +  +  S  A GI    P    +  L +     +     +    +    LP+S   L S +S  S  S+  + G+    IQ          ++   S  K T+ +R S    SD    +TLY  M   +  S L +  S ++          D+  +  S+++       +G  +I   +   G + + LA+SD  LT  P+       +S  I +  C+      ++SA++ +L   V      V++F+       HCA      NW  ++        +   WQK + +  E+ ++        PG          ++T  L R  + G   RN   A K + +A +  G     A  +   +R+Y +P+    +  V   E    G+RL+     F   +E GN+ + I D+   +   S +  + +   +  H       LHCS  F  + IN +    ++ V             YQ  S              S+   +   S +   Y A   +          K +    F+LP   K +L +LLD      +DWR LA+ L   R LQFF++    S T +LLDLWEA +  S +++ +L+  LR MGR D V +LE+ L
Sbjct:   37 QPKSGYVI-RNKPLRLQCRANHATKIRYKCSSKWIDDSRIE------KLIGTDSTSGVGY----IDASVDISRIDVDTSGHVDAFQCQCYASGDDDQ----DVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVV----QPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTC------HVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSS-CHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADSSRIVISDTAVYGSVASIFI-------------VASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHST-TLRSGKSAFSGYSSTRNAGSRAALIQE-------CSSSSSGSGGKRTM-LRTSSSNCSDDDNYATLYDYM---EDKSVLGLDTSQNIV-----AAQIDSNGARLSLSK-------SGARLIVPELAVEGEKMLYLAVSD-TLTDQPHLKPIESALSPVIVIGQCDV-----SMSAHDNILRRPV------VVSFR-------HCASTFPRDNWQFTLYAD-----EGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVF--GPTEMSAYRRPFELRVYCVPETGAAMESVWKQED---GSRLLCESNDFIL-NEKGNLCICIEDVIPGF---SCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIV-------------YQKAS--------------STEPMVMEVSNEPELYDATSEER--------EKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFL 938          
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 156.762 bits (395), Expect = 7.904e-39
Identity = 223/917 (24.32%), Postives = 369/917 (40.24%), Query Frame = 3
Query:  732 INKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEY--GELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTS-----------RQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMY--IGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRY-STTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSY---SDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGR-ISLALSDINLTCPPN--SFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDS-------PPGYAQLAKDRLFLITNQLQRFCVVGSSYRNK-RATKVLRIAAYCTGLDRRHADEQ-IVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWH----SPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSN--KLSSTEILLDLWEAQNH-SRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            + K F   P  Q+V    +++L C  P++ P AE+ W K+G  +     P   +     G L++S  RL+DSGNY+C A++    R     ++ ++  G WS+WS W G C        +CP +   +            Q+R R CN     N    C G E   + C + C     W+ WS+WS CS + C + RTR CT     N G+      D+    EC   + +          + +S  +  D A+Y  +     V+ F++ +  +FC  R       P +  +  S  A GI    P    +  L +     +     +    +    LP+S   L S +S  S  S+  + G+    IQ          ++   S  K T+ +R S    SD    +TLY  M   +  S L +  S ++          D+  +  S+++       +G  +I   +   G + + LA+SD  LT  P+       +S  I +  C+      ++SA++ +L   V      V++F+       HCA      NW  ++        +   WQK + +  E+ ++        PG          ++T  L R  + G   RN   A K + +A +  G     A  +   +R+Y +P+    +  V   E    G+RL+     F   +E GN+ + I D+   +   S +  + +   +  H       LHCS  F  + IN +    ++ V             YQ  S              S+   +   S +   Y A   +          K +    F+LP   K +L +LLD      +DWR LA+ L   R LQFF++    S T +LLDLWEA +  S +++ +L+  LR MGR D V +LE+ L
Sbjct:    1 MRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVV----QPDANVIRASDGSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTC------HVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSS-CHRYRTRACTVPPPMNGGQPCFG--DDLMTQECPAQLCT----------ADSSRIVISDTAVYGSVASIFIVASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHST-TLRSGKSAFSGYSSTRNAGSRAALIQE-------CSSSSSGSGGKRTM-LRTSSSNCSDDDNYATLYDYM---EDKSVLGLDTSQNIV-----AAQIDSNGARLSLSK-------SGARLIVPELAVEGEKMLYLAVSD-TLTDQPHLKPIESALSPVIVIGQCDV-----SMSAHDNILRRPV------VVSFR-------HCASTFPRDNWQFTLYAD-----EGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVF--GPTEMSAYRRPFELRVYCVPETGAAMESVWKQED---GSRLLCESNDFIL-NEKGNLCICIEDVIPGF---SCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIV-------------YQKAS--------------STEPMVMEVSNEPELYDATSEER--------EKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFL 802          
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 135.576 bits (340), Expect = 3.301e-32
Identity = 204/855 (23.86%), Postives = 336/855 (39.30%), Query Frame = 3
Query:  915 LSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTS-----------RQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRY-STTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSY---SDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGR-ISLALSDINLTCPPN--SFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDS-------PPGYAQLAKDRLFLITNQLQRFCVVGSSYRNK-RATKVLRIAAYCTGLDRRHADEQ-IVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWH----SPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSN--KLSSTEILLDLWEAQNH-SRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            +S  RL+DSGNY+C A++    R     ++ ++  G WS+WS W G C        +CP +   +            Q+R R CN     N    C G E   + C + C     W+ WS+WS CS + C + RTR CT     N G+      +    C    C    +  + S+     S  SI+I             V+ F++ +  +FC  R       P +  +  S  A GI    P    +  L +     +     +    +    LP+S   L S +S  S  S+  + G+    IQ          ++   S  K T+ +R S    SD    +TLY  M   +  S L +  S ++          D+  +  S+++       +G  +I   +   G + + LA+SD  LT  P+       +S  I +  C+      ++SA++ +L              +P +++  HCA      NW  ++        +   WQK + +  E+ ++        PG          ++T  L R  + G   RN   A K + +A +  G     A  +   +R+Y +P+    +  V   E    G+RL+     F   +E GN+ + I D+   +   S +  + +   +  H       LHCS  F  + IN +    ++ V             YQ  S              S+   +   S +   Y A   +          K +    F+LP   K +L +LLD      +DWR LA+ L   R LQFF++    S T +LLDLWEA +  S +++ +L+  LR MGR D V +LE+ L
Sbjct:    1 MSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTC------HVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPCKLDGGWSSWSDWSACSSS-CHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLCTADSSRIVISDTAVYGSVASIFI-------------VASFILAILAMFCCKRGNSKKSKPLKPQKMNSEKAGGIYYSEPPGVRRLLLEHQHGTLLGEKISSCSQYFEPPPLPHSTT-LRSGKSAFSGYSSTRNAGSRAALIQE-------CSSSSSGSGGKRTM-LRTSSSNCSDDDNYATLYDYM---EDKSVLGLDTSQNIV-----AAQIDSNGARLSLSK-------SGARLIVPELAVEGEKMLYLAVSD-TLTDQPHLKPIESALSPVIVIGQCDV-----SMSAHDNILR-------------RPVVVSFRHCASTFPRDNWQFTLYAD-----EGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVF--GPTEMSAYRRPFELRVYCVPETGAAMESVWKQED---GSRLLCESNDFIL-NEKGNLCICIEDVIPGF---SCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIV-------------YQKAS--------------STEPMVMEVSNEPELYDATSEER--------EKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFL 743          
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 123.25 bits (308), Expect = 1.416e-28
Identity = 122/461 (26.46%), Postives = 197/461 (42.73%), Query Frame = 3
Query: 2034 ENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNV-------IAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDS-------PPGYAQLAKDRLFLITNQLQRFCVVGSSYRNK-RATKVLRIAAYCTGLDRRHADEQ-IVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWH----SPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSN--KLSSTEILLDLWEA-QNHSRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            +N++ A IDS+G R+SL+ S   L  P    A    + ++LA  ++  D P+L   E+ LSPV+V G  +V       I  +P +++  HCA      NW  ++        +   WQK + +  E+ ++        PG          ++T  L R  + G   RN   A K + +A +  G     A  +   +R+Y +P+    +  V   E    G+RL+     F   +E GN+ + I D+   +   S +  + +   +  H       LHCS  F  + IN +    ++ V             YQ  S              S+   +   S +   Y A   +          K +    F+LP   K +L +LLD      +DWR LA+ L   R LQFF++    S T +LLDLWEA  + S +++ +L+  LR MGR D V +LE+ L
Sbjct:  239 QNIVAAQIDSNGARLSLSKSGARLIVP--ELAVEGEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYAD-----EGSGWQKAVTIGEENLNTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAGHPRRNSLSAAKRVHLAVF--GPTEMSAYRRPFELRVYCVPETGAAMESVWKQED---GSRLLCESNDFIL-NEKGNLCICIEDVIPGF---SCDGPEVVEISETQHRFVAQNGLHCSLKFRPKEINGSQFSTRVIV-------------YQKAS--------------STEPMVMEVSNEPELYDATSEER--------EKGSVCVEFRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLERFL 648          
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0339998)

HSP 1 Score: 102.834 bits (255), Expect = 1.119e-21
Identity = 97/373 (26.01%), Postives = 147/373 (39.41%), Query Frame = 3
Query:  375 VPKFIQQPKSMYYVSKSHPAVITCIA--------------QPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWF---SEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEV-GQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-------------------LWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASS--VEIDNCTLAECGGFVASFI 1370
            +P F+ +P+S++ V K+ PAV+ C A              QP    +    D       EEV+AT                           H+D+++ F     ++C C AW+          V+S +A ++ +YI K F   P + ++ +    +L C PP   P  ++ W KN   IT  S P   ++  G L+   + L    NYSC A +    R + + +L+  V G WS WS W         +   C    S  R +R R CN     N  A C G +I+ K  D    P                     W+ WS+WS CS   C + R R+C T    + SS   E  +  L   G  +A+ I
Sbjct:  127 LPIFLIEPESVFVV-KNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHTGVNMEEVTAT--------------------------IHRDLVDEFFGDGPFKCECHAWS------SRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSA-GTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPW---------RECKCAGKPSQGR-KRSRTCNNPMPLNGGAQCPGPQIQ-KSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAE-CIQVRRRKCLTQGQTQISSEAEEAGDLLLGAPGVGMAALI 453          

HSP 2 Score: 95.5153 bits (236), Expect = 2.000e-19
Identity = 106/490 (21.63%), Postives = 208/490 (42.45%), Query Frame = 3
Query: 1926 PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMI--------WATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLL-SPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPY-WQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW-HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNH---------SRKSLNNLIDILRKMGRLDCVAIL 3335
            P+     D+  E G +    +  S       ++ NG+  I        +  + S+GG++ L   ++ L  P ++    + + + L   + E    + +   ++L S VV   P N    KP IL IPHC    +   W + +  + S   +    W++ + +  E+  + P + QL    +F++T QL  F VV    R ++ +  +++ A+       +A+    +R+Y++ D         N E  +LG   +   + F     + N+ + +   + D +A++   +  IP++ +  ++  LHC F+  ++                D N  C      +   +    +   + +GS+    S T+T  S    G       +V++    +F    +LP  TK  +C  LD     + DWR LA+ L+  R + +F+ K S TE +L+LWE + +            ++  L+  L++MGR D + I+
Sbjct:  615 PIDHLSVDYLSETGESSTADTSNST------FDMNGKLSILNASKSSTYEMLGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPHCLVAPE--QWHVHIYHADSEHDELSVNWRRAVSV-GEETINTPMFVQLEATHVFIMTEQLGHFTVVAEP-RIQQPSIKMKLLAFSQHTPPSNAN--CSLRIYVVKDFPNSRDICANVEA-KLGGSFLGESQVFAFTLNSRNLNIRVR--SADVEAAAPYEHA-IPYQHILSNNSILHCEFSLRRQ----------------DQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGN------YVNESCVMDF---VQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDII 1063          
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0087382)

HSP 1 Score: 102.834 bits (255), Expect = 1.119e-21
Identity = 97/373 (26.01%), Postives = 147/373 (39.41%), Query Frame = 3
Query:  375 VPKFIQQPKSMYYVSKSHPAVITCIA--------------QPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWF---SEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEV-GQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-------------------LWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASS--VEIDNCTLAECGGFVASFI 1370
            +P F+ +P+S++ V K+ PAV+ C A              QP    +    D       EEV+AT                           H+D+++ F     ++C C AW+          V+S +A ++ +YI K F   P + ++ +    +L C PP   P  ++ W KN   IT  S P   ++  G L+   + L    NYSC A +    R + + +L+  V G WS WS W         +   C    S  R +R R CN     N  A C G +I+ K  D    P                     W+ WS+WS CS   C + R R+C T    + SS   E  +  L   G  +A+ I
Sbjct:  127 LPIFLIEPESVFVV-KNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHTGVNMEEVTAT--------------------------IHRDLVDEFFGDGPFKCECHAWS------SRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSA-GTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPW---------RECKCAGKPSQGR-KRSRTCNNPMPLNGGAQCPGPQIQ-KSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDWSICSAE-CIQVRRRKCLTQGQTQISSEAEEAGDLLLGAPGVGMAALI 453          

HSP 2 Score: 95.5153 bits (236), Expect = 2.000e-19
Identity = 106/490 (21.63%), Postives = 208/490 (42.45%), Query Frame = 3
Query: 1926 PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMI--------WATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLL-SPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPY-WQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW-HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNH---------SRKSLNNLIDILRKMGRLDCVAIL 3335
            P+     D+  E G +    +  S       ++ NG+  I        +  + S+GG++ L   ++ L  P ++    + + + L   + E    + +   ++L S VV   P N    KP IL IPHC    +   W + +  + S   +    W++ + +  E+  + P + QL    +F++T QL  F VV    R ++ +  +++ A+       +A+    +R+Y++ D         N E  +LG   +   + F     + N+ + +   + D +A++   +  IP++ +  ++  LHC F+  ++                D N  C      +   +    +   + +GS+    S T+T  S    G       +V++    +F    +LP  TK  +C  LD     + DWR LA+ L+  R + +F+ K S TE +L+LWE + +            ++  L+  L++MGR D + I+
Sbjct:  615 PIDHLSVDYLSETGESSTADTSNST------FDMNGKLSILNASKSSTYEMLGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPHCLVAPE--QWHVHIYHADSEHDELSVNWRRAVSV-GEETINTPMFVQLEATHVFIMTEQLGHFTVVAEP-RIQQPSIKMKLLAFSQHTPPSNAN--CSLRIYVVKDFPNSRDICANVEA-KLGGSFLGESQVFAFTLNSRNLNIRVR--SADVEAAAPYEHA-IPYQHILSNNSILHCEFSLRRQ----------------DQNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGN------YVNESCVMDF---VQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDII 1063          
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Match: pyd (gene:FBgn0262614 transcript:FBtr0310205)

HSP 1 Score: 58.5362 bits (140), Expect = 4.217e-8
Identity = 31/99 (31.31%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 2055 IDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLP------NLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTS 2333
             DS+GG ++  L  ++L  PP +   G+ + I+    +            ++   ET+LSP+V+CGP  +    P  LNIPHCA  T S   A+    S
Sbjct: 2268 FDSNGGTLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPPLDMENGETMLSPLVMCGPQGLEFLVPVTLNIPHCAGRTASLGLALKATDS 2366          
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Match: pyd (gene:FBgn0262614 transcript:FBtr0305297)

HSP 1 Score: 58.5362 bits (140), Expect = 4.554e-8
Identity = 31/99 (31.31%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 2055 IDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLP------NLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTS 2333
             DS+GG ++  L  ++L  PP +   G+ + I+    +            ++   ET+LSP+V+CGP  +    P  LNIPHCA  T S   A+    S
Sbjct: 1963 FDSNGGTLADKLWHVSLQIPPGAIPAGVRQEIYFTVSDPRMGQAVGGPPLDMENGETMLSPLVMCGPQGLEFLVPVTLNIPHCAGRTASLGLALKATDS 2061          
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Match: robo1 (gene:FBgn0005631 transcript:FBtr0071922)

HSP 1 Score: 54.299 bits (129), Expect = 7.077e-7
Identity = 55/231 (23.81%), Postives = 97/231 (41.99%), Query Frame = 3
Query:  348 LPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCI--AQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNG------EKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEV 1016
            LP+ +     P+ I+ P  +  V K+ PA + C    +P   +  F  D +    NE+ S             R+  K     F   +Q K   +   EY C  +         +V +  S  A +  + +  DF+  PK+ +V+   +  L C PP   P   + W+K+G      + ++  +  +  I + G LL+SN+   D GNY C+A +    R ++   L+ +V
Sbjct:   46 LPAVRGQYQSPRIIEHPTDLV-VKKNEPATLNCKVEGKPEPTIEWF-KDGEPVSTNEKKSH------------RVQFKDGALFFYRTMQGKKEQDG-GEYWCVAK--------NRVGQAVSRHASLQIAVLRDDFRVEPKDTRVAKGETALLECGPPKGIPEPTLIWIKDGVPLDDLKAMSFGASSRVRIVDGGNLLISNVEPIDEGNYKCIAQNLVGTRESSYAKLIVQV 253          
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 288.886 bits (738), Expect = 3.970e-82
Identity = 275/1023 (26.88%), Postives = 439/1023 (42.91%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTS--IYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQ-MGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGS-----QSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L     D+   L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN E I       F I    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C          NKK     TS  +     VA+Y GL  A+ + +++V  +  L+ RR        +   S+       F+P                          Y+     N     P+   D ++ SA T  G  +  +Q+  L S   +PM  +PLL  + P+LKI+  Y+ S +SS   P  +G V         V S   DH+   G+T       S +               AT+ S GGR+++  + ++L  PP +   G    ++L     E+       ++T+LSPVV CGP+ ++  +P +L +PHCA   +  +W +++         +  W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q N                  T I  T    S   AGGS     Q  PY             F+LP   + K+C  LD+ +    DWR LAR L+  R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   19 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTKESL-----DHITGLVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCA--------RNKKVSVEHTSHPLGSGTGVAVYAGLVGALLLCVILVLCVGILVYRRSCRHLHGEITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPTAPPDLTA-SAGTFRG-PLFSLQQATLDSHHKIPMTTSPLLDPL-PSLKIK-VYNSSTMSSLELPTGLGSVDGDIMSLKTVGSGPKDHH---GHTLPREPSHSAS---------------ATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCA-QLEPPDWTLTLKMQ----NHQGAWEEVLTV-GEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLSLD-------YSLRVYCIQDTPHALKEVLEVERS-LGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEG----QIFQLN------------------TDIQETLPPHSPLPAGGSCLPSSQVGPY------------AFRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 908          
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 289.656 bits (740), Expect = 4.043e-82
Identity = 275/1023 (26.88%), Postives = 439/1023 (42.91%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTS--IYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQ-MGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGS-----QSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L     D+   L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN E I       F I    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C          NKK     TS  +     VA+Y GL  A+ + +++V  +  L+ RR        +   S+       F+P                          Y+     N     P+   D ++ SA T  G  +  +Q+  L S   +PM  +PLL  + P+LKI+  Y+ S +SS   P  +G V         V S   DH+   G+T       S +               AT+ S GGR+++  + ++L  PP +   G    ++L     E+       ++T+LSPVV CGP+ ++  +P +L +PHCA   +  +W +++         +  W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q N                  T I  T    S   AGGS     Q  PY             F+LP   + K+C  LD+ +    DWR LAR L+  R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   48 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTKESL-----DHITGLVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCA--------RNKKVSVEHTSHPLGSGTGVAVYAGLVGALLLCVILVLCVGILVYRRSCRHLHGEITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPTAPPDLTA-SAGTFRG-PLFSLQQATLDSHHKIPMTTSPLLDPL-PSLKIK-VYNSSTMSSLELPTGLGSVDGDIMSLKTVGSGPKDHH---GHTLPREPSHSAS---------------ATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCA-QLEPPDWTLTLKMQ----NHQGAWEEVLTV-GEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLSLD-------YSLRVYCIQDTPHALKEVLEVERS-LGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEG----QIFQLN------------------TDIQETLPPHSPLPAGGSCLPSSQVGPY------------AFRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 937          
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 287.345 bits (734), Expect = 2.372e-81
Identity = 271/1021 (26.54%), Postives = 435/1021 (42.61%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQ-MGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGS-----QSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L     D+   L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN E I       F I    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C   + S                    VA+Y GL  A+ + +++V  +  L+ RR        +   S+       F+P                          Y+     N     P+   D ++ SA T  G  +  +Q+  L S   +PM  +PLL  + P+LKI+  Y+ S +SS   P  +G V         V S   DH+   G+T       S +               AT+ S GGR+++  + ++L  PP +   G    ++L     E+       ++T+LSPVV CGP+ ++  +P +L +PHCA   +  +W +++         +  W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q N                  T I  T    S   AGGS     Q  PY             F+LP   + K+C  LD+ +    DWR LAR L+  R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   48 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTKESL-----DHITGLVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNFLITIEHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCSGSMMESKNCTEGLCARTLGSGTG-----------------VAVYAGLVGALLLCVILVLCVGILVYRRSCRHLHGEITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPTAPPDLTA-SAGTFRG-PLFSLQQATLDSHHKIPMTTSPLLDPL-PSLKIK-VYNSSTMSSLELPTGLGSVDGDIMSLKTVGSGPKDHH---GHTLPREPSHSAS---------------ATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCA-QLEPPDWTLTLKMQ----NHQGAWEEVLTV-GEESLSSPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLSLD-------YSLRVYCIQDTPHALKEVLEVERS-LGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEG----QIFQLN------------------TDIQETLPPHSPLPAGGSCLPSSQVGPY------------AFRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 926          
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 248.825 bits (634), Expect = 6.012e-68
Identity = 253/1017 (24.88%), Postives = 426/1017 (41.89%), Query Frame = 3
Query:  375 VPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVS------ATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVS--------TLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNF-NGENMIW--ATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLS--ANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDL-AMDWQASSANNYQEIPFKDVW---HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVD-DCSKTN--FESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRL 3317
            +P F+Q+P   Y V KS+P  + C A+P   +   C + ++ + N+  S       TGLK+ ++               ++  Q  +      +Y C C AW+ +         +S  A +  +Y+ K+F+  P+  +V + G + L C PP+  P AE+ W+KN E +        +      L+++  RL+DSGNY+C+AS+     R ATA ++VF  G WS W++W           S C   C    Q+R R C      N  A C G  ++   C   C  +  W+ W+ WS+C+ + C+++RTR+CT     + G+    ++++ DNCT   C       +  + K P++   +  ++DVA+Y GL  A  V  MVV +I   + RR        V   S    G Q F                            ++S    N L    S Q D + +  YT        +++  +P  P +  PL     P LK+       KV S+    +G+ +           T P  V   +              S  +  +P L  +  NG+  +         GGR+ +  + ++L  P  +     +  ++++   ++QD   LS  A E LLSP V  GP  +    P  L + HCA + +S +W I +        Q   W++ + L+ E   S   Y  L      L+  +   + +VG +  ++ A K LR+AA+   ++    +  I  R+Y + D      +V + E  R G RL+   K       + ++ V I D+    W        QE  F  VW    SP L C+F+  +    AN    KISV  +  +    L +Y T +   K TV                               P+F   DC+ T+      FK+P+  + ++C   D+      DW+ LA+ L I R+L +F+ + S + ++L LWEAQ+  +  L++L   L ++G++
Sbjct:   43 LPHFLQEPDDAYIV-KSNPIKLRCRARPALQIFFKC-NGEWVHQNQHTSLEHIELGTGLKIREV-------------MINVSRQQVEDFHGPEDYWCLCVAWSHL------GTAKSRKATVRIAYLRKNFEQEPQGMEVPINGMIVLHCRPPEGVPAAEVEWLKNEELVHSLEDINIDTRADHNLIINEARLSDSGNYTCLASNIVARRRSATAMVIVFVNGGWSSWTDW-----------SECNVRCGRGVQKRTRTCTNPAPLNGGAFCEGMSVQKSTCTSPCPVDGGWSEWTMWSECT-SECERQRTRECTDPEPKHGGRLCDGAALDTDNCTGDLC--IQDRKLLHDVKVPQA--DVESSNDVALYSGL--AAGVVTMVVLVIAVTLYRRNQSEYGVDVIDSSALTGGFQSFS---------------------------FKSARQGNPLLMNSSMQPDLTVSRTYTSPICFPDSMEKELIPE-PALFDPL-----PDLKV-------KVHSSFMVSLGVSERAEYHAKAPSQTFPRGVVQEIGGGGGT--LGGRGKSQLTSIQPALISSMTNGKRALRTSGVFGHGGGRLVVPNAGVSLLVPHGAIEEDTTWELYMSI--TQQDSSALSDEAQEILLSPEVTYGPPGLSLSCPVALTVAHCA-DVNSEDWNIKLKRQ----TQDNSWEEVMILEEE---STSCYCLLDTQCCHLLVERPGCYALVGEAL-SQAAGKRLRLAAF-GNMEPNFLNYSI--RVYCVDDTPHAFQEVVSVERGR-GGRLLEEPKTLLFRANSFSLQVSIQDIPQFLWSIKPFTTCQEFSFSQVWCSSQSP-LQCAFSLERYSPAANQLSCKISVRQVKGHEQ-ILQVYTTIAESEKDTV-------------------------------PFFTQSDCTITSQTGSRAFKIPQSIRQRICATFDTANAKGKDWQLLAQKLHIDRNLGYFARQTSPSAVILSLWEAQHQEQGDLDSLASALEEIGKV 930          
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Match: unc5a (unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-080219-19])

HSP 1 Score: 173.326 bits (438), Expect = 9.292e-44
Identity = 134/449 (29.84%), Postives = 208/449 (46.33%), Query Frame = 3
Query: 2028 NGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPY---WQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYR---NKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKT-NFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            NG N  + T +  GGR++L  + I+L  PP +   G    I+L     E     L+  +TLLSPVV CGP  V+  +P IL + HC+ +    NWAI        LK++ Y   W+  L L  ED  S P Y QL  +   + T QL RF +VG S      KR   +L   AYC+ L+         +R+Y   D  + + +V   E  +LG RL+        +D   N+ + I D+    W++     YQEIPF  +W     TLHCSF   ++           S+++ D +  CTL ++Q        ++  +         I    + F              +++CS      S F++P   + K+C  LD+  P   DWR LA+ L + R + FF++K S T ++LDLWE Q+    +LN L  ++ ++G+ + +  L  D
Sbjct:  457 NG-NTSYGTFNFLGGRLTLPNTGISLLIPPEAIPRGKIYEIYLTIQKKEDMRLPLAGCQTLLSPVVSCGPPGVMLTRPVILCMDHCS-DACLENWAIR-------LKKQSYEGTWEDVL-LLGEDLLSEPYYCQLEAETCRVFTEQLGRFALVGESLSMAAAKRLKLLLFAPAYCSTLEYN-------IRVYCTDDTQDLLKEVMQME-RQLGGRLIDEPHVLLFKDSYHNLRLSIHDMPHTHWRSKLLAGYQEIPFYHIWSGSQRTLHCSFTLERQ-----------SLSTSDLS--CTLCVWQVEGEGQSFSLDFNIAK-----DIRPLDSDF------------LLLENCSPALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRLLAQRLKLDRHMSFFASKSSPTSVILDLWETQHFHSGNLNQLAAVMAEIGKQEAMIFLVSD 857          

HSP 2 Score: 115.161 bits (287), Expect = 1.787e-25
Identity = 77/281 (27.40%), Postives = 131/281 (46.62%), Query Frame = 3
Query:  375 VPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEV------SATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERH-ATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRC 1190
            +P F+ +P  +Y V K+ P  +TC + P + +   C + ++ + ++ +       ATGL V+++             K  +  Q  + I    +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V++   + L C PP+  PPAE+ W +N E I  K+ P F I     L++   RL D+GNY+CVA +    R  ++A ++V+  G WS+WS+W           S C   CS  R    R C Q        +C G +++   C
Sbjct:   51 LPHFLIEPDDVYIV-KNKPVTLTCRSTPATQIYFKC-NGEWVHQDQHLIDRDVDPATGLPVMQV-------------KIDISRQQVEKIFGLEDYWCQCVAWS------TTGTQKSQKAFVRIAYLRKNFEEEPLGKEVALDQELLLRCHPPEGVPPAEVEWQRNEELIDPKTDPNFFITTDHNLIIKQTRLADTGNYTCVAKNIVARRKSSSATVIVYVDGGWSEWSKW-----------SPCGADCSMWRS---RECTQPTPGTGGKDCQGLDLQSLNC 296          
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 316.235 bits (809), Expect = 2.040e-91
Identity = 273/1014 (26.92%), Postives = 449/1014 (44.28%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R +T A ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C          NK+    + S  +  T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                    +N    +++    NS    P+ Q D ++N+    +     Y  ++    +PM  +PLL  + P LKI+  ++ S V S+     G+      L + P  +  SD+     N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA +  + +W + + T       +  W++ + L+ E  ++P  Y QL      ++ +QL  +  VG SY +K A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV + K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q   H + +  + S     SHT  S T TQ   Y+                      FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   35 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDEVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLC--------MQNKRVLGETKSHLLESTGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCRELDTDITDSSAALTG--GFHP--------------------VN----FKTSRHDNSHLIHPAMQPDLTANAG---IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VFNSSTVGSS----PGIHDGNDLLGVKPTGTYPSDN-----NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DIATSDWILQLKTQ----SHQGNWEEVVTLNEETLNTP-CYCQLESHSCHILLDQLGTYAFVGESY-SKSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEDPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL--HTSLEENVKSFDPFCSHTENSVT-TQLGPYA----------------------FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 927          
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 315.849 bits (808), Expect = 3.590e-91
Identity = 273/1014 (26.92%), Postives = 449/1014 (44.28%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R +T A ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C          NK+    + S  +  T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                    +N    +++    NS    P+ Q D ++N+    +     Y  ++    +PM  +PLL  + P LKI+  ++ S V S+     G+      L + P  +  SD+     N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA +  + +W + + T       +  W++ + L+ E  ++P  Y QL      ++ +QL  +  VG SY +K A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV + K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q   H + +  + S     SHT  S T TQ   Y+                      FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   48 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDEVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLC--------MQNKRVLGETKSHLLESTGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCRELDTDITDSSAALTG--GFHP--------------------VN----FKTSRHDNSHLIHPAMQPDLTANAG---IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VFNSSTVGSS----PGIHDGNDLLGVKPTGTYPSDN-----NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DIATSDWILQLKTQ----SHQGNWEEVVTLNEETLNTP-CYCQLESHSCHILLDQLGTYAFVGESY-SKSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEDPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL--HTSLEENVKSFDPFCSHTENSVT-TQLGPYA----------------------FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 940          
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 314.694 bits (805), Expect = 6.722e-91
Identity = 271/1012 (26.78%), Postives = 445/1012 (43.97%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R +T A ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C   + S                 T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                    +N    +++    NS    P+ Q D ++N+    +     Y  ++    +PM  +PLL  + P LKI+  ++ S V S+     G+      L + P  +  SD+     N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA +  + +W + + T       +  W++ + L+ E  ++P  Y QL      ++ +QL  +  VG SY +K A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV + K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q   H + +  + S     SHT  S T TQ   Y+                      FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   48 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDEVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLCMQMLES-----------------TGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCRELDTDITDSSAALTG--GFHP--------------------VN----FKTSRHDNSHLIHPAMQPDLTANAG---IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VFNSSTVGSS----PGIHDGNDLLGVKPTGTYPSDN-----NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DIATSDWILQLKTQ----SHQGNWEEVVTLNEETLNTP-CYCQLESHSCHILLDQLGTYAFVGESY-SKSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEDPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL--HTSLEENVKSFDPFCSHTENSVT-TQLGPYA----------------------FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 929          
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 312.383 bits (799), Expect = 4.653e-90
Identity = 270/1019 (26.50%), Postives = 439/1019 (43.08%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSL-------PMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R +T A ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C   + S                 T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                                   + F  S    A+      + G     I R H+ +L       PM  +PLL  + P LKI+  ++ S V S+     G+      L + P  +  SD+     N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA +  + +W + + T       +  W++ + L+ E  ++P  Y QL      ++ +QL  +  VG SY +K A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV + K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q ++   +   ++S     SHT  S T TQ   Y+                      FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   48 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDEVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLCMQMLES-----------------TGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCRELDTDITDSSAALTG--GFHP-----------------------------------VNFKTSRHGKANVPDLTANAG-----IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VFNSSTVGSS----PGIHDGNDLLGVKPTGTYPSDN-----NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DIATSDWILQLKTQ----SHQGNWEEVVTLNEETLNTP-CYCQLESHSCHILLDQLGTYAFVGESY-SKSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEDPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQLHTSLEEAPTVISFDPFCSHTENSVT-TQLGPYA----------------------FKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 925          
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Match: UNC5B (unc-5 netrin receptor B [Source:NCBI gene;Acc:100492290])

HSP 1 Score: 311.997 bits (798), Expect = 7.017e-90
Identity = 271/1014 (26.73%), Postives = 446/1014 (43.98%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R + TA ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C          NK+    + S  +  T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                    +N    +++    NS    P+ Q D ++N+    +     Y  ++    +PM  +PLL  + P LKI+  ++ S V S+     G+      L + P  +  SD+     N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA +  + +W + + T       +  W++ + L+ E  ++ P Y QL      ++ +QL  +  VG SY +K A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV + K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q                   HTS+     +  N S   +Q  PY             FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   49 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDEVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRAYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLC--------MQNKRVLGETKSHLLESTGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCRELDTDITDSSAALTG--GFHP--------------------VN----FKTSRHDNSHLIHPAMQPDLTANAG---IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VFNSSTVGSS----PGIHDGNDLLGVKPTGTYPSDN-----NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DIATSDWILQLKTQ----SHQGNWEEVVTLNEETLNT-PCYCQLESHSCHILLDQLGTYAFVGESY-SKSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEDPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL------------------HTSLE----EVRNNSV-TTQLGPY------------AFKIPYSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 931          
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Match: Unc5b (unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI:894703])

HSP 1 Score: 295.049 bits (754), Expect = 5.730e-84
Identity = 274/1017 (26.94%), Postives = 442/1017 (43.46%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVS------ATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ V+      ATGL+V ++                +EV  + V E F   +Y C C AW+           +S  A I  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  +C  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C       +N  K +P     +  + DVA+Y GL VAV V + V+  +  ++ RR        +   S    G   F+P                     N P L      P++ P L          +A   +     Y  ++    +PM  +PLL  + P+LKI+  Y+ S + S      GL      L +    +    +    +  +  S    ++  L    +  + +  T    GGR+SL  + ++L  P  +   G    ++L    +E  LP    ++T+LSP V CGPT ++  +P +L +PHCA    +G+W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +  +G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + D+    W++     YQEIPF  VW+     LHC+F   +  + +     K+ V  ++        I+Q +      T L  TP GS     SA     +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA+      LN+L   L +MG+ + +  +  D
Sbjct:   45 EQLPYFLLEPQDAYIV-KNKPVELHCRAFPATQIYFKC-NGEWVSQNDHVTQESLDEATGLRVREVQ---------------IEVSRQQVEELFGLEDYWCQCVAWS------SSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCV-LNQRTLNDPKSHP-----LETSGDVALYAGLVVAVFVVVAVLMAVGVIVYRRNCRDFDTDITDSSAALTG--GFHP-------------VNFKTARPNNPQLLH----PSAPPDL----------TASAGIYRGPVYALQDSADKIPMTNSPLLDPL-PSLKIK-VYNSSTIGSG----SGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCA-EVIAGDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEAKSCHILLDQLGTYVFMGESY-SRSAVKRLQLAIFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQRALHCTFTLERHSLASTEFTCKVCVRQVEGEG----QIFQLH------TTLAETPAGSLDALCSAPGNAIT------TQLGPY------------AFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMATD 942          
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 290.812 bits (743), Expect = 1.683e-82
Identity = 261/1016 (25.69%), Postives = 441/1016 (43.41%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAEC-GGFVASFINSNKKYPESS-TSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLD--LDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C  GF+      ++   E   +S   + DVA+Y+G+ +AV+V L +  ++   + R+      + +   S    G Q            +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   S   V+    PQ  L +  S L   ++ SL ++  E  N  N++  +     C  +          T +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P IL + HCA +  + +W I        LK +    ++ D  +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + +V   E  ++G +L+   K    +    N+ + I D+A   W++     YQEIPF  +W      LHC+F   +  +N      K+ V  ++        I+Q N   +++   +  P     ++I+  +                           S F +P   + KLC  LD+     +DWR LA  L++ R L +F+ K S T ++LDLWEAQN    +L+ L  +L +MGR + V  L  +
Sbjct:   59 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDFESDIIDSSALNGGFQ-------PVNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNSSGAVT----PQDDLAEFSSKLSPQMTQSLLEN--EALNLKNQSLARQTDPSCTAF---------GTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCA-DPSTEDWKIQ-------LKNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEVLQLE-RQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEG----QIFQLNCTVSEEPTGIDLPLLDPASTITTVTG-------------------------PSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 947          
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 290.812 bits (743), Expect = 1.683e-82
Identity = 261/1016 (25.69%), Postives = 441/1016 (43.41%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAEC-GGFVASFINSNKKYPESS-TSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLD--LDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C  GF+      ++   E   +S   + DVA+Y+G+ +AV+V L +  ++   + R+      + +   S    G Q            +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   S   V+    PQ  L +  S L   ++ SL ++  E  N  N++  +     C  +          T +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P IL + HCA +  + +W I        LK +    ++ D  +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + +V   E  ++G +L+   K    +    N+ + I D+A   W++     YQEIPF  +W      LHC+F   +  +N      K+ V  ++        I+Q N   +++   +  P     ++I+  +                           S F +P   + KLC  LD+     +DWR LA  L++ R L +F+ K S T ++LDLWEAQN    +L+ L  +L +MGR + V  L  +
Sbjct:   59 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAITVVVALFVYRKNHRDFESDIIDSSALNGGFQ-------PVNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNSSGAVT----PQDDLAEFSSKLSPQMTQSLLEN--EALNLKNQSLARQTDPSCTAF---------GTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCA-DPSTEDWKIQ-------LKNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEVLQLE-RQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEG----QIFQLNCTVSEEPTGIDLPLLDPASTITTVTG-------------------------PSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 947          
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Match: Unc5b (unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI:894703])

HSP 1 Score: 290.426 bits (742), Expect = 1.727e-82
Identity = 271/1017 (26.65%), Postives = 438/1017 (43.07%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVS------ATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ V+      ATGL+V ++                +EV  + V E F   +Y C C AW+           +S  A I  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  +C  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C                   ++  + DVA+Y GL VAV V + V+  +  ++ RR        +   S    G   F+P                     N P L      P++ P L          +A   +     Y  ++    +PM  +PLL  + P+LKI+  Y+ S + S      GL      L +    +    +    +  +  S    ++  L    +  + +  T    GGR+SL  + ++L  P  +   G    ++L    +E  LP    ++T+LSP V CGPT ++  +P +L +PHCA    +G+W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +  +G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + D+    W++     YQEIPF  VW+     LHC+F   +  + +     K+ V  ++        I+Q +      T L  TP GS     SA     +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA+      LN+L   L +MG+ + +  +  D
Sbjct:   45 EQLPYFLLEPQDAYIV-KNKPVELHCRAFPATQIYFKC-NGEWVSQNDHVTQESLDEATGLRVREVQ---------------IEVSRQQVEELFGLEDYWCQCVAWS------SSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLC-----------------VLTLETSGDVALYAGLVVAVFVVVAVLMAVGVIVYRRNCRDFDTDITDSSAALTG--GFHP-------------VNFKTARPNNPQLLH----PSAPPDL----------TASAGIYRGPVYALQDSADKIPMTNSPLLDPL-PSLKIK-VYNSSTIGSG----SGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCA-EVIAGDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEAKSCHILLDQLGTYVFMGESY-SRSAVKRLQLAIFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQRALHCTFTLERHSLASTEFTCKVCVRQVEGEG----QIFQLH------TTLAETPAGSLDALCSAPGNAIT------TQLGPY------------AFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMATD 931          
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 285.804 bits (730), Expect = 8.115e-81
Identity = 259/1014 (25.54%), Postives = 436/1014 (43.00%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLD--LDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  + V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN + I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  ++   C  +C  +  WT WS+WS C G  C   R R+CT     N GK      ++  NCT   C           +  P+S        DVA+Y+G+ +AV+V L +  ++   + R+      + +   S    G Q            +   +      D+ +  ++YR  V                   A  DV + I           PM  +P+L  + P LKI+   S   V+    PQ  L +  S L   ++ SL ++  E  N  N++  +     C  +          T +S GG + +  S ++L  P  +   G    +++     E   P +  ++TLL+PVV CGP   +  +P IL + HCA +  + +W I        LK +    ++ D  +  E+  + P Y QL  +   ++T  L  + +VG S   K A K L++A +    C+ L+         +R+Y + D  + + +V   E  ++G +L+   K    +    N+ + I D+A   W++     YQEIPF  +W      LHC+F   +  +N      K+ V  ++        I+Q N   +++   +  P     ++I+  +                           S F +P   + KLC  LD+     +DWR LA  L++ R L +F+ K S T ++LDLWEAQN    +L+ L  +L +MGR + V  L  +
Sbjct:   59 EPLPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKC-NSEWVHQKDHVVDE-----RVDETSGLIVR----EVSIEISRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTSWSKWSTC-GTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLC----------MQAAPDSD-------DVALYVGIVIAVTVCLAITVVVALFVYRKNHRDFESDIIDSSALNGGFQ-------PVNIKAARQDLLAVPPDLTSAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPILDPL-PNLKIKVYNSSGAVT----PQDDLAEFSSKLSPQMTQSLLEN--EALNLKNQSLARQTDPSCTAF---------GTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCA-DPSTEDWKIQ-------LKNQAVQGQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGQS-TTKAAAKRLKLAIFGPLCCSSLEYS-------IRVYCLDDTQDALKEVLQLE-RQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWSGSQRNLHCTFTLERLSLNTVELVCKLCVRQVEGEG----QIFQLNCTVSEEPTGIDLPLLDPASTITTVTG-------------------------PSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Match: sp|Q8JGT4|UN5BA_XENLA (Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 GN=unc5b-a PE=2 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 6.505e-88
Identity = 267/1013 (26.36%), Postives = 442/1013 (43.63%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAV-SVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ ++       ++D+   L V+    +  +EV  + V E F   +Y C C AW+           +S  + +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CV+ +   +R + TA ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C         +  +  ES      T DVA+Y GL VA+  V ++++A+   + RR    F  +     +    G   F+P                    +N    +++    NS    P+ Q D ++N+     GN   Y  ++    +PM  +PLL  + P LKI+  Y+ S V S+     G+    + L   P  +  SD+        N +    +T P      +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA + ++ +W + + T       +  W++ + L+ E  ++ P Y QL       + +QL  +  VG SY ++ A K L++A +    CT L+         +++Y + D  + + +V   E   LG  LV   K    +D   N+ + I D+    W++     YQEIPF  +W     TLHC+F   +  + A     KI V  ++        I+Q                   HT +      F  + +    S    +           FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   48 ESLPHFLLEPEDAYIV-KNKPVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDDVTGLVVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDPTKDTNFLITIDHNLIIKQARLSDTANYTCVSKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLCMQNKRVLGETKSRLLES------TGDVALYAGLVVAIFIVIILLMAVGIVVYRRNCREFDTDITDSSAALTGG---FHP--------------------VN----FKTSRHDNSQLIHPAMQPDLTANAGIYR-GN--MYALQDSADKIPMTNSPLLDPL-PNLKIK-VYNSSTVGSS----PGIHDGNNLLGTKPTGTYPSDNNIMNARNKNMSMQHLLTLP-----RDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCA-DINTSDWILQLKTQ----SHQGNWEEVVTLNEETLNT-PCYCQLESHSCHTLLDQLGTYAFVGESY-SRSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLVEEPKLLMFKDSYHNLRLSIHDIPHSLWRSKLMAKYQEIPFYHIWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL------------------HTLLEENVKSFDPFCSQAENSVTTHLG-------PYAFKIPFSIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 940          
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Match: sp|Q8IZJ1|UNC5B_HUMAN (Netrin receptor UNC5B OS=Homo sapiens OX=9606 GN=UNC5B PE=1 SV=2)

HSP 1 Score: 307.76 bits (787), Expect = 1.313e-87
Identity = 286/1046 (27.34%), Postives = 452/1046 (43.21%), Query Frame = 3
Query:  300 WDSKENHEVDSKKDLVLPSE---KHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVF---LMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSD-----HYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            WD + +         VLP        E +P F+Q+P+  Y V K+ P  + C A P + +   C + ++   N+ V+  GL     D    L V+    +  +EV  + V E F   +Y C C AW+           +S  A +  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  IC  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C     +  + N    E+S       D A+Y GL VA+ V    LM V ++  + RR    F  +     +    G   F+P                    +N    +++    N     PS   D ++++    +     Y  ++    +PM  +PLL  + P+LK++  YS S   S      GL      L + P  +  SD     H+  L  + +  S Q +  P  P      + +  T    GGR+S+  + ++L  P  +   G    ++L    +E  LP     +T+LSP V CGPT ++  +P IL +PHCA    + +W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +   G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + DL    W++     YQEIPF  +W      LHC+F   +  + +     KI V  ++        I+Q +      T L  TP GS  T  SA  +  +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA       LN+L   L +MG+ + +  +  D
Sbjct:   19 WDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV-KNKPVELRCRAFPATQIYFKC-NGEWVSQNDHVTQEGL-----DEATGLRVR----EVQIEVSRQQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTLSDPNSHLLEASG------DAALYAGLVVAIFVVVAILMAVGVV--VYRRNCRDFDTDITDSSAALTGG---FHP--------------------VN----FKTARPSNPQLLHPSVPPDLTASAG---IYRGPVYALQDSTDKIPMTNSPLLDPL-PSLKVK-VYSSSTTGSG----PGLADGADLLGVLPPGTYPSDFARDTHFLHL-RSASLGSQQLLGLPRDP-----GSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCA-EVSARDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEPRACHILLDQLGTYVFTGESY-SRSAVKRLQLAVFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEG----QIFQLH------TTLAETPAGSLDTLCSAPGSTVT------TQLGPY------------AFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATD 942          
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Match: sp|C5IAW9|UN5BB_XENLA (Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 GN=unc5b-b PE=1 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.795e-87
Identity = 271/1014 (26.73%), Postives = 445/1014 (43.89%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQC---TTNNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPI-PVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+    + C A P + +   C + ++   N+ ++       ++D+   L V+    +  +EV  + V E F   ++ C C AW+           +S  + +  +Y+ K+F   P  ++V++     L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R +T A ++VF  G WS W+EW           S C   C    Q+R R C      N    C G + +   C+ +C  +  WT WS+WS CS   C   R+R+C   T  N GK  S   ++  NCT   C          NK+    + S  +  T DVA+Y GL VA+ + ++++  +  ++ RR        +   S    G   F+P                    +N    +++    NS    P+ Q D ++N+    +     Y  ++    +PM  +PLL  + P LKI+  Y+ S V S+     G+      L   P  +  SD      N  N  +    T+  L    +  N +  T  S GGR++   + ++L  P  +   G    ++L     E  +      +T+LSP++ CGPT ++  KP IL +PHCA  T S +W + + T       +  W++ + L+ E  ++P  Y QL      ++ +QL  +  VG SY ++ A K L++A +    CT L+         +++Y + D  + + +V   E   LG  L+   K    +D   N+ + I D+    W++     YQEIPF  VW     TLHC+F   +  + A     KI V  ++        I+Q   H + +  + S     SH   S T TQ   Y+                      FK+P   + K+C  LD+     NDWR LA+ L + R L +F+ K S T ++LDLWEA +     LN L   L +MG+ + + ++  D
Sbjct:   48 ESLPHFLLEPEDAYIV-KNKAVELVCKANPATQIYFKC-NGEWVNQNDHITKE-----RVDDVTGLVVR----EVQIEVSRQQVEELFGLEDFWCQCVAWS------SAGTTKSKRSYVRIAYLRKNFDQEPLGKEVALEQEALLQCRPPEGVPPAEVEWLKNEEIIDSTKDTNFLITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVFVNGGWSSWTEW-----------SPCNNRCGHGWQKRTRTCTNPAPLNGGTMCEGQQYQKFACNTMCPVDGGWTEWSKWSACS-TECTHWRSRECNAPTPKNGGKDCSGMLLDSKNCTDGLC--------MQNKRVLGETKSHLLESTGDVALYAGLVVAIFIIIILLMAVGIVVYRRNCREFDTDITDSSAALTG--GFHP--------------------VN----FKTSRHDNSHLIHPAMQPDLTANAG---IYRGHMYALQDSADKIPMTNSPLLDPL-PNLKIK-VYNSSTVGSS----PGIHDGNDLLGAKPTGTYPSD------NIMNARNKNMSTQHLLTLPRDSSNSVTGTFGSLGGRLTFPNTGVSLLIPQGAIPQGKYYEMYLMINKRENTVLPSEGTQTILSPIITCGPTGLLLCKPVILTVPHCADITTS-DWILQLKTQ----SHQGNWEEVVTLNEETLNTP-CYCQLESHSCHILLDQLGTYAFVGESY-SRSAIKRLQLAIFAPMLCTSLEYN-------LKVYCVEDTPDALKEVLELEKT-LGGYLIEEPKPLMFKDSYHNLRLSIHDIPHSLWRSKLLAKYQEIPFYHVWSGSQRTLHCTFTLERYSLAATELTCKICVRQVEGEG----QIFQL--HTSLEENVKSFDPFCSHAENSVT-TQLGPYA----------------------FKIPFLIRQKICNSLDAPNSRGNDWRLLAQKLCMDRYLNYFATKASPTGVILDLWEALHQDDGDLNTLASALEEMGKSEMMLVMATD 939          
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Match: sp|Q8K1S3|UNC5B_MOUSE (Netrin receptor UNC5B OS=Mus musculus OX=10090 GN=Unc5b PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 4.008e-83
Identity = 274/1017 (26.94%), Postives = 442/1017 (43.46%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVS------ATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++   N+ V+      ATGL+V ++                +EV  + V E F   +Y C C AW+           +S  A I  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  +C  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C       +N  K +P     +  + DVA+Y GL VAV V + V+  +  ++ RR        +   S    G   F+P                     N P L      P++ P L          +A   +     Y  ++    +PM  +PLL  + P+LKI+  Y+ S + S      GL      L +    +    +    +  +  S    ++  L    +  + +  T    GGR+SL  + ++L  P  +   G    ++L    +E  LP    ++T+LSP V CGPT ++  +P +L +PHCA    +G+W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +  +G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + D+    W++     YQEIPF  VW+     LHC+F   +  + +     K+ V  ++        I+Q +      T L  TP GS     SA     +      +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA+      LN+L   L +MG+ + +  +  D
Sbjct:   45 EQLPYFLLEPQDAYIV-KNKPVELHCRAFPATQIYFKC-NGEWVSQNDHVTQESLDEATGLRVREVQ---------------IEVSRQQVEELFGLEDYWCQCVAWS------SSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCV-LNQRTLNDPKSHP-----LETSGDVALYAGLVVAVFVVVAVLMAVGVIVYRRNCRDFDTDITDSSAALTG--GFHP-------------VNFKTARPNNPQLLH----PSAPPDL----------TASAGIYRGPVYALQDSADKIPMTNSPLLDPL-PSLKIK-VYNSSTIGSG----SGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGKFYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCA-EVIAGDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEAKSCHILLDQLGTYVFMGESY-SRSAVKRLQLAIFAPALCTSL-------EYSLRVYCLEDTPVALKEVLELERT-LGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQRALHCTFTLERHSLASTEFTCKVCVRQVEGEG----QIFQLH------TTLAETPAGSLDALCSAPGNAIT------TQLGPY------------AFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMATD 942          
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Match: sp|O08722|UNC5B_RAT (Netrin receptor UNC5B OS=Rattus norvegicus OX=10116 GN=Unc5b PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 5.745e-83
Identity = 272/1019 (26.69%), Postives = 442/1019 (43.38%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADK---QYSYMNEEV--SATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHAT-AQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFL---MVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIA----AYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P F+ +P+  Y V K+ P  + C A P + +   C  +   Q  ++ +E    ATGL++ ++                +EV  + V E F   +Y C C AW+           +S  A I  +Y+ K+F   P  ++V +   V L C PP+  P AE+ W+KN + I       F +     L++   RL+D+ NY+CVA +   +R +T A ++V+  G WS W+EW+  C N C +G           Q+R R C      N  A C G   +   C  +C  +  WT WS+WS CS   C   R+R+C      N G+  S   ++  NCT   C       +N        S  +  + DVA+Y GL VAV V L   M V +I  + RR    F  +     +    G   F+P                    +N    +++    N     PS   D ++++    +     Y  ++    +PM  +PLL  + P+LKI+  Y  S + S      GL      L +    +    +    +  +  S    ++  L    +  + +  T    GGR+++  + ++L  P  +   G    ++L    +E  LP    ++T+LSP V CGPT ++  +P +L +PHCA    +G+W   + T       + +W++ + LD E  ++P  Y QL      ++ +QL  +   G SY ++ A K L++A    A CT L       +  +R+Y + D    + +V   E   LG  LV   K    +D   N+ + + D+    W++     YQEIPF  VW+     LHC+F   +  + +     K+ V  ++        I+Q +      T L  TP GS     SA        +A  +Q  PY             FK+P   + K+C  LD+     NDWR LA+ LS+ R L +F+ K S T ++LDLWEA+      LN+L   L +MG+ + +  +  D
Sbjct:   45 EQLPHFLLEPEDAYIV-KNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQ---------------IEVSRQQVEELFGLEDYWCQCVAWS------SSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWS-PCSNRCGRG----------WQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACS-TECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLC------VLNQRTLNDPKSRPLEPSGDVALYAGLVVAVFVVLAVLMAVGVI--VYRRNCRDFDTDITDSSAALTGG---FHP--------------------VN----FKTARPSNPQLLHPSAPPDLTASAG---IYRGPVYALQDSADKIPMTNSPLLDPL-PSLKIK-VYDSSTIGSG----AGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLTIPGTGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCA-EVIAGDWIFQLKTQ----AHQGHWEEVVTLDEETLNTP-CYCQLEAKSCHILLDQLGTYVFTGESY-SRSAVKRLQLAIFAPALCTSL-------EYSLRVYCLEDTPAALKEVLELERT-LGGYLVEEPKTLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQKALHCTFTLERHSLASTEFTCKVCVRQVEGEG----QIFQLH------TTLAETPAGSLDALCSAPG------NAATTQLGPY------------AFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMTTD 942          
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Match: E1CHK7 (Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Djunc5A PE=2 SV=1)

HSP 1 Score: 518.464 bits (1334), Expect = 1.288e-162
Identity = 348/1056 (32.95%), Postives = 545/1056 (51.61%), Query Frame = 3
Query:  297 DWDSKENHEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVG-QWSDWSEWTGICPNICSKGSNCP-KVCSTSRQQRVRYC--NQIKNQKANCIGSEIEYKRCDLICDP--NLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRR-VIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSM----KPTLKIRPSYSDSKVSSTLYPQMGLV-KHVSTLP--IPVSSSLSDHYQELGNTDNETSDQSVTEPC-----------------LPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTS-YSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVG--SSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLD---FNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQ 3353
            +W      EVD KKDLV P+EKH +G+PKF+ +P   YYV+K+HPA+I C+A+PVSHVNIFCADKQ+SYMN E S +GL VIKM++  +   KGNRWKFSLEV++KDV+EWFSEY+C+CEAWNQI  + K KKV SS+A+I +SY   DFKT PK+Q++     ++L C PP++KP +++ W+KN E IT  + P   I+E   L++  +  +DSGNY+CVA S G+ + +   +++  +   WS W++W   CP IC   + C  ++CS+S +QR+RYC   +IK +  +C G   E + CD  C+   + W  WS W+      C + R R+C   NC      +  NC+   C     S              I  +    MY+GLF+ +S+  +++ II CLI ++  I   P R   +S   NG+   Y +K+ K                            NS  FL +N           D  + I  I+ ++   L  +AT LLS +     P  ++  + +  +V   +Y    ++ K   T P   P+ +S+    +    T  E    +++ P                  LP +   + + W TI ++GGR+ L  S I+LT P  +   G SE +FLA C    ++P +   E LLSPV++CGP  +   K  IL IPHCA N    +W I VL++ +   +  P W++   +   ++     YAQL      LI +QLQ  C+ G  S   +   +  LRI A+   L    ++   ++R++LIPD  E I  V   E  +L  +L+ N K+F      G+I + + DL++ W+  S+N  Q               S++FI RL ++ + E+   +  +D     + C ++I Q +   N+  V +      ++ SI   S    + +   SQ+   ++D       ++VF+L   T+ +L  LLD        W+ LA H+ +  +L +FS K+S ++ LLDLWEA+     ++ +LI+ILR +GR DC  I+E+D+++
Sbjct:   33 EWPDNSESEVDGKKDLVQPNEKHYDGIPKFLVEPHPFYYVNKTHPALIICVAEPVSHVNIFCADKQFSYMNTERSESGLIVIKMNHLNQPDSKGNRWKFSLEVKYKDVLEWFSEYKCYCEAWNQITMINKDKKVHSSAALIQESYFQNDFKTTPKSQELREGNKLELQCTPPESKPNSKVTWLKNDELITQSNFPLIIIDESKRLIIEQVLKSDSGNYTCVAQSQGVVKKSKPAVIIITMKYNWSPWAKW-NTCPEICKMETKCQNEICSSSHRQRIRYCLNEEIKVEDKHCKGESNEKESCDKACEKEESKWNSWSFWTTICFPNCSQTRVRRCEFGNCFGPKQ-QSRNCSQIICQRADPSL-------------ILESQSTTMYLGLFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGMTKIYTNKSSK----------------------------NSEKFLLNN-----------DQKSTIVTIKNHNAQDL--VATSLLSEIPNNYSPVYEMHSNNNRDQVLPAIYSDYPMISKSQYTYPSTAPLLNSILSPERSYNETSEEDQKANLSSPLYQELSIGRGSCGLLSNYLPPDMELDTIAWGTITTAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHTNIPVIDMMEMLLSPVILCGPPQIQLLKSVILTIPHCA-NIQCSDWNIRVLSARFQNSQIPPLWKELSTIRPVNRSDSNIYAQLDSTSAHLIIDQLQMICITGCLSPLSDSSVSIRLRILAFSLPLS---SELDHIIRVHLIPDTKEAIENVIASEL-KLNGQLLDNSKKFTFSSSGGDIALCLDDLSLGWRCHSSNKMQTF-------------SYSFIWRLNHSQNQEIHFLLEHVDPTRTGFSCNITIQQIDLPQNQVIVRVIKERSPNNRSIIPISLDSRSNNREFSQA---YLDP-----LQTVFRLSFTTRQQLWPLLDP------SWQTLANHMLLNGNLNYFSEKMSPSDALLDLWEARCRDEGAIADLINILRVIGRNDCAMIVEQDILK 1000          
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Match: A0A210QTQ7 (Netrin receptor UNC5C OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06250 PE=4 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 2.316e-110
Identity = 294/1031 (28.52%), Postives = 479/1031 (46.46%), Query Frame = 3
Query:  354 SEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCAD-KQYSYMNEEVSATGL--KVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSE--YRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQIL-VFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCT----TNNCGKASSVEID--NCTLAEC------GGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSD-SKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQE-----LGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLST----PNGSSHTSISATSTQFSNYSAGGSQSFPYFVD-DCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            S+  L G P FI++P+  YY+ K+ P  I C A     +   CA   QY  + EE   + L  KVI                  LEV   +V ++F E  + C C A N ++     KK++S   ++  + + + F+  P + + ++    +L+C+PP+ KP  E+ W+KNGE+I  K      I+  G LL   +R++D+GNY+C A +   +R + + +L V+  G WS WS+W           S C   C    Q+R R C      N  A C+G   +   C  IC     W+ WS WS CS + C   R R C      N  G  S  ++D  NCT   C      G        +    P + +      ++A+YIG+ V++     VV  IF +    ++  +  R  + +  +N   +   +K   KN + + +          P L +++V+        +N ++  S S   +  N+      NH+ S+  I       + P++  R S    +K   TL+ +   + +     +P    +           + N +   S QS+    LP N + E + W T +  GGR+ L+ S + LT P  +   G +E +F+A C  ++D P LS ++T++SPV++ GP      KP IL++ HCA N   G W +S+ TS +P  + P W K + L  E  ++P  YAQL  +   ++T  LQR+ ++G +    +  K+LR+AA+   +          +R+Y++ D  + +  V   E  + G RL+   KQ   +D   N+ + I +L   W++  A NYQEIPF+ +W      LHCSF+    L   + +  K+S         C + +YQ     N+Q + +S      + S  T  S    + S  +   S  F   V  D    NF    +LP   + +LC LLD      NDWR LA+ L++ R +QFF+ K S TE +LDLWEA++    ++ +L++I R MGRLD  ++LE+D
Sbjct:   23 SDPRLIGSPMFIKEPEPYYYIVKNRPINIHCKAVSAVQIKFRCAGVDQYHEITEEYFDSNLNKKVISS---------------RLEVTRDEVKDYFGEGGFWCECYATNSLQDTDNGKKIKSRKGMVEIAMMRRWFEHEPMSLRAALDTDAQLTCLPPEGKPRPEVFWLKNGEEIDIKKTNNI-ISSEGNLLFPQVRISDTGNYTCGARNVVAKRISQSAVLTVYVNGSWSTWSQW-----------STCSVKCGRGSQKRYRACTNPTPLNGGAPCVGETSQKTECTAICPVRGQWSMWSSWSTCSPD-CLHHRRRSCDDPPPENGGGYCSGNDLDSTNCTGGMCRERTLYGDLRGPVKTATTVGPNAGSG-----NIALYIGICVSI-----VVLAIFVI----LVALAIRRKSQNANNSNQPPLTDEEKKAHKNGNGVVSVP--------PDLTQTVVIVQH-----NNMNNGISRSPSLEAPNN------NHVNSVENIYDK--PDISPSMDSRLSGGTLTKNGKTLFVEPTFMNNRPQEKLPYEKDVPPPVPLGPRPPIQNNNVMDSRQSMMSVQLPSNIDMEAVAWTTFNHQGGRLVLSDSGVALTVPEGAIKKGHTEELFIAVCRDDKDRPKLSDHQTVISPVILVGPVKHDMLKPVILSVQHCA-NMRQGGWMLSLCTSDTPTDEPPRWHKIVTLGQETINTPI-YAQLDPNHCHIMTEYLQRYALIGEAVHGGKPIKILRLAAFAPMMP---PSMDFSIRVYVVEDTQDALESVIQ-EERKFGGRLLDKPKQIPFQDGGHNLCLTIEELTPGWRSKLAANYQEIPFQHIWSGTQNNLHCSFS----LELVDRAYHKVS---------CKIQVYQKAILSNRQVLNISNNFKEKSTSCSTPSSTLKGRSSTVTTNSSSGFSSMVTLDPQGQNF----RLPTHIRTRLCMLLDPPNARGNDWRMLAQALTVDRYVQFFATKGSPTEHILDLWEARHREETAVTDLMNIFRVMGRLDAASVLEED 967          
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Match: A0A1S3JPZ4 (netrin receptor UNC5C-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106174972 PE=4 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 4.737e-107
Identity = 291/1029 (28.28%), Postives = 475/1029 (46.16%), Query Frame = 3
Query:  378 PKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCAD-----KQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKV--------KKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-GLVKHVSTLPIPV--------SSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW--HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNK---QTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            P F+Q+P+   Y+ KS P  ITC A     +   CA+     K++   +     TG  V++                S+EV  + V E+F    Y C C AW +I    +           V S   ++  ++I K F+  P +  V +   V+L C+PP   PP E+ W+K+G+ I  K    F I+  G L++S  RL+D GN++C A +    R + +A+++V+  G WS WS+W           S+C   C    Q R R C+     N  + C G   +   C  +C  +  W+ W+ WS C+ + CK  R R+C      N GK   ++ + I NCT    GG    F  S+     +        D+A+Y+G+ +AV V   ++ II  +IRR+                        D+          +      +  +P+   ++V P+    L    +   ++S Y     D      NH+ ++  I  P+L+    T  +  S    K S  LY Q+ G  K  ST  + +        SS+     Q   +TDN ++ QSVT   LP N + E + W  I  +GG +++  + ++++ P  + + G +E IF+A C  ++D P LS  +T+LSP+++ GP  +   KP I++  HCA +   G W + V  S +   + P W K+L    E+  + P Y Q+  +   ++T+QL R+ ++G S +   A K LR+AA+   +    +     +R+Y++ D  + +  V   E  +LGA L+   KQ   +D   N+ + I +LA  W++    NYQEIPF+ +W  +   LHCSF+        ++  L+ +V+       C + +YQ +   N+   Q V   T       ++       +  S+ G  S    +D   K      F+LP Q K KLC  LD      NDWR LA+ L + R + FF++K S TE +LDLWEA++    +L +L++ LR M R D  A+LEK+L
Sbjct:   50 PIFLQEPEPHNYIVKSKPVTITCQAINAVDITFRCAEEWVPLKRHVRADFTHPETGEAVLQA---------------SVEVTRQAVEEYFGIDGYWCECNAWTEIPSPDRPWTGDNPPPAHVSSRRGLVQVAFIRKRFEREPISTSVELEKPVQLHCLPPTGVPPPEVFWLKDGQVINDKEETNFIISNEGNLIISQARLSDQGNFTCGAINVAATRKSESAELIVYVKGAWSTWSQW-----------SDCDSKCGKGFQSRSRTCSNPAPLNNGSPCPGDWEQKVPCTTVCPVDGGWSTWASWSTCNED-CKHFRRRRCDNPPPQNNGKHCESTDLNITNCT----GGLCREFPGSDVYAERTEKPGQDVKDIALYVGVSLAVLVLATIIVIIIFMIRRK------------------------DQRQFDMDLGERSLPQYDDEDKKPAKNGAMVQPD----LTQTIAPVRTHSLY-----DQPPPNNNHIDAMEKI--PMLNGH--THPVEDSPIIDKKSKHLYIQLPGEEKTDSTEKLTLQKSKASLKSSTSGSRPQSEYDTDN-SNRQSVTSNLLPSNIDVEALAWGNITHAGGMLTIPETGVSVSIPEGAISKGNTEEIFIAVCRDDKDRPKLSDKQTILSPILLLGPQGLALHKPVIVSFQHCA-SQKHGLWVMRVYGSGTAYDEPPAW-KHLVTFGEETLNTPIYCQVDTNCCHMMTDQLCRYALIGESMQGTAAMKRLRLAAFAPAV---ASSIDYSIRVYVVEDTQDAVEGVIQLE-KKLGAALLDRPKQILFQDGGNNLCLTIEELAPGWRSKLTANYQEIPFRHIWSGNQNNLHCSFSL------EHTDGLQQTVS-------CKIGVYQKSILGNRAVLQIVSNLTEKVIPSPTVPGKPRASTTVSSSGCSSM-VTLDQAQK-----AFRLPSQIKTKLCAYLDPPNSRGNDWRMLAQALCVDRYINFFASKPSPTEHILDLWEARHREETALTDLMNTLRVMDRFDAAAVLEKEL 984          
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Match: D1LX77 (Netrin receptor unc5-like protein OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 2.953e-105
Identity = 300/1089 (27.55%), Postives = 481/1089 (44.17%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWF---SEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAEC---GGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVI----------------GFSPNRVWRYSTTANGIQM----FYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPF--LPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTD--NETSDQSV-----TEPC---------------------------------------LPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSAN-ETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSN---YSAG---GSQSFPYFVDDCSKTNFE---SVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            E +P+FI +P+  Y V K+    +TC+A P  H+   C            +   ++   +  +  L   GN  K +  V  ++ IE F    +Y C C AW +         V+S  A I  S++ K F+  P    + +  + ++ C PP+  P  +I+W K+G +I  +    + I     L+++  RL D+GNY+CVA +   +R +  A++ V+  G WS WS WTG C + C KG           Q+R R C      N  A C GS  +   C  +C  +  WT W+EWS CS   C   R+R C+     N GK      +E  NCT   C   G   A    S+   P+          +A+Y+GL VA  VF++V   I  LI R+V                 G  PN++  +    +   M      PD           N  +   D++   L   ++ P   P   +P+N+S  S +   +      T    N   ++  ++ P  S     +  R S+    VSS   P     K ++ LP+    +L +    +  TD    ++DQS+     T+ C                                       LP + +   + W  +   GGR+++  + +++     + A G +E I++A C  E+D P + A  ET+LSPV++CGPT++   KP ++  PHCA+  +  NW  S+ T  S   + P W+K + +  E  ++P  Y QL +   FL+ ++L RF +VG S     A K+L++AA+   L R  AD  I  R+Y++ D  E +  V   E  RLG  L+   KQ    D   ++ + I ++   W++  + NYQEIP+  +W      LHC+F             L   +  +     C +++YQ +    KQ + +        T+++ T  QF     Y  G    S         CS    +   +VF++P  T+ KLC  LD      NDWR LAR L + R + FF+ K S TE +LDLWEA+    ++L++L+ I ++MGR D V ++EKD+
Sbjct:   51 EPIPEFIVEPEDGYIV-KNADITLTCVAAPAMHIYFKC------------NGDWVRGKHLVQQETLDEAGNAQKEASIVLTRNEIESFFGDEDYWCQCVAWGE------GGSVKSRKATIVISFLKKAFEREPLGANIEIESAFQMMCRPPEGNPLPDIYWEKDGRQIDVQEDRNYIITTDASLIINQARLADTGNYTCVAQNMASKRKSDVAKVNVYVNGAWSTWSAWTG-CDSRCGKGI----------QRRTRTCTNPAPLNGGAPCPGSSSQTSPCTTLCPVDGSWTSWNEWSNCSPE-CNHIRSRTCSNPRPQNSGKLCKGLDMESRNCTDGLCKLVGIEGAEHQESDLTEPKVKKGS--GDGIALYVGLIVACVVFMLVCVFIVYLIHRKVRQAGVYIDINASDMTLPGACPNQIKGHKIGQDNAHMAMLSIQPDVTQSTCQLRNQNLMMRNGDMDTTKLV--MISPPVPPIYNIPNNKSKMSDSMTLS-----ATTPSENKYETIQPLSCPECSVTPSQISPRSSF----VSSCYSPVHSPDKELNVLPLD-DEALKEKLDIIRETDLIGSSTDQSIKMAVETDDCNSEKSFGTLKSLSDSSSRPMSMYDSDNLGNSMCSIASTTLPTHIDPRCIAWGMMGHRGGRLTVPDTGVSVLIAEGALAKGQTEEIYIAVCREEKDRPKVKAGKETILSPVIMCGPTHLNFKKPVVVQFPHCAH-VEGCNWVSSIYTCDSHPDEPPNWEKVVTIGEETINTPL-YCQLDESECFLMVDRLSRFALVGESRPGHEACKILKLAAFAQPL-RSLADYNI--RVYVVDDTLEALEGVVQVE-QRLGGHLLDKPKQLEFVDSGASLCLTIDNIMTGWRSKLSANYQEIPYYHIWSGNMNALHCAFTL---------ERLDRQIQKI----HCRITVYQVSGGKEKQCLQI-------LTNVNETKAQFPPEMLYGLGRSRSSTVTTNSTSGCSSMTVDPPSTVFRIPRPTRNKLCICLDRPMKKGNDWRLLARKLKVDRYINFFATKPSPTEHILDLWEARCRGERALSDLLRIFKEMGRNDVVDLIEKDV 1068          
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Match: A0A1S3JQG5 (netrin receptor UNC5C-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106174972 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 4.032e-105
Identity = 291/1045 (27.85%), Postives = 475/1045 (45.45%), Query Frame = 3
Query:  378 PKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCAD-----KQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKV--------KKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-----------------WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-GLVKHVSTLPIPV--------SSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW--HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNK---QTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDL 3347
            P F+Q+P+   Y+ KS P  ITC A     +   CA+     K++   +     TG  V++                S+EV  + V E+F    Y C C AW +I    +           V S   ++  ++I K F+  P +  V +   V+L C+PP   PP E+ W+K+G+ I  K    F I+  G L++S  RL+D GN++C A +    R + +A+++V+  G WS WS+W           S+C   C    Q R R C+     N  + C G   +   C  +C  +                  W+ W+ WS C+ + CK  R R+C      N GK   ++ + I NCT    GG    F  S+     +        D+A+Y+G+ +AV V   ++ II  +IRR+                        D+          +      +  +P+   ++V P+    L    +   ++S Y     D      NH+ ++  I  P+L+    T  +  S    K S  LY Q+ G  K  ST  + +        SS+     Q   +TDN ++ QSVT   LP N + E + W  I  +GG +++  + ++++ P  + + G +E IF+A C  ++D P LS  +T+LSP+++ GP  +   KP I++  HCA +   G W + V  S +   + P W K+L    E+  + P Y Q+  +   ++T+QL R+ ++G S +   A K LR+AA+   +    +     +R+Y++ D  + +  V   E  +LGA L+   KQ   +D   N+ + I +LA  W++    NYQEIPF+ +W  +   LHCSF+        ++  L+ +V+       C + +YQ +   N+   Q V   T       ++       +  S+ G  S    +D   K      F+LP Q K KLC  LD      NDWR LA+ L + R + FF++K S TE +LDLWEA++    +L +L++ LR M R D  A+LEK+L
Sbjct:   50 PIFLQEPEPHNYIVKSKPVTITCQAINAVDITFRCAEEWVPLKRHVRADFTHPETGEAVLQA---------------SVEVTRQAVEEYFGIDGYWCECNAWTEIPSPDRPWTGDNPPPAHVSSRRGLVQVAFIRKRFEREPISTSVELEKPVQLHCLPPTGVPPPEVFWLKDGQVINDKEETNFIISNEGNLIISQARLSDQGNFTCGAINVAATRKSESAELIVYVKGAWSTWSQW-----------SDCDSKCGKGFQSRSRTCSNPAPLNNGSPCPGDWEQKVPCTTVCPVDYYHSSTVSSTLGWPVDGGWSTWASWSTCNED-CKHFRRRRCDNPPPQNNGKHCESTDLNITNCT----GGLCREFPGSDVYAERTEKPGQDVKDIALYVGVSLAVLVLATIIVIIIFMIRRK------------------------DQRQFDMDLGERSLPQYDDEDKKPAKNGAMVQPD----LTQTIAPVRTHSLY-----DQPPPNNNHIDAMEKI--PMLNGH--THPVEDSPIIDKKSKHLYIQLPGEEKTDSTEKLTLQKSKASLKSSTSGSRPQSEYDTDN-SNRQSVTSNLLPSNIDVEALAWGNITHAGGMLTIPETGVSVSIPEGAISKGNTEEIFIAVCRDDKDRPKLSDKQTILSPILLLGPQGLALHKPVIVSFQHCA-SQKHGLWVMRVYGSGTAYDEPPAW-KHLVTFGEETLNTPIYCQVDTNCCHMMTDQLCRYALIGESMQGTAAMKRLRLAAFAPAV---ASSIDYSIRVYVVEDTQDAVEGVIQLE-KKLGAALLDRPKQILFQDGGNNLCLTIEELAPGWRSKLTANYQEIPFRHIWSGNQNNLHCSFSL------EHTDGLQQTVS-------CKIGVYQKSILGNRAVLQIVSNLTEKVIPSPTVPGKPRASTTVSSSGCSSM-VTLDQAQK-----AFRLPSQIKTKLCAYLDPPNSRGNDWRMLAQALCVDRYINFFASKPSPTEHILDLWEARHREETALTDLMNTLRVMDRFDAAAVLEKEL 1000          
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 287.345 bits (734), Expect = 2.017e-81
Identity = 274/1027 (26.68%), Postives = 435/1027 (42.36%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-----GLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGG-----SQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L  I       L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN + I       F +    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C          NKK     T+  +     VA+Y GL  A+ + +++V  +  L  RR        +   S+       F+P                          Y+     N     PS   D ++ SA T  G   + +Q++ L S   +PM  +PLL  + P LKI+  Y  S +SS   P       G +  + T    V S   DHY   G+T       S +               AT+   GGR+++  + ++L  PP +   G    ++L     E+        +T+LSPVV CGP+ ++  +P IL +PHCA   +  +W++++ T     +    W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q                   HT I  T    S   AGG     SQ  PY             F+LP   + K+C  LD+ +    DWR LA  L   R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   48 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTRESLDQIT-----GLVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCIGSIMESKNCTEGLCA--------RNKKISIEHTTHPLDSGAGVAVYAGLVGALLLCVILVLCVGILAYRRSCSHLHGDITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPSAPPDLTA-SAGTFRGPLFSSLQQSTLDSHHKIPMTNSPLLDPL-PGLKIK-VYDSSTMSSVELPAGPGSSDGEIMSLKT----VGSGTRDHY---GHTLPGEPGHSAS---------------ATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCA-QLEPPDWSLTLKT-----QTNQAWEEVLTV-GEESLSSPCYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLALFAPRAPCLSLD-------YSLRVYCIHDTPHALKEVLELERS-LGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLAVSQLSCKICVRQVEGEG----QIFQL------------------HTDIQETLPPHSPLPAGGTCLPSSQVGPY------------AFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 937          
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 286.96 bits (733), Expect = 2.488e-81
Identity = 272/1025 (26.54%), Postives = 433/1025 (42.24%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-----GLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGG-----SQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L  I       L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN + I       F +    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT     G  A  ++S                VA+Y GL  A+ + +++V  +  L  RR        +   S+       F+P                          Y+     N     PS   D ++ SA T  G   + +Q++ L S   +PM  +PLL  + P LKI+  Y  S +SS   P       G +  + T    V S   DHY   G+T       S +               AT+   GGR+++  + ++L  PP +   G    ++L     E+        +T+LSPVV CGP+ ++  +P IL +PHCA   +  +W++++ T     +    W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q                   HT I  T    S   AGG     SQ  PY             F+LP   + K+C  LD+ +    DWR LA  L   R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   48 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTRESLDQIT-----GLVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCIGSIMESKNCT----EGLCARTLDSGA-------------GVAVYAGLVGALLLCVILVLCVGILAYRRSCSHLHGDITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPSAPPDLTA-SAGTFRGPLFSSLQQSTLDSHHKIPMTNSPLLDPL-PGLKIK-VYDSSTMSSVELPAGPGSSDGEIMSLKT----VGSGTRDHY---GHTLPGEPGHSAS---------------ATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCA-QLEPPDWSLTLKT-----QTNQAWEEVLTV-GEESLSSPCYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLALFAPRAPCLSLD-------YSLRVYCIHDTPHALKEVLELERS-LGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLAVSQLSCKICVRQVEGEG----QIFQL------------------HTDIQETLPPHSPLPAGGTCLPSSQVGPY------------AFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 926          
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Match: unc5c (unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-030131-9196])

HSP 1 Score: 283.493 bits (724), Expect = 3.967e-80
Identity = 257/1003 (25.62%), Postives = 418/1003 (41.67%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSL--SDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGR 3314
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  E          ++D    L V+    + S+E+  + V E F   ++ C C AW+           +S  A +  +Y+ K F   P  ++VS+   V L C PP+  P AE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G  I+   C+ +C  + LWT WS+WS C G  C   R R+C+     N GK      ++  NCT   C     S                 T DVA+Y+G+ +AV + L++  I+   + R+      + +   S    G Q                                SI    +   L +     S+ + Y        Y   +    +PM  +PLL  + P LKI+   S   V+    PQ  L    S L   +  SL  SD       +   + D S T              + + +S GG + +  S ++L  P  +   G    +++     E   P++   +T+LSPVV CGP   +  +P I+ + HCA   DS +W I + +      Q+  W+  + +  E+  + P Y Q+ ++   ++T  L  +C+VG S  +   TK L++A +    CT L+         +R+Y + D  + + +V   E  ++G +L+   K    +D   N+ + + D+    W++     YQE+ F+ VW      LHC+F              + S  +L+    C L + Q                      I   +T  S  S     S      + +     + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+    +LN L  +L +MGR
Sbjct:   55 EPLPHFLMEPEEAYIV-KNKPVNLYCKATPATQIYFKC-NSEWVHQKEHTVEE-----RVDETSGLVVR----EASIEITRQQVEELFGLEDFWCQCVAWS------SAGTTKSRKAHVRIAYLRKTFDQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEW-----------SACNSRCGRGFQKRTRSCTNPAPLNGGAICEGQPIQKLACNPLCPVDGLWTEWSKWSTC-GTECTHWRRRECSAPAPKNGGKDCEGMVLQSKNCTDGLCMQTAPS-----------------TDDVALYVGIVIAVIMCLVISVIVALFVYRKNHRDFDSDIIDSSALNGGFQPV------------------------------SIKTARTADLLAAPPDLTSAAAMY----RGPVYALHDVADKIPMTNSPLLDPL-PNLKIKVYNSSGLVT----PQEDLSDFSSKLSPKLPHSLIDSDTMGRRTQSLVRSRDPSCTA-------------FGSFNSLGGHLIVPNSGVSLLVPAGAIPQGRVYEMYVTVHRKETMRPSVDDTQTVLSPVVSCGPPGALLTRPVIITMHHCA-EADSEDWLIQLRSQ----SQQGQWEDVV-VVGEENFTTPCYIQMDEEACHILTETLGTYCLVGQSV-SAATTKRLKLAVFGPVTCTALEYN-------IRVYCLDDTQDALKEVLQME-KQMGGKLLDEPKTLNFKDSTHNLRLSLHDVPHTLWKSKLLAKYQELSFQHVWSGSQRNLHCTFTL-----------ERFSAGTLELG--CKLCVRQVEGEGQ----------------IFQLNTTLSEDSQCIDTSLLDPASNITTLVGPNAFRIPLSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLNRLAAVLEEMGR 915          
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 278.87 bits (712), Expect = 1.503e-78
Identity = 271/1025 (26.44%), Postives = 429/1025 (41.85%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPNL-WTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-----GLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGG-----SQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L  I       L V+    +  + V    V E F   +Y C C AW             SS+   Y+   N  F+  P  ++V +   V L C PP+  PPAE+ W+KN + I       F +    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C    +  ++S                VA+Y GL  A+ + +++V  +  L  RR        +   S+       F+P                          Y+     N     PS   D ++ SA T  G   + +Q++ L S   +PM  +PLL  + P LKI+  Y  S +SS   P       G +  + T    V S   DHY   G+T       S +               AT+   GGR+++  + ++L  PP +   G    ++L     E+        +T+LSPVV CGP+ ++  +P IL +PHCA   +  +W++++ T     +    W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q                   HT I  T    S   AGG     SQ  PY             F+LP   + K+C  LD+ +    DWR LA  L   R L +F+ K S T +LLDLWEA +     L +L   L +MG+ + + ++  D
Sbjct:   48 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTRESLDQIT-----GLVVR----EVDISVSRTQVEELFGLEDYWCQCVAW-------------SSAVSTYEKLSN--FEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCIGSIMESKNCTEGLCARSESHALDSGA-------------GVAVYAGLVGALLLCVILVLCVGILAYRRSCSHLHGDITDSSSALTA--AFHPGN------------------------YKPPRQDNPHLLHPSAPPDLTA-SAGTFRGPLFSSLQQSTLDSHHKIPMTNSPLLDPL-PGLKIK-VYDSSTMSSVELPAGPGSSDGEIMSLKT----VGSGTRDHY---GHTLPGEPGHSAS---------------ATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCA-QLEPPDWSLTLKT-----QTNQAWEEVLTV-GEESLSSPCYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLALFAPRAPCLSLDYS-------LRVYCIHDTPHALKEVLELERS-LGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLAVSQLSCKICVRQVEGEG----QIFQL------------------HTDIQETLPPHSPLPAGGTCLPSSQVGPY------------AFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTD 921          
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 248.44 bits (633), Expect = 1.380e-68
Identity = 253/977 (25.90%), Postives = 403/977 (41.25%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASS-FGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYI--THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDAS-SNSAYTDVGNDITYIQRNHLPS---LPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQM-----GLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY-----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHSPT--LHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGG-----SQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITR 3191
            E +P+F  +P+  + V K+ P  ++C A P + +   C + ++   N+ V+   L  I       L V+    +  + V    V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  ++V +   V L C PP+  PPAE+ W+KN + I       F +    +L++   RL+D+ NY+CVA +     R +TA ++V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  +C  +  WT W++WS C G  C   R+R+C      N G+    S +E  NCT   C          NKK     T+  +     VA+Y GL  A+ + +++V  +  L  RR        +   S+       F+P                                     + P  Q+    + SA T  G   + +Q++ L S   +PM  +PLL  + P LKI+  Y  S +SS   P       G +  + T    V S   DHY   G+T       S +               AT+   GGR+++  + ++L  PP +   G    ++L     E+        +T+LSPVV CGP+ ++  +P IL +PHCA   +  +W++++ T     +    W++ L +  E+  S P Y Q+ +    ++  QL  + +VG S   + A K L++A +     C  LD         +R+Y I D    + +V   E + LG  L+ + K    +D   N+ + I D+    W++     YQEIPF  +W      LHC+F+  +  +  +    KI V  ++        I+Q                   HT I  T    S   AGG     SQ  PY             F+LP   + K+C  LD+ +    DWR LA  L   R
Sbjct:   23 EPLPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTRESLDQITG-----LVVR----EVDISVSRTQVEELFGLEDYWCQCVAWS------SAGTTKSRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNFLMTVDHDLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEW-----------SECNARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLCPVDGGWTEWAKWSAC-GTECTHWRSRECQAPPPRNGGRHCIGSIMESKNCTEGLCA--------RNKKISIEHTTHPLDSGAGVAVYAGLVGALLLCVILVLCVGILAYRRSCSHLHGDITDSSSALTA--AFHPGN-----------------------------------YKPPRQAPPDLTASAGTFRGPLFSSLQQSTLDSHHKIPMTNSPLLDPL-PGLKIK-VYDSSTMSSVELPAGPGSSDGEIMSLKT----VGSGTRDHY---GHTLPGEPGHSAS---------------ATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCA-QLEPPDWSLTLKT-----QTNQAWEEVLTV-GEESLSSPCYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLALFAPRAPCLSLD-------YSLRVYCIHDTPHALKEVLELERS-LGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWSGSQRPLHCTFSLERGSLAVSQLSCKICVRQVEGEG----QIFQL------------------HTDIQETLPPHSPLPAGGTCLPSSQVGPY------------AFRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDR 852          
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 264.233 bits (674), Expect = 2.335e-74
Identity = 266/1025 (25.95%), Postives = 413/1025 (40.29%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFC----ADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTTN---NCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYIT----HDVAMYIGLFVAVSVFLMVV-AIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYN----FNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETN---------------RLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P   + V ++ P  + C A P + +   C      ++  Y  E +S    KV++        V  N  +  +E  ++       ++ C C AW+           +S  A +  +++ K+F+  P  + V +   V L C PP+A PPAE+ W+K+ E I  +    F I     L++   RL+DS NY+CVA +     R +TA + V+  G WS W+EW           S C   C    Q+R R C      N  A C G   +   C  IC  +  W  WS+WS C G  C   R+R+C+     N GK    S ++  NC+ A C       I S K     STS  +      +VA+Y G+ VA+ + + VV A  F L RRR   +  + +   S    G   F P              Q    + +  +L R+ + P+               +A         Y   N    + M  +PLL  +       P +     SS++          S  P P         + +    + T D + TE CL  N       +  ++ T    GGR+++A S ++L  PP +  PG    +++     ++  P L  ++TLLSPVV CG  +V    P IL++ HCA      +WA+S+      L   P W++ L    E    P  + Q     +   T  L  FC   SS+     +   R+          H D       Y  P +  C    H +  +               +LG RL+        +  +GN+ + I  +  + W     N +QEIPF  VW      LHC+F   +  +++     K+ V  L+        + Q       +T LL+ P+ +  +   A        SAG +   P              FKLP   + KLC  LDS  P  NDWR LA  L I R   +F  + S T ++LDLWEAQ+     L++L  +L +MGR +
Sbjct:    8 EPLPIFLTEPNDGFIV-QNKPVTLDCSASPATQIYFKCNGEWLHQKALYTQEHLSEITGKVVR-------EVHTNVSRQQVEDPYR-----LEDFWCQCVAWS------ASGTTKSRKAFVKVAHLRKNFEQEPLGKDVPLNHEVLLHCRPPEAIPPAEVEWMKDKELIDPEEDSNFYITVDHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVYVNGGWSLWTEW-----------SPCNSKCGRGTQKRTRSCTNPAPLNGGAVCNGQGTQKIPCSTICPVDGGWVEWSKWSTC-GPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALC-------IQSEKIIIGQSTSCVLASEAGDEVALYAGVAVALVISVGVVLAASFVLYRRRRQEYGSDIIDSASALTGG---FRP------------VNQKAGRNADDSNLLRTAIQPDL--------------TASVGTFPQPVYPVHNATQKIQMTQSPLLEPL-------PGHKIKVCSSSMLASTDNEGDQSVEPSPKRHGTRQPNKMI---QHHTLDLAPTETCLDNNEMHQVGSDTTVFGTFCCLGGRLTIAHSGVSLLVPPGAIPPGQFYQMYITIHREKEKRPALENSQTLLSPVVSCGAPSVPLLSPVILSLRHCA-ELSPEDWALSLKRQ---LSSGP-WEEVLRQGEEPARPPSCHWQRVSVSVTSTTAHLVSFCYYCSSF----MSVCGRVC---------HQD-------YFSPCLCVCGRVCHQYYCSSSTHDQFKEVVELEKQLGGRLLEEPTTLNFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPGCQRLLHCTFALERASLSSTEFSCKLCVQQLEGEG----QVLQL------RTTLLNAPSATDDSPTEAA-------SAGSALVGP------------QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINRYGNYFEMRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGRRE 901          
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003861.1 (pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 gene:ENSPMAG00000003466.1 transcript:ENSPMAT00000003861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 231.491 bits (589), Expect = 8.843e-64
Identity = 216/861 (25.09%), Postives = 363/861 (42.16%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVS-----ATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTTN---NCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFL-MVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMD-WQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLD 2882
            E +P F+Q+ +  Y V ++ P  ++C A P + +   C  +  S     V       TG  V ++  +             +  Q  +V      Y C C AW+           +S  A +  +Y++K+F+  P+ ++      ++L C PPDA PPAE+ W+KN   I  +    F I     L++   RL+DS NY+CVA +     R +TA + V+  G WS W+EW   C + C +G+          Q+R+R C      N    C G   E   C   C     W  WS+WS C G  C   R+R+C+     N GK    S ++  NC+ A C     +F      Y  +  S     ++A+Y G+ VA+ V + +V+A    L RRR   +  + +   S    G                             P+  +++   N++  +  +    + +S++    N   Y Q +    + M    LL  + P LKI+   S +  S+ +  + G             + LS    E   +D+  S++  ++ C P + +    ++AT    GGR+ +  S + L  PP +   G    ++L     E   P L  ++TLLSPVV CGP ++    P IL++ HCA      +WA+S+    S      +W++ L L  E    P  + QL +    ++T     + V+G +     A K LR+AA+    C  L+         +RLY + D  E +++V   E  RLG  +V        +  +G++ + +  +    W  +  +  QEIPF  VW      LHC+F   +  +++     K+ V  L+
Sbjct:   34 EPLPHFLQELEDAYIV-RNKPVTMSCAASPATQIYFKCNAEWVSQQAHHVQQRTDQGTGRSVREVQTD-------------VSRQQVEVYYGPEPYWCQCVAWS------AAGTSKSRKAYVRIAYLHKNFEMEPQGKEEPQGQKIQLHCRPPDAVPPAEVEWLKNEMLIDPEEDSNFHITADHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVYVEGGWSLWNEWA-PCNSKCGRGT----------QKRIRTCTNPAPLNGGPFCDGQASENTPCTSACPVDGGWVEWSKWSTC-GPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALCIQTKTNFTG----YTSTLFSSETGDELALYGGVAVALVVSVGIVLAASVALYRRRRQNYEADIINSNSDLYGGF---------------------------APAGQKAVRHDNTMQRMAMHSDLTARSSSF----NGPVYPQCDMTQKISMTHFQLLEPL-PGLKIKVCSSPTVSSADVSRENG-------------ARLSSRKLETDTSDSGVSERRRSQNCAPLHQDKGTSVYATFGCLGGRLLIPSSGVGLLVPPGAIPHGHFYQMYLTVHRGEDSGPVLDGSQTLLSPVVSCGPPSIPLLSPVILSLRHCA-ELSPEDWALSLKRQLS----SGHWEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEAL-GPAAVKRLRLAAFAPSVCPSLE-------YSLRLYCLNDDTESLAEVVELE-KRLGGHMVGEPSTLHFKANSGHLQLSMHAVPDTLWTNNVHSKLQEIPFWHVWPGCQRLLHCTFALERAGLSSTEFSCKLCVQQLE 799          
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010609.1 (pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1 gene:ENSPMAG00000009605.1 transcript:ENSPMAT00000010609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 1.073e-43
Identity = 128/432 (29.63%), Postives = 200/432 (46.30%), Query Frame = 3
Query: 2043 IWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHS--PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSI-TRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGR 3314
            ++ T    GGR+ +  S ++L  PP +   G    ++L     E   P L  ++TLLSPVV CGP +V    P IL++ HCA   +S +WA+ +           +W++ L L  E    P  + QL +    ++T     + V+G +     A K LR+AA+    C  L       +  +RLY + D AE +++V   E  +LG RL+        +  +GN+ + I  +  + W     N +QEIPF  VW      LHC+F   +  +++     K+ V  L+        + Q       +T LL+ P+ +  +   A        SAG +   P              FKLP   + KLC  LDS  P  NDWR LA  L I + S+++F  + S T ++LDLWEAQ+     L++L  +L +MGR
Sbjct:  577 VYGTFGCMGGRLVIPNSGLSLLVPPGAIPSGQFYQMYLTVHRDEDKRPVLEGSQTLLSPVVSCGPPSVPLLSPVILSLRHCA-ELNSEDWALGLKRQLD----SGHWEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEAL-GPAAVKRLRLAAFAPSVCPSL-------EYSLRLYCLNDDAESLAEVVELE-KQLGGRLLEEPTTLSFKANSGNLRLSIHAIPDVLWTNKLLNTFQEIPFWHVWPGCQRLLHCTFALERAGLSSTEFSCKLCVQQLEGEG----QVLQL------RTTLLNAPSATDDSPTEAA-------SAGSALVGP------------QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINSASMEYFETRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGR 965          

HSP 2 Score: 148.673 bits (374), Expect = 1.358e-36
Identity = 115/398 (28.89%), Postives = 177/398 (44.47%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCAD----KQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSF-GLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICD-PNLWTFWSEWSKCSGNPCKKERTRQCTTN---NCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGL--FVAVSVFLMVVAIIFCLIRRR 1508
            E +P F+Q+P+  Y V ++ P  ++C A P + +   C      ++  ++ E V  T  + ++              +   +V  + V E F   +Y C C AW+           +S  A +  +Y+ K+F+  P  + V +   V L C PPDA P AE+ W+KN E I       F I     L++   RL DS NY+CVA +     R +TA I V+  G WS W+EW           S C   C    Q+R R C+     N  A C G  +E   C  +C     W  WS+WS C G  C   R+R+C+     N GK    S ++  NC+ A C       + + K   E  +S     +VA+Y G+   V ++V +++ A I    RR+
Sbjct:   55 EPLPHFLQEPEDAYIV-RNKPVTMSCAASPATQIYFKCNGEWLHQKAHHIEERVDETTGRSVR--------------EVQTDVSRQQVEELFGLEDYWCQCVAWS------AAGTSKSRKAYVRIAYLRKNFEQEPLGKDVLLDHEVLLHCRPPDAIPQAEVEWLKNEEIIDPVIDQNFYITVDHNLIIKQTRLADSANYTCVAKNLVAKRRSSTATITVYVNGGWSQWTEW-----------SPCNSKCGRGTQKRTRSCSNPTPLNGGAVCDGQGVEKMPCSSLCPVDGGWVEWSKWSTC-GPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALC-------LQNAKYRDELYSSEARGDEVALYAGVAAVVVITVGIVLAAAILLYKRRQ 412          
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Match: tjp1a (tight junction protein 1a [Source:ZFIN;Acc:ZDB-GENE-031001-2])

HSP 1 Score: 63.1586 bits (152), Expect = 3.580e-10
Identity = 32/99 (32.32%), Postives = 51/99 (51.52%), Query Frame = 3
Query: 2049 ATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNL--SANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYS 2339
               DS+GG +S   + +++  P  +   G+ + I+   C     +P L     ETLLSP+V+CGP  +   KP  L +PHCA     G W+ ++ +S S
Sbjct: 1640 GVFDSNGGVLSSVETGVSVVVPRGAIPEGLEQEIYFKVCQDNSIIPALDKEKGETLLSPLVMCGPHGLRFLKPVELRLPHCAAMNPDG-WSFALKSSES 1737          
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002817.1 (pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-1 gene:ENSPMAG00000002526.1 transcript:ENSPMAT00000002817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.734e-8
Identity = 29/87 (33.33%), Postives = 44/87 (50.57%), Query Frame = 3
Query: 2058 DSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSAN--ETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNW 2312
            D+ GG +S   + +++  P  +  P + + I+   C     LP L     ETLLSP+V+CGP  +   KP  L +PHC    +  NW
Sbjct: 1597 DTHGGVLSSVETGVSIIIPKGAIPPAVEQEIYFKVCKDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHC----EPSNW 1679          
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Match: EDO46601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN0])

HSP 1 Score: 84.3445 bits (207), Expect = 2.153e-16
Identity = 102/467 (21.84%), Postives = 176/467 (37.69%), Query Frame = 3
Query: 1986 SDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGS-SYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITV--VISDLAMDWQASSANNYQEIPFKDVWHS----PTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDN----DWRQLARHL-SIT----RSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILE 3338
            S Q    P LP   +     W  ID +GG++ +  + I+L  PP++   G  E I++A        P L   + LLSP VVCGP  +   +P  L +PH A   +     +   T          W+    LD + +  P  Y  L ++ + ++        VVG   Y   +    L+    C G     A     V++YLIP     + +    + +R+G       K F   + + ++ V   + ++   W+  +    Q +PF  VW S    P +   F  I    N  +      +          + +      H ++  +      S+ T  S+   +   + +  +          S+    +  K+P   +IKLC  L+   P DN     W+ LA  +  IT    R L+           L+D WE     +  L+ L  ++  +GR D   ++E
Sbjct:  580 SKQQCPRPSLPERADERLCAWGRIDHNGGQLVIPNTGISLYVPPSALPQGQEEVIYIAMMKRSAKYPQLRPGQALLSPAVVCGPEGLQFNEPVFLKLPHNAALKNGEIPHLEGKTRSGESTDATTWRTLESLDGDPESRPISY--LDENSVEMMLTHFSDQTVVGEPEYLKIKVVPFLQ----CDG-----AQFDCRVQVYLIPRTKAALEEA-ILDASRVGLIQADTGKLFSLMNTSRDVRVKACLHEVDTKWKPVTPVQ-QALPFSQVWSSVEDMPNVTFGFAPIPDQPNLTTFRCNFEIQQYGETDLARIFVTYCIKDHEEEGAV----GSSASTPTSSPQRKLERWDSSSTLGI------GSEMQGPNENKIPRDIRIKLCIKLE---PADNLMIGSWKDLAGKIPGITTDHIRYLEGRKVGDGPVGALIDYWETSLSEKIPLHQLAQLMEDIGRRDAAELVE 1020          
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Match: EDO41849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S398])

HSP 1 Score: 70.0922 bits (170), Expect = 4.313e-12
Identity = 60/256 (23.44%), Postives = 109/256 (42.58%), Query Frame = 3
Query: 2064 SGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNL--SANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFI 2825
             GG +S   S +++  P  +   G+ + I+   C     +P L     ETLLSP+V+CGP      K   L +PHCA  T  G W+ ++ +S +P      W+       E KD      Q+  + + ++ +    F + G +  N  ATK +  + +         + + +  + L  ++     +V   ET   G    +         +A ++ V + D+A  W + SA   + I F+D W +   + + NF+
Sbjct:  820 EGGVLSSEESGVSIFIPEGAIPKGVEQEIYFKVCKENNIMPPLDTEKGETLLSPLVMCGPHGTKFLKSVELRLPHCAAMTPDG-WSFALKSSDTPTGMPTQWRNVSLPGQEHKDK----CQVDPNSVSVLVDHFSSFSLAGEARSN--ATKRMVASVFAQPP---MTNSEWLFHVVLADNMDSARREVQQAETA-CGRLQFSPFVPIDVHGDAKDVRVQLRDIADGWISRSACK-KYIEFQDTWEAYLQNPTVNFV 1063          
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Match: EDO33294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL1])

HSP 1 Score: 62.3882 bits (150), Expect = 1.794e-10
Identity = 47/172 (27.33%), Postives = 71/172 (41.28%), Query Frame = 3
Query:  744 FKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQ--IKNQKANCIGSEIEYKRCDL-ICD-PNLWTFWSEWSKCS 1247
            F   P++  + + GSV L        P   + W KNG+       P   I     LL++ ++  D+G+Y C A+   L     A ++V   G WS W  WT            C + C T  + R R C+     +  A C GS  + +RC    C  P  W+ W  W+ C+
Sbjct:    1 FTRTPQDTAIDL-GSVLLWHCTATGYPTPVLTWQKNGQGFNPWWPPHIRILANNSLLINGVKREDAGSYQCRATINSLSNAIQAVLIVRVPGGWSAWQSWT-----------PCTQSCGTGLRYRYRACDNPFPAHGGATCPGSNEDRERCSAQPCPVPGGWSAWQSWTPCT 160          
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Match: EDO31173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYQ3])

HSP 1 Score: 48.1358 bits (113), Expect = 1.311e-6
Identity = 35/122 (28.69%), Postives = 46/122 (37.70%), Query Frame = 3
Query: 1017 GQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQ--IKNQKANCIGSEIEYKRCDLICDP--NLWTFWSEWSKCSGN--PCKKERTRQC---TTNNCGKA---SSVEIDNCTLAEC 1346
            G W  W+ W           S C K C    Q R R C+    KN  + C+G   + + C +   P    W  W+ WS CS       + RTR C      N G A    S +   C +A C
Sbjct:    3 GHWGRWTAW-----------SACSKTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQTQACKIATSPVDGHWGSWTAWSACSKTCGDGTQTRTRMCDDPAPKNGGSACVGDSSQTQACKIATC 113          
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Match: EDO40760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S664])

HSP 1 Score: 51.9878 bits (123), Expect = 1.717e-6
Identity = 34/97 (35.05%), Postives = 46/97 (47.42%), Query Frame = 3
Query: 1017 GQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRC-DLICDPN-LWTFWSEWSKCSG--NPCKKERTRQCTT 1289
            G WSD+S W           S+C K C    Q R R C   K  +    C+G   E + C +  C  N  W+ +S+W+KCS      K+ERTR CT+
Sbjct:  287 GGWSDYSSW-----------SSCTKTCGGGTQTRTRTCTNPKPAHGGKECVGDAKETRHCSEAACAVNGGWSDFSKWTKCSKTCGGGKQERTRTCTS 372          
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 293.893 bits (751), Expect = 1.354e-83
Identity = 269/1010 (26.63%), Postives = 436/1010 (43.17%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYI-----THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKH-VSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P+  Y V K+ P  + C A P + +   C  +     +  V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW           S C   C    Q+R R C      N    C G  I+   C  +C  + +WT WS+WS C G  C + R R+C      N GK      ++  NCT   C   + S +      P+  T + +     T DVA+Y+G+ +AV + L++  I+   + R+      + +   S    G Q      ++    +  ++      D+ N  ++YR  V                   A  DV + I           PM  +PLL  + P LKI+   S   V+    PQ  L     S L   ++ SL ++   + N  N++  +S    C  +          + +S GG + +  S ++L  P  +   G    + +     +   P +   +T+LSPVV CGP   +  +P IL I HCA N    +W I +    S       W+  + +  E+  + P Y Q+  +   ++T  L  +C+VG S   K A K L++A +    CT LD         +R+Y + D  + + +V   ET ++G +L+   K    +D   N+ + I D+  M W++     YQEIPF  VW     +LHC+F  ++RL  A    +++S         C L + Q       Q   LS    +    +    T   + ++           + +     + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+     LN L  +L +MGR D
Sbjct:   62 EPLPHFLFEPEEGYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEE------RVDENSGLVVR----EASIEITRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEW-----------SPCNSRCGRGFQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSAC-GTECTQWRRRECNNPAPKNGGKDCEGLVLQSQNCTDGLC---MQSSLFQKSNVPKEKTDLGMPSAPSTDDVALYVGIVIAVIMCLVISVIVALFVYRKTHRDFDSDIIDTSALNGGFQ------SVNIKTARSADLLTAPPDLTNAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPLLDPL-PNLKIKVYNSSGLVT----PQDDLGGDFTSKLSPKITQSLLENSDTM-NLRNQSLARSRDPSCTAH---------GSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQE-DWLIQLKNRLS----MGEWEDVV-VVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSI-GKAAAKRLKLAVFGPVSCTTLDYH-------IRVYCLDDTQDALKEVLQMET-QMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFT-LERLTPAT---MELS---------CKLCVRQVEGE--GQIFQLSN---TLEEELQCIDTSLMDPAS-----------NITTLTGPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 945          
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 289.271 bits (739), Expect = 3.735e-82
Identity = 267/1005 (26.57%), Postives = 429/1005 (42.69%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKH-VSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P+  Y V K+ P  + C A P + +   C  +     +  V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW           S C   C    Q+R R C      N    C G  I+   C  +C  + +WT WS+WS C G  C + R R+C      N GK      ++  NCT   C     S                 T DVA+Y+G+ +AV + L++  I+   + R+      + +   S    G Q      ++    +  ++      D+ N  ++YR  V                   A  DV + I           PM  +PLL  + P LKI+   S   V+    PQ  L     S L   ++ SL ++   + N  N++  +S    C  +          + +S GG + +  S ++L  P  +   G    + +     +   P +   +T+LSPVV CGP   +  +P IL I HCA N    +W I +    S       W+  + +  E+  + P Y Q+  +   ++T  L  +C+VG S   K A K L++A +    CT LD         +R+Y + D  + + +V   ET ++G +L+   K    +D   N+ + I D+  M W++     YQEIPF  VW     +LHC+F  ++RL  A    +++S         C L + Q       Q   LS    +    +    T   + ++           + +     + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+     LN L  +L +MGR D
Sbjct:   47 EPLPHFLFEPEEGYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEE------RVDENSGLVVR----EASIEITRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEW-----------SPCNSRCGRGFQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSAC-GTECTQWRRRECNNPAPKNGGKDCEGLVLQSQNCTDGLCMQTAPS-----------------TDDVALYVGIVIAVIMCLVISVIVALFVYRKTHRDFDSDIIDTSALNGGFQ------SVNIKTARSADLLTAPPDLTNAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPLLDPL-PNLKIKVYNSSGLVT----PQDDLGGDFTSKLSPKITQSLLENSDTM-NLRNQSLARSRDPSCTAH---------GSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQE-DWLIQLKNRLS----MGEWEDVV-VVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSI-GKAAAKRLKLAVFGPVSCTTLDYH-------IRVYCLDDTQDALKEVLQMET-QMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFT-LERLTPAT---MELS---------CKLCVRQVEGE--GQIFQLSN---TLEEELQCIDTSLMDPAS-----------NITTLTGPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 911          
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 288.886 bits (738), Expect = 5.842e-82
Identity = 267/1005 (26.57%), Postives = 429/1005 (42.69%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGKASS---VEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKH-VSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P+  Y V K+ P  + C A P + +   C  +     +  V        ++D    L V+    + S+E+  + V E F   +Y C C AW+           +S  A +  +Y+ K F+  P  ++VS+   V L C PP+  P AE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R + TA ++V+  G WS W+EW           S C   C    Q+R R C      N    C G  I+   C  +C  + +WT WS+WS C G  C + R R+C      N GK      ++  NCT   C     S                 T DVA+Y+G+ +AV + L++  I+   + R+      + +   S    G Q      ++    +  ++      D+ N  ++YR  V                   A  DV + I           PM  +PLL  + P LKI+   S   V+    PQ  L     S L   ++ SL ++   + N  N++  +S    C  +          + +S GG + +  S ++L  P  +   G    + +     +   P +   +T+LSPVV CGP   +  +P IL I HCA N    +W I +    S       W+  + +  E+  + P Y Q+  +   ++T  L  +C+VG S   K A K L++A +    CT LD         +R+Y + D  + + +V   ET ++G +L+   K    +D   N+ + I D+  M W++     YQEIPF  VW     +LHC+F  ++RL  A    +++S         C L + Q       Q   LS    +    +    T   + ++           + +     + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+     LN L  +L +MGR D
Sbjct:   62 EPLPHFLFEPEEGYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEE------RVDENSGLVVR----EASIEITRQQVEELFGPEDYWCQCVAWS------SAGTTKSRKAHVRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEW-----------SPCNSRCGRGFQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLCTVDGVWTEWSKWSAC-GTECTQWRRRECNNPAPKNGGKDCEGLVLQSQNCTDGLCMQTAPS-----------------TDDVALYVGIVIAVIMCLVISVIVALFVYRKTHRDFDSDIIDTSALNGGFQ------SVNIKTARSADLLTAPPDLTNAAAMYRGPVY------------------ALHDVSDKI-----------PMTNSPLLDPL-PNLKIKVYNSSGLVT----PQDDLGGDFTSKLSPKITQSLLENSDTM-NLRNQSLARSRDPSCTAH---------GSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQE-DWLIQLKNRLS----MGEWEDVV-VVGEENFTTPCYVQMDSEACHILTETLGTYCLVGQSI-GKAAAKRLKLAVFGPVSCTTLDYH-------IRVYCLDDTQDALKEVLQMET-QMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWSGSQRSLHCTFT-LERLTPAT---MELS---------CKLCVRQVEGE--GQIFQLSN---TLEEELQCIDTSLMDPAS-----------NITTLTGPNAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHD 926          
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 288.5 bits (737), Expect = 8.741e-82
Identity = 256/1013 (25.27%), Postives = 435/1013 (42.94%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIY-----ITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQE--LGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHN--KQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  E          ++D    L V+    + S+E+  + V E F   ++ C C AW+           +S  A +  +Y+ K F   P  ++VS+   V L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R++ TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  I+   C+ +C  + LWT WS+WS C G  C   R R C      N GK    + ++  NCT   C   + S +N      +    +       T DVA+Y+G+ +AV + L++  ++   + RR      + +   S    G Q       +    +  ++      D+ +  +LYR  V                   A  DV + I           PM  +PLL  + P LKI+           +Y   GLV     L    SS LS       L N+D+    ++ ++  L    +       +  S GG++ +  S ++L  P  +   G    +++     E   P++   +T+LSPVV CGP   +  +P ++ + HCA      +W I + +      Q+  W+  + +  E+  + P Y Q+  +   ++T  L  +C+VG S  +    K L++A +    C  ++         +R+Y + D  + + +V   E  ++G +L+   K    +D   N+ + I D+  M W++     YQE+ F+ VW      LHC F              + S +++D    C + + Q        +    LS  + S  TS+   ++  +                       + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+    +L+ L  +L +MGR D
Sbjct:   41 EPLPVFLMEPEEAYIV-KNKPVNLYCKATPATQIYFKC-NSEWVHQKEHTVEE-----RVDENSGLVVR----EASIEITRQQVEELFGPEDFWCQCVAWS------SAGTTKSRKAHVRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRSCTNPAPLNGGAICDGQGIQKLPCNPLCPVDGLWTEWSKWSTC-GTECTHWRRRDCGAPAPKNGGKDCEGTVLQSKNCTDGLC---MQSSLNPKSSEAKGKNDLGNSLAPSTDDVALYVGIVIAVIMCLVISVVVALFVYRRNHRDFSSDILDSSALNGGFQ------PVSIKTARKADLLTAPPDLTSAAALYRGPVY------------------ALHDVADKI-----------PMTNSPLLEPL-PNLKIK-----------VYNSSGLVTPQDDLGGEFSSKLSPKLPHCLLDNSDSTMGRRTQSQTLL-RTRDPSCTALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQ----SQQNQWEDVV-VVGEENFTTPCYVQMDDEACHILTETLGTYCLVGQSL-SAATIKRLKLAIFGPVTCAAMEYH-------IRVYCLDDTQDALKEVLQME-KQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVWSGSQRNLHCCFTL-----------ERFSTSTVDLT--CKICVRQVEGEGQIFQLDTTLSEDSQSIDTSLLDPASNITTLVG------------------PNAFRIPVSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSRLAQVLEEMGRHD 928          
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 287.73 bits (735), Expect = 1.047e-81
Identity = 255/1008 (25.30%), Postives = 430/1008 (42.66%), Query Frame = 3
Query:  369 EGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFS--EYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHA-TAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIK--NQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT---NNCGK---ASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDI-NQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQE--LGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAY----CTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLA-MDWQASSANNYQEIPFKDVWHSP--TLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHN--KQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLD 3320
            E +P F+ +P+  Y V K+ P  + C A P + +   C + ++ +  E          ++D    L V+    + S+E+  + V E F   ++ C C AW+           +S  A +  +Y+ K F   P  ++VS+   V L C PP+  PPAE+ W+KN E I       F I     L++   RL+D+ NY+CVA +   +R++ TA ++V+  G WS W+EW+ +C + C +G           Q+R R C      N  A C G  I+   C+ +C  + LWT WS+WS C G  C   R R C      N GK    + ++  NCT   C     S                 T DVA+Y+G+ +AV + L++  ++   + RR      + +   S    G Q       +    +  ++      D+ +  +LYR  V                   A  DV + I           PM  +PLL  + P LKI+           +Y   GLV     L    SS LS       L N+D+    ++ ++  L    +       +  S GG++ +  S ++L  P  +   G    +++     E   P++   +T+LSPVV CGP   +  +P ++ + HCA      +W I + +      Q+  W+  + +  E+  + P Y Q+  +   ++T  L  +C+VG S  +    K L++A +    C  ++         +R+Y + D  + + +V   E  ++G +L+   K    +D   N+ + I D+  M W++     YQE+ F+ VW      LHC F              + S +++D    C + + Q        +    LS  + S  TS+   ++  +                       + F++P   + KLC  LD+     NDWR LA  L++ R L +F+ K S T ++LDLWEAQ+    +L+ L  +L +MGR D
Sbjct:   41 EPLPVFLMEPEEAYIV-KNKPVNLYCKATPATQIYFKC-NSEWVHQKEHTVEE-----RVDENSGLVVR----EASIEITRQQVEELFGPEDFWCQCVAWS------SAGTTKSRKAHVRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIVYVNGGWSTWTEWS-VCNSRCGRG----------YQKRTRSCTNPAPLNGGAICDGQGIQKLPCNPLCPVDGLWTEWSKWSTC-GTECTHWRRRDCGAPAPKNGGKDCEGTVLQSKNCTDGLCMQMAPS-----------------TDDVALYVGIVIAVIMCLVISVVVALFVYRRNHRDFSSDILDSSALNGGFQ------PVSIKTARKADLLTAPPDLTSAAALYRGPVY------------------ALHDVADKI-----------PMTNSPLLEPL-PNLKIK-----------VYNSSGLVTPQDDLGGEFSSKLSPKLPHCLLDNSDSTMGRRTQSQTLL-RTRDPSCTALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQ----SQQNQWEDVV-VVGEENFTTPCYVQMDDEACHILTETLGTYCLVGQSL-SAATIKRLKLAIFGPVTCAAMEYH-------IRVYCLDDTQDALKEVLQME-KQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVWSGSQRNLHCCFTL-----------ERFSTSTVDLT--CKICVRQVEGEGQIFQLDTTLSEDSQSIDTSLLDPASNITTLVG------------------PNAFRIPVSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSRLAQVLEEMGRHD 909          
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Match: SMESG000040323.1 (SMESG000040323.1)

HSP 1 Score: 2125.13 bits (5505), Expect = 0.000e+0
Identity = 1045/1049 (99.62%), Postives = 1045/1049 (99.62%), Query Frame = 3
Query:  216 MKFQILLLAVFIIDRLISSLAQNGILTDWDSKENHEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIKNQKANCIGSEIEYKRCDLICDPNLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQINA 3362
            MKFQILL AVFIIDRLISSLAQNGILTDWDSKENHEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQI NQKANCIGSEIEYKRCDLICD NLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDKNLKKNLSNLSNKQINLIDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLS NETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQINA
Sbjct:    1 MKFQILLQAVFIIDRLISSLAQNGILTDWDSKENHEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQINNQKANCIGSEIEYKRCDLICDSNLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDKNLKKNLSNLSNKQINLIDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSTNETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQINA 1049          
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 435.261 bits (1118), Expect = 3.339e-135
Identity = 331/1041 (31.80%), Postives = 501/1041 (48.13%), Query Frame = 3
Query:  318 HEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMD--NEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFE-------VGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQ--IKNQKANCIGSEIEYKR--CDLICDPNLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYP------DXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSP-----LKQ---KPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW---HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTP--NGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
             E++ + D V  +E  LEG+P FI++P+S+YYV +  PA I CIA+PVSHVNI C  + +SYM+ E+S + L+V KM+  NE  L   G+RW FSLE+ +  V EWF+ + C CEAWNQI  L+  KKV S   VI ++Y   +FK VP+++ V    S+ L+C+PP++KP A++ W+KN +++   +  + +I E  +LL+ +  LTDSGNYSC+A S   +R++   I+  +         QWS WS   G C                 ++ R R CN   +  +  +C   E EY R     + +PN                           N    SS++         G FVA                         + + V V      + IIFCLIRR+ +        RY    NG  + Y         +   +  N      +L ++ Q   Y S   PN  P  P+  S+ SS +AY+  G D +Y            + PL+S+         S + S +S+T +    L   VS  PI  S   S  Y EL + D E+   S   P +  N +   + W TI + GGR+ L  S I LT  P SF    S  ++LA   ++ + P LS NETLL+P+V+ GP +V   KP +L++PH A +   GNW I +L+   P     LK+   +P W+    +  E  D  P Y  L     F++ +Q Q+ C+VG SY   +ATK LR+AA+   L          +R+Y+  D  E    V   ET +LG+ L+    Q    D  GN+   I +L+  W++     YQEIPF+D+W    S TLHC+F F     N + S+  ++         C ++ YQ+  +  KQ + +     + S+H        +   YS   +     ++D        +VF++   T+ KLC LLD++TP  NDW+QL R LS+   L +F +K+S T+ L+ LWE++N +  +L +LI  L+ +GR DC  +LE D
Sbjct:   34 REIEDENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLT-NGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFENN--RIKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWSACDGNC-----------------KKTRTRNCNSKGVCKEIDSCTKKECEYNRAVAPFVKNPN--------------------------KNGVSTSSLQDARDIAMYVGLFVA-------------------------VTILVMV------ITIIFCLIRRKAL-LPLRSTMRYPLNINGNGVAYDVKNSLIKNSNTISTKNPYIMDTSLANLTQQRSYLSQSPPNLPP--PTCLSEISSTNAYS-TGIDFSYNSTGS----GKFSQPLISNSSSASTTNKSKATS-LSNTDHKPDPLT--VSGTPIN-SRPPSALYHEL-SLDRESICNS--PPFVSENIDISTLAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSA-DLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIGCE-TDQTPIYTHLDPYAAFIMLDQPQKICLVGQSYPGGKATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIET-KLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTF----DNIDPSQQSLT---------CRITAYQSGFYSQKQVITIKQDKLDRSNHKRDLIQHEKVLLYSESNNT----YLDP-----LMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESD 957          
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Match: SMESG000073898.1 (SMESG000073898.1)

HSP 1 Score: 324.709 bits (831), Expect = 2.097e-94
Identity = 180/427 (42.15%), Postives = 259/427 (60.66%), Query Frame = 3
Query:  321 EVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGI--CPNICSKGSNC-PKVCSTSRQQRVRYC--NQIKNQKANCIGSEIEYKRCDLICDP--NLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRR-VIGFSPNRVWRYSTTANGIQMFY 1577
            EVD KKDLV P+EKH +G+PKFI +P+  YYV+KSHPA I CIA+PVSHVNIFCADKQ+SYMN+E+S +GL V+KM+   +   KG RWKFS  V++KD+IEWFSEY+C+CEAWN+I  + K KKV SS+A+I +SY   +FK  P N K++    + L C PPD+KP +++ W+KN E IT  ++P   I+EY  L++  +  +DSGNY+CVA S G+ +   ++I V  V    +WS WT +  CP IC     C  ++CS   ++R+R+C  +  K    NC G + E + CD+ C+   + W  WS W+      C + R R+C +  C      +I NC+ A C            + P+ S  +  +    MY+ LF+ +S+  +++ II CLI ++  I   P R   +S   NGI   Y
Sbjct:   35 EVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVK--KSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQ-QIRNCSQAIC------------QKPDPSL-LLESQSTTMYLSLFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGITKIY 445          

HSP 2 Score: 202.216 bits (513), Expect = 6.305e-53
Identity = 133/453 (29.36%), Postives = 227/453 (50.11%), Query Frame = 3
Query: 2013 LPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTS-YSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVG--SSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLD---FNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQ 3353
            LP +   E + W TI ++GGR+ L  S I+LT P  +   G SE +FLA C    ++P +   E LLSPV++CGP +    KP IL IPHCA N    +W I VL++ +   +  P W++   +   ++     YAQL      LI + LQ  C+ G  S   +   +  LR+ A+   L    ++   ++R++LIPD  E I  V   E  +L  +L+ N K+       G+I   + DL++ W+  + +  Q   +  VW             RL ++ + E+ I +  +D     + C +++ Q +   N+  + +      ++ S+   S    + S   SQ+   ++D       ++VF+L   T+ +L  LLDS       W+ LA H+ +  +L +FS K S ++ LLDLWE++     ++ +LI+ILR +GR DC  I+E+++++
Sbjct:  571 LPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCA-NIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLS---SEVDHLIRVHLIPDTKEAIENVIVSEL-KLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVW-------------RLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQA---YLDP-----LQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILK 991          
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 309.301 bits (791), Expect = 2.743e-89
Identity = 247/757 (32.63%), Postives = 365/757 (48.22%), Query Frame = 3
Query: 1155 NCIGSEIEYKRCDLIC--------DPNLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYP------DXXXXXXXXXXXXXXXXXXDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTSYSP-----LKQ---KPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVW---HSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTP--NGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKD 3344
            +CI   +E KR   I           N  T WS WS C GN CKK RTR C +    K    EID+CT  EC                S++S+    D+AMY+GLFVAV++ +MV+ IIFCLIRR+ +        RY    NG  + Y         +   +  N      +L ++ Q   Y S   PN  P  P+  S+ SS +AY+  G D +Y            + PL+S+         S + S +S+T +    L   VS  PI  S   S  Y EL + D E+   S   P +  N +   + W TI + GGR+ L  S I LT  P SF    S  ++LA   ++ + P LS NETLL+P+V+ GP +V   KP +L++PH A +   GNW I +L+   P     LK+   +P W+    +  E  D  P Y  L     F++ +Q Q+ C+VG SY   +ATK LR+AA+   L          +R+Y+  D  E    V   ET +LG+ L+    Q    D  GN+   I +L+  W++     YQEIPF+D+W    S TLHC+F F     N + S+  ++         C ++ YQ+  +  KQ + +     + S+H        +   YS   +     ++D        +VF++   T+ KLC LLD++TP  NDW+QL R LS+   L +F +K+S T+ L+ LWE++N +  +L +LI  L+ +GR DC  +LE D
Sbjct:  244 SCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWSACDGN-CKKTRTRNCNSKGVCK----EIDSCTKKECE--------------LSTSSLQDARDIAMYVGLFVAVTILVMVITIIFCLIRRKAL-LPLRSTMRYPLNINGNGVAYDVKNSLIKNSNTISTKNPYIMDTSLANLTQQRSYLSQSPPNLPP--PTCLSEISSTNAYS-TGIDFSYNSTGS----GKFSQPLISNSSSASTTNKSKATS-LSNTDHKPDPLT--VSGTPIN-SRPPSALYHEL-SLDRESICNS--PPFVSENIDISTLAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSA-DLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIGCE-TDQTPIYTHLDPYAAFIMLDQPQKICLVGQSYPGGKATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIET-KLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTFD----NIDPSQQSLT---------CRITAYQSGFYSQKQVITIKQDKLDRSNHKRDLIQHEKVLLYSESNNT----YLDP-----LMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESD 941          

HSP 2 Score: 217.624 bits (553), Expect = 6.463e-58
Identity = 111/269 (41.26%), Postives = 166/269 (61.71%), Query Frame = 3
Query:  318 HEVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMD--NEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFE-------VGQWSDWSEWTGICPNICSKGSNCPKVC 1097
             E++ + D V  +E  LEG+P FI++P+S+YYV +  PA I CIA+PVSHVNI C  + +SYM+ E+S + L+V KM+  NE  L   G+RW FSLE+ +  V EWF+ + C CEAWNQI  L+  KKV S   VI ++Y   +FK VP+++ V    S+ L+C+PP++KP A++ W+KN +++   +  + +I E  +LL+ +  LTDSGNYSC+A S   +R++   I+  +         QWS WS   G C    ++  N   VC
Sbjct:   34 REIEDENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLT-NGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFENN--RIKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWSACDGNCKKTRTRNCNSKGVC 299          
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Match: SMESG000000615.1 (SMESG000000615.1)

HSP 1 Score: 267.314 bits (682), Expect = 2.866e-74
Identity = 274/1058 (25.90%), Postives = 458/1058 (43.29%), Query Frame = 3
Query:  378 PKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQ--------YSYMNEEVSATGLKVIKMDNEGRL-----AVKGNRWKFSLEVQHKDVIEWF-SEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVA-SSFGLERHATAQILVF-----EVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQRVRYCNQIKNQKANCIGSEIEYKRCDLICDPN-LWTFWSEWSKCSGNPCKKERTRQCTT-------NNC-GKASSVEIDNCTLAECGGFVASFINSNKKYPE-SSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQ-MFYPDXXXXXXXXXXXXXXXXXXDINQPSL--YRSIVLPNSLPFL-PSNQSDASSNSAYTD---VGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDH----YQELGNTDNETSDQSVTEPCLPYNFN------GENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSANETLLSPVVVCGPTNVIAF-KPFILNIPHCAYNTDSGNWAISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVGS-----SYRNKR--------------ATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAE----CISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILE 3338
            P F++ P    YV+ S   +I C+ +  S + I C + Q         S +++      LK  K  ++ +      +V+G+    +L +  K V  WF   + C CEA    +     + V +    I  +YI+K FK  P +  + +   VKL+CIPPD  P  +IHW KNG K+      +  +++ G L++ +  +TD+G Y CVA +  G+     A++ V      E G W  W+ W   CPN C+ G  C   C    ++R R C      +  C GS ++ + C   C  +  W  WS WS C  + C ++R R+C         + C  K S  E +NCTL  C     S  + N +    +  + Y+  D+ +Y+ L +A+ + ++V  II C  ++  +         +ST +N I      DK     L +L NK   + D N  S+  Y S    NS P +  +N    SSNS       V N                    LS++  TLK  P+   SK  S  +P +    H   + +P S  L+++    YQ +           ++ P +  N N      G N++   I +SGGR+ L  + I++T  P++F    +  + L + ++ + L   S   T LS ++ C     I+  KP IL  PHC       +W + V+   +  K    W+ Y+D       +   Y  L ++  +L+T +L  FC++G      SY NK               A K L + ++   L+  H  +Q+ +  YL  D  +     ISK+        G R+         ++ A N++V +   +  W+  + + YQEI F+D+W+  T      FI R I    SE      ++   +   +++YQ N + ++  + +S  +     +++ +ST  S Y     +  P      SKT     F+LP  T  +L   LD      + W  +A+ L I+ +L++F  + + T  LL LWEAQN    +L +L   L+ +G LD   + +
Sbjct:   32 PIFVKMPPEHLYVTPSKAVMIECVVKQSSFLQINCVEDQDTISKTSTASLLDQSKETVYLKPNKKSDKKQFDKITKSVQGDVHSVNLTLTEKTVESWFVRNFWCQCEAAYTQDSSTSNQLVRTKKTFIEVAYIDKTFKLEPNSATLYLGRYVKLTCIPPDGSPKPKIHWRKNGRKLELTDLSKILVSDDGSLVIFSTSITDNGQYECVAENEAGIRISKAAKLEVLDTDSTENGDWLPWAPWNA-CPNDCTYGKYCVDSCIKYLRRRSRLCKTSSKDRVKCPGSSLQTESCATFCRVDGEWNTWSGWSLCQPD-CTRKRIRECNNPKPQSGGDQCLPKNSFSEKENCTLDSCFRIDKSKFSENIEIRSPNPQNRYVLRDMVVYVVLSIALFLLILVTTIILCFQKKHFL---------FSTQSNEINSKIGGDKGGFILLKSLGNKNAIVKDNNSESVTTYNSGSGNNSSPLINEANMKHDSSNSTICTSRFVDN--------------------LSTVDVTLKNTPA---SKQVSFQHPPISC--HYKEVELPTSPILANYPSLIYQPIST--------PISLPPIIENRNLISNGSGSNLL---ISNSGGRVILGSTGISVTVMPDTFGSEKTISMELYSKHTHERLIEFS-KYTQLSSIIFCSLKETISLQKPLILVFPHCVTWKSFSSWDMKVVKMNNNFK----WEVYIDFQNPQMSNKQAYCHLDEEFCYLMTFELFPFCLLGKSQNPLSYDNKDNFDLSNQFPLPVFLADKRLCVISF---LEPLHQQKQLQLSCYLFIDTKDIKDYLISKI-----TAAGCRIFDIPHILSLKESAANVSVTVESASTSWKVHAKHRYQEILFEDLWNFRTEP----FITRNIILEHSE------TIFQPFIGHITVYQNNFYQDRIEISVSFNSTEISNTLNKSSTPSSTYKDATCKLIP-----ASKT-----FRLPRVTIRELSIHLDPPKIPVSQWSMIAKQLGISNNLEYFHRQSNPTAYLLMLWEAQNREETALVDLKSTLKIIGLLDIANVFK 1009          
The following BLAST results are available for this feature:
BLAST of Unc-5 netrin receptor B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5B2.733e-8827.34unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5B1.187e-8627.06unc-5 netrin receptor B [Source:HGNC Symbol;Acc:HG... [more]
UNC5C9.072e-7825.10unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5C1.537e-7725.10unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5C6.399e-5225.25unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-57.113e-4323.81Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-54.811e-4224.01Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-57.904e-3924.32Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-53.301e-3223.86Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-51.416e-2826.46Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-51.119e-2126.01gene:FBgn0034013 transcript:FBtr0339998[more]
unc-51.119e-2126.01gene:FBgn0034013 transcript:FBtr0087382[more]
pyd4.217e-831.31gene:FBgn0262614 transcript:FBtr0310205[more]
pyd4.554e-831.31gene:FBgn0262614 transcript:FBtr0305297[more]
robo17.077e-723.81gene:FBgn0005631 transcript:FBtr0071922[more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5b3.970e-8226.88unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b4.043e-8226.88unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b2.372e-8126.54unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5da6.012e-6824.88unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5a9.292e-4429.84unc-5 netrin receptor A [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5B2.040e-9126.92unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B3.590e-9126.92unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B6.722e-9126.78unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B4.653e-9026.50unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
UNC5B7.017e-9026.73unc-5 netrin receptor B [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc5b5.730e-8426.94unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI... [more]
Unc5c1.683e-8225.69unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c1.683e-8225.69unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5b1.727e-8226.65unc-5 netrin receptor B [Source:MGI Symbol;Acc:MGI... [more]
Unc5c8.115e-8125.54unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JGT4|UN5BA_XENLA6.505e-8826.36Netrin receptor UNC5B-a OS=Xenopus laevis OX=8355 ... [more]
sp|Q8IZJ1|UNC5B_HUMAN1.313e-8727.34Netrin receptor UNC5B OS=Homo sapiens OX=9606 GN=U... [more]
sp|C5IAW9|UN5BB_XENLA1.795e-8726.73Netrin receptor UNC5B-b OS=Xenopus laevis OX=8355 ... [more]
sp|Q8K1S3|UNC5B_MOUSE4.008e-8326.94Netrin receptor UNC5B OS=Mus musculus OX=10090 GN=... [more]
sp|O08722|UNC5B_RAT5.745e-8326.69Netrin receptor UNC5B OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E1CHK71.288e-16232.95Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Dju... [more]
A0A210QTQ72.316e-11028.52Netrin receptor UNC5C OS=Mizuhopecten yessoensis O... [more]
A0A1S3JPZ44.737e-10728.28netrin receptor UNC5C-like isoform X3 OS=Lingula u... [more]
D1LX772.953e-10527.55Netrin receptor unc5-like protein OS=Saccoglossus ... [more]
A0A1S3JQG54.032e-10527.85netrin receptor UNC5C-like isoform X1 OS=Lingula u... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5b2.017e-8126.68unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5b2.488e-8126.54unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5c3.967e-8025.62unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5b1.503e-7826.44unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5b1.380e-6825.90unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008404.12.335e-7425.95pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
ENSPMAT00000003861.18.843e-6425.09pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 g... [more]
ENSPMAT00000010609.11.073e-4329.63pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1... [more]
tjp1a3.580e-1032.32tight junction protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000002817.11.734e-833.33pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466012.153e-1621.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418494.313e-1223.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332941.794e-1027.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311731.311e-628.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407601.717e-635.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-72b7.11.354e-8326.63netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.13.735e-8226.57netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.15.842e-8226.57netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
unc5c8.741e-8225.27netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
unc5c1.047e-8125.30netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of Unc-5 netrin receptor B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040323.10.000e+099.62SMESG000040323.1[more]
SMESG000025091.13.339e-13531.80SMESG000025091.1[more]
SMESG000073898.12.097e-9442.15SMESG000073898.1[more]
SMESG000025091.12.743e-8932.63SMESG000025091.1[more]
SMESG000000615.12.866e-7425.90SMESG000000615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013824 ID=SMED30013824|Name=Unc-5 netrin receptor B|organism=Schmidtea mediterranea sexual|type=transcript|length=3424bp
GTCTACTAAACATAATCAATCCATATCTCAAGCTCTCTATCAATGCGGAT
TCATCAGATTACGATAGTGAACATTTTTAGAATATATTTCTAAAGTAAAC
ATTTAAAAAAATCCTTCGTTTTTAACTGTCTTTTTCAAGAAAAAATTAAT
TCAAAAAAAACCGATTTGAAATTTTTCGGGAAAAAATATTTTCAAATTTG
AAAAATTTGATTGTCATGAAATTTCAGATTTTGCTCCTAGCGGTCTTCAT
CATAGACAGGTTGATTAGTTCTCTTGCTCAAAATGGAATTTTAACAGATT
GGGACTCAAAGGAAAATCATGAAGTCGATTCGAAAAAGGATCTCGTTTTG
CCGAGTGAAAAACATCTTGAAGGGGTTCCGAAATTCATTCAGCAGCCGAA
ATCAATGTATTACGTTTCAAAAAGTCATCCAGCTGTCATTACCTGCATTG
CTCAGCCCGTGTCACATGTCAATATTTTTTGTGCCGATAAACAATATTCT
TACATGAATGAGGAAGTATCGGCAACGGGATTGAAAGTAATCAAAATGGA
TAATGAAGGAAGGCTAGCCGTCAAAGGAAACCGATGGAAATTTTCTTTAG
AGGTTCAACATAAAGATGTGATTGAATGGTTTAGTGAATACAGGTGTCAT
TGTGAGGCTTGGAATCAAATTGAGCAACTTCAAAAGGTGAAAAAAGTCGA
GAGCTCGTCTGCTGTTATTTACGATTCATATATCAATAAAGATTTCAAAA
CTGTTCCAAAAAATCAAAAAGTTTCTGTGCGGGGCAGCGTTAAATTGTCT
TGCATACCACCAGACGCTAAACCTCCAGCTGAAATTCATTGGGTGAAAAA
TGGTGAGAAAATAACCGGAAAATCCCATCCTCAATTTGAGATCAATGAAT
ATGGGGAACTGCTTTTATCCAATATCAGATTGACTGATTCCGGAAATTAT
TCCTGTGTCGCTTCTAGTTTTGGACTCGAGAGACATGCAACAGCACAAAT
TTTGGTTTTTGAAGTTGGCCAATGGTCTGATTGGTCAGAATGGACGGGAA
TTTGTCCGAATATCTGTTCAAAGGGATCAAATTGTCCGAAAGTGTGCAGT
ACATCAAGACAACAACGAGTACGTTATTGCAATCAAATAAAAAATCAAAA
AGCAAACTGCATTGGATCAGAAATCGAATACAAAAGATGTGATTTAATAT
GTGATCCAAATTTATGGACATTCTGGTCAGAATGGAGCAAATGCTCAGGA
AATCCTTGTAAAAAAGAACGAACAAGACAATGCACAACTAATAACTGTGG
TAAAGCGAGTTCAGTAGAAATAGACAATTGTACCTTGGCTGAATGTGGAG
GATTCGTTGCCTCATTTATCAATAGCAATAAAAAATATCCCGAAAGTTCT
ACCAGTATTTATATAACCCATGATGTAGCAATGTATATTGGCTTGTTTGT
TGCGGTATCTGTCTTTCTTATGGTTGTCGCTATTATCTTTTGTTTAATTC
GACGACGAGTAATTGGGTTTTCTCCAAACCGAGTATGGAGATATAGTACG
ACAGCAAATGGTATTCAAATGTTTTATCCAGATAAAAATCTGAAAAAGAA
TCTAAGTAATCTATCGAACAAGCAAATAAATTTAATTGATATTAACCAAC
CTTCACTATACCGTTCAATTGTACTTCCCAACAGTCTTCCATTTCTCCCA
AGCAATCAGTCTGACGCCAGTAGCAATTCCGCGTACACGGATGTAGGCAA
CGATATAACTTATATTCAACGCAATCACTTGCCATCATTGCCTATGATTG
CCACCCCTCTGCTATCTTCAATGAAACCAACGTTGAAAATCAGGCCTTCA
TATAGCGATTCAAAAGTCAGTAGCACGTTATATCCTCAAATGGGTTTAGT
GAAGCACGTCTCAACTTTACCTATACCGGTTTCGAGCTCCTTGTCGGATC
ATTATCAGGAACTTGGTAATACGGACAATGAAACATCAGATCAGTCTGTC
ACTGAGCCTTGTTTACCGTATAATTTCAATGGAGAAAATATGATTTGGGC
TACAATTGACTCAAGTGGTGGACGTATTTCGTTGGCACTTTCAGATATCA
ATCTGACTTGTCCTCCGAATTCTTTCGCTCCTGGAATTTCTGAACCGATT
TTCTTGGCAACTTGTAACAGTGAACAAGACTTACCTAATTTGAGTGCAAA
TGAAACATTGCTTTCTCCTGTGGTCGTTTGTGGTCCCACTAATGTGATTG
CATTCAAACCGTTTATACTCAATATACCTCATTGTGCTTATAATACTGAT
TCTGGTAATTGGGCCATCAGTGTTTTAACTTCGTACAGTCCTTTGAAACA
AAAACCTTATTGGCAGAAATATTTGGATCTTGATGCCGAAGACAAAGATT
CTCCACCTGGATACGCCCAACTAGCAAAAGATCGGCTGTTTTTAATAACC
AATCAATTGCAAAGATTTTGTGTAGTTGGCAGCAGTTATAGAAATAAGCG
GGCAACAAAAGTTCTTCGAATCGCCGCTTATTGTACTGGATTAGATAGAA
GACATGCCGATGAACAAATTGTAGTTAGACTGTATCTGATACCTGATATT
GCAGAATGCATTTCCAAAGTACATAATTTCGAAACAAACCGTTTAGGCGC
CAGACTAGTCACGAATCAGAAACAGTTTTTTTGTGAAGATGAAGCTGGAA
ATATTACAGTAGTGATTTCTGATTTAGCAATGGATTGGCAGGCAAGCAGT
GCTAACAACTATCAGGAAATTCCGTTCAAAGATGTTTGGCATTCACCGAC
ATTGCATTGTTCCTTTAATTTCATCAAACGGCTGATAAATGCAAACAGCT
CAGAATTGAAAATATCTGTCAATTCATTAGATTTCAATTGGTTTTGCACT
CTCAGCATCTATCAAACAAATTCTCATCATAATAAACAAACCGTTTTGCT
TTCTACACCCAACGGTTCTTCTCATACATCAATTTCAGCCACTTCTACCC
AGTTTTCAAATTACAGTGCCGGAGGTAGCCAGAGTTTTCCTTATTTTGTT
GATGATTGCAGCAAAACTAATTTCGAATCCGTTTTCAAATTGCCAGAACA
AACGAAAATAAAGTTGTGCAAATTATTGGATTCTCTTACACCTTTAGATA
ATGATTGGAGACAATTAGCCAGACATCTTTCCATTACAAGATCTCTACAG
TTCTTCTCAAACAAATTGAGTTCCACTGAAATTCTTCTTGATTTATGGGA
AGCTCAAAATCATTCAAGAAAATCTCTCAATAATTTAATCGATATTCTCA
GAAAAATGGGTCGATTAGACTGTGTAGCAATTTTAGAGAAAGATTTGATA
CAAATCAATGCTTGACATTTTTTTGGACTTTTTTTTAAAACAATTTAATC
ATATCAGCGTTTTTTTAATGTGAA
back to top

protein sequence of SMED30013824-orf-1

>SMED30013824-orf-1 ID=SMED30013824-orf-1|Name=SMED30013824-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1050bp
MKFQILLLAVFIIDRLISSLAQNGILTDWDSKENHEVDSKKDLVLPSEKH
LEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEE
VSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWN
QIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPD
AKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVAS
SFGLERHATAQILVFEVGQWSDWSEWTGICPNICSKGSNCPKVCSTSRQQ
RVRYCNQIKNQKANCIGSEIEYKRCDLICDPNLWTFWSEWSKCSGNPCKK
ERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYI
THDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGI
QMFYPDKNLKKNLSNLSNKQINLIDINQPSLYRSIVLPNSLPFLPSNQSD
ASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSK
VSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCL
PYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATC
NSEQDLPNLSANETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWA
ISVLTSYSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQR
FCVVGSSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECIS
KVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQ
EIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLDFNWFCTLSIYQ
TNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSK
TNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNK
LSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQINA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005042netrin receptor activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0038007netrin-activated signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033772UPA
IPR037936UNC5
IPR036179Ig-like_dom_sf
IPR000884TSP1_rpt
IPR003599Ig_sub
IPR003598Ig_sub2
IPR000488Death_domain
IPR000906ZU5_dom
IPR011029DEATH-like_dom_sf
IPR013783Ig-like_fold
IPR007110Ig-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 181..265
e-value: 2.8E-10
score: 50.2
IPR000488Death domainSMARTSM00005DEATH_4coord: 953..1044
e-value: 3.4E-12
score: 56.5
IPR000488Death domainPFAMPF00531Deathcoord: 966..1042
e-value: 1.5E-15
score: 57.1
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 980..1044
score: 12.019
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 270..330
e-value: 0.82
score: 10.0
coord: 334..378
e-value: 0.0039
score: 26.4
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 331..378
score: 8.95
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 267..330
score: 8.967
IPR000906ZU5 domainSMARTSM00218zu_1coord: 606..710
e-value: 1.3E-12
score: 57.9
IPR000906ZU5 domainPFAMPF00791ZU5coord: 610..706
e-value: 6.8E-23
score: 80.9
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 608..757
score: 17.611
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 187..254
e-value: 3.4E-6
score: 36.6
IPR033772UPA domainPFAMPF17217UPAcoord: 764..885
e-value: 2.7E-11
score: 43.5
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 605..759
e-value: 1.3E-20
score: 75.4
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 948..1046
e-value: 3.4E-24
score: 86.6
NoneNo IPR availablePFAMPF13927Ig_3coord: 181..250
e-value: 1.0E-10
score: 42.1
NoneNo IPR availablePANTHERPTHR12582:SF6NETRIN RECEPTOR UNC5Bcoord: 42..1039
NoneNo IPR availableCDDcd08781Death_UNC5-likecoord: 959..1041
e-value: 5.42399E-30
score: 111.599
NoneNo IPR availableCDDcd00096Igcoord: 192..261
e-value: 2.06224E-10
score: 55.7112
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.535
NoneNo IPR availableTMHMMTMhelixcoord: 406..428
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 176..264
e-value: 2.8E-16
score: 61.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 51..175
e-value: 9.7E-25
score: 89.2
IPR037936Netrin receptor UNC5PANTHERPTHR12582NETRIN RECEPTOR UNC5coord: 42..1039
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 175..261
score: 10.589
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 956..1042
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 176..260