slc24a-2

Overview
Nameslc24a-2 (AKN21563.1)
Smed IDSMED30013820
Length (bp)2821
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc24a-2 (SMED30013820) t-SNE clustered cells

Violin plots show distribution of expression levels for slc24a-2 (SMED30013820) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc24a-2 (SMED30013820) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc24a-2 (SMED30013820) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013820

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30013820SMESG000022802.1 dd_Smed_v4_9904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
collecting ductSMED30013820SMESG000022802.1 Smed-slc24a-2smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc24a-2 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 140.198 bits (352), Expect = 4.816e-35
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  181 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 375          

HSP 2 Score: 74.3294 bits (181), Expect = 3.007e-13
Identity = 47/126 (37.30%), Postives = 72/126 (57.14%), Query Frame = 1
Query:  316 TMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            T+++S N+AGVT LA GNGA D+FS+L A    S+P+      G L GAG+ V ++ AG I I+ PF    RP  +D +FY  A+     +  R ++ L  +L +L LY  Y++  ++   +Y R 
Sbjct:    2 TLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQ 124          
BLAST of slc24a-2 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 137.887 bits (346), Expect = 1.700e-33
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  255 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 449          

HSP 2 Score: 56.6102 bits (135), Expect = 2.005e-7
Identity = 34/101 (33.66%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSA 402
            N S+ C +I     C  + G+++Y +  +C F     P  + L     L   +     A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of slc24a-2 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 137.502 bits (345), Expect = 4.747e-33
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 85.5001 bits (210), Expect = 1.865e-16
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            N S+ C +I     C  + G+++Y +  +C F     P  + L     L   +     A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+      G L GAG+ V ++ AG I I+ PF    RP  +D +FY  A+     +  R ++ L  +L +L LY  Y++  ++   +Y R 
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQ 254          
BLAST of slc24a-2 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 137.502 bits (345), Expect = 4.747e-33
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 85.5001 bits (210), Expect = 1.865e-16
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            N S+ C +I     C  + G+++Y +  +C F     P  + L     L   +     A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+      G L GAG+ V ++ AG I I+ PF    RP  +D +FY  A+     +  R ++ L  +L +L LY  Y++  ++   +Y R 
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQ 254          
BLAST of slc24a-2 vs. Ensembl Human
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 74.7146 bits (182), Expect = 3.369e-14
Identity = 58/174 (33.33%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIEL-WS 615
            N S+ C +I     C  + G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+      G L GAG+ V ++ AG I I+ PF    RP  +D +FY  A+     +  R ++ L W+
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWA 230          
BLAST of slc24a-2 vs. Ensembl Celegans
Match: ncx-6 (Putative sodium/calcium exchanger 6 [Source:UniProtKB/Swiss-Prot;Acc:P34315])

HSP 1 Score: 135.191 bits (339), Expect = 9.377e-33
Identity = 73/200 (36.50%), Postives = 123/200 (61.50%), Query Frame = 1
Query: 1945 LEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G
Sbjct:  330 MDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQG 524          

HSP 2 Score: 87.4261 bits (215), Expect = 1.977e-17
Identity = 53/144 (36.81%), Postives = 88/144 (61.11%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRR-QIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G + GAG+FV ++   + +   PFK      I+D  FY  AL +  F F+    +E+W  + FL +Y IY+   ++S++L+ RH
Sbjct:  114 VSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRH 257          
BLAST of slc24a-2 vs. Ensembl Celegans
Match: ncx-7 (Putative sodium/calcium exchanger 7 [Source:UniProtKB/Swiss-Prot;Acc:P34322])

HSP 1 Score: 134.035 bits (336), Expect = 4.316e-32
Identity = 72/201 (35.82%), Postives = 118/201 (58.71%), Query Frame = 1
Query: 1942 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQG 606          

HSP 2 Score: 85.5001 bits (210), Expect = 9.587e-17
Identity = 52/143 (36.36%), Postives = 88/143 (61.54%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFI-RRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G + G G+FV ++    I++ +PF +     I+D LFY  AL +  F F+   ++ LW  L FL LY +Y++  + ++ ++ R
Sbjct:  105 VSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNR 247          
BLAST of slc24a-2 vs. Ensembl Celegans
Match: ncx-9 (Mitochondrial sodium/calcium exchanger protein [Source:UniProtKB/Swiss-Prot;Acc:O16242])

HSP 1 Score: 122.479 bits (306), Expect = 2.717e-28
Identity = 65/199 (32.66%), Postives = 115/199 (57.79%), Query Frame = 1
Query: 1948 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNT-PFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            +E+ E + F K +++I+   +F   LT+P  + +     WCK L  +HC  S+ F +    +    PF  S  L +Y       +  V + F     +   Y+  ++++G + SI WIY  +NEIV+++++ GVV  +S  +LGL+++A++N  GD+V+++ + K  YP++  +A +GGPLFNLL+G G+PF+I    G
Sbjct:  442 DEFSEMNIFIKIVTVIKVVPVFFFKLTVPSNEMS-----WCKPLFILHCFASIQFALFSIQIITLKPFDGSPGLWLYGLGFSAILAMVAMYFLPLSKEQKYYKEIYSYLGFLMSIAWIYATSNEIVSVVTMIGVVTGLSMELLGLTIMAWSNCIGDIVADIAVVKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIAAAQG 635          

HSP 2 Score: 92.8189 bits (229), Expect = 4.548e-19
Identity = 58/144 (40.28%), Postives = 88/144 (61.11%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIR-RQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            +++ AD F  P +  +   +RMSE++AGVT LA GNGA DVFSS+S+V +T  P   LA G + G  IFV ++   II+    FK+   P ++D +FY + L + +F F++  +IE+W    FL +Y +Y+ VTVI   +Y  H
Sbjct:  118 MSSIADDFFCPAISGIVSHLRMSESIAGVTFLAFGNGAPDVFSSISSVLTTPKPKADLALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMTTLAFIVFCFLKFDKIEVWMPATFLGIYGVYV-VTVIILGIYRTH 260          
BLAST of slc24a-2 vs. Ensembl Celegans
Match: ncx-8 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16241])

HSP 1 Score: 117.857 bits (294), Expect = 6.066e-27
Identity = 66/199 (33.17%), Postives = 116/199 (58.29%), Query Frame = 1
Query: 1948 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            EE+ E + F K + II+    F + +TIP  + +     WCK L  +HC  S+ F +    + N  PF  S  L +Y       I  + + F     +   ++  ++++G + SI WIY  ANEI++++++ GVV  +S  +LGL+V+++++  GD+V+++ + K  YP++  +A +GGPLFNLL+G G+PF+I +  G
Sbjct:  444 EEFSEMNIFVKIIMIIRIIPSFFMKMTIPSNEMS-----WCKPLFLLHCFASIQFALFSIQIINLKPFDGSPGLWLYGLAFSATIALLALCFLPLNKELKYHKEVYSYLGFLMSIAWIYATANEIISVMTMVGVVTGLSQELLGLTVMSWSDCIGDIVADIAVIKQGYPKMAMAAAIGGPLFNLLIGFGLPFTIASAQG 637          

HSP 2 Score: 91.2781 bits (225), Expect = 1.489e-18
Identity = 58/141 (41.13%), Postives = 86/141 (60.99%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIR-RQIELWSSLVFLILYAIYILVTVISRLLY 681
            ++T AD F  P +  +   ++MSE++AGVT LA GNGA DVF S+S+V ST  P   LA G + G  IFV ++   II+    FK+   P ++D +FY   L +  F F++  +IE+W    FL +YA+Y+L TVI+  +Y
Sbjct:  119 MSTIADDFFCPSISGIVTHLKMSESIAGVTFLAFGNGAPDVFGSISSVLSTPKPKAALALGDLFGTSIFVTTVVLAIIIFTKSFKVAIIPTLRDLIFYMITLAFITFCFLKFDKIEVWMPATFLGIYAVYLL-TVIAFSIY 258          
BLAST of slc24a-2 vs. Ensembl Celegans
Match: ncx-10 (Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q965R5])

HSP 1 Score: 111.309 bits (277), Expect = 3.835e-25
Identity = 66/216 (30.56%), Postives = 117/216 (54.17%), Query Frame = 1
Query: 1948 EEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNV-YNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLF-----------------NLLVGIGIPFSIRTFSG 2541
            +E+ E + FS+F++++     F L LTIP  +       W K +  IHC  S+   +    +   +PF  S  L +Y  +I   +  + + FT    +   Y+  ++++G + SI WIY I++EI+N++++ GV   +S  ILGL+++A++N  GD+VS+V + K  +P++  +A +GGPLF                 +LL+G G+PF+I    G
Sbjct:  275 DEFYEMNYFSRFITVVAVIPTFFLKLTIPSNE-----MPWSKPILIIHCFCSIQLALFAVQISAKSPFHGSPGLWLYGLLISIILSLLALRFTPLDREQKYYREVYSYLGFLMSIAWIYTISSEIINVITMIGVATGVSQEILGLTIMAWSNCIGDIVSDVAVVKQGFPKMAMAAAIGGPLFSKLYSRPCQIKITTYISDLLIGFGLPFTIACLQG 485          

HSP 2 Score: 80.4925 bits (197), Expect = 2.614e-15
Identity = 51/139 (36.69%), Postives = 83/139 (59.71%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIR-RQIELWSSLVFLILYAIYILVTVISRL 675
            +   AD F +P +  + + +++SE++AGVT LA GNGA DVF S+++V +T  P   LA G I+G GIFV ++    I++   F++     I+D +F+  A I+    F+    +E+W  L FL LYA Y++  ++ RL
Sbjct:    1 MTVVADDFFSPSIAGIVRHLKISESIAGVTFLAFGNGAPDVFGSIASVITTPKPKADLAIGDIIGGGIFVTTVVLSAIILTKSFRIAILATIRDIVFFIIADIFLAIWFLTFNHVEIWMPLTFLGLYAAYVVSVILMRL 139          
BLAST of slc24a-2 vs. Ensembl Fly
Match: CG14744 (gene:FBgn0033324 transcript:FBtr0307024)

HSP 1 Score: 97.0561 bits (240), Expect = 2.137e-20
Identity = 67/241 (27.80%), Postives = 118/241 (48.96%), Query Frame = 1
Query: 1831 PENENE------NKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL-----PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPF 2520
            PE  +E      N+  L   EN  ++  F      F  ++ PVD E W+     ++   I + P +F+L L IP+VD      GW K+LNC   + +    + L      +VY T   T +F +      L   + +V+   S+ D PP Y   F  +   +S++ ++    E+  +  + G+VFN+S   + ++  A +N+T D+++N  LA   Y R+ ++A +GGP+F +LV + + F
Sbjct:  300 PERRSEHVDYELNRTALHDSENPKNLQLF----TEFFQSLNPVDAEAWQLGGWSNRIYLIARCPLVFVLQLFIPVVDYEKIKHGWSKLLNCTQIVTNPFVVITLVHSGVSSVYKTWHITLDFSISMWSPCLTVPLAIVIFLHSRTDVPPSYHHLFIILTFFSSMVTLWLAVTELEVLSEIVGIVFNLSESFMAVTFEAVSNATPDIIANYQLALQGYGRMAFAAIIGGPVFAILVSMSLAF 536          
BLAST of slc24a-2 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0339335)

HSP 1 Score: 93.2041 bits (230), Expect = 2.561e-19
Identity = 61/227 (26.87%), Postives = 107/227 (47.14%), Query Frame = 1
Query: 1903 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPN----VYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQ 2556
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +    ++    G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV 
Sbjct:  207 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVS 431          

HSP 2 Score: 51.9878 bits (123), Expect = 2.205e-6
Identity = 44/122 (36.07%), Postives = 70/122 (57.38%), Query Frame = 1
Query:  325 MSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFY-FSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            M+E++AGVTLLA GN +AD+FS+L++V    N N    F   L A +FV+ ++ G+I   +PFK+     ++D LF  F +++   F+     +   S +V  ++Y  YILV V+   L  R
Sbjct:    1 MNEHVAGVTLLAFGNSSADLFSNLASV----NAN-VPVFANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVVDVYLIRR 117          
BLAST of slc24a-2 vs. Ensembl Fly
Match: CG12376 (gene:FBgn0033323 transcript:FBtr0088706)

HSP 1 Score: 93.2041 bits (230), Expect = 3.588e-19
Identity = 61/227 (26.87%), Postives = 107/227 (47.14%), Query Frame = 1
Query: 1903 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----LVFWVLLPN----VYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQ 2556
            G +K   + + P++ E+WR+ +   +   + + P + I  + IP+VD      GW K+LNCI  +L+     +    LL +    ++    G      +Y   I   I   +    S+ D PP Y   F  + L  S+  I+  A EI  +L V G +  +    +G +V A   S G L++NV +A + YPR+ Y++ +GGP F +++       ++   G +PV 
Sbjct:  316 GLFKDLFIALRPINCEKWRKGNIIKRAFMLTKIPAVIICCIYIPLVDYELDKHGWNKLLNCIQVMLNPAMSIMAIKALLSSRGNSLWYVAMGEEAIYAMYSLPITVPIAVFMF-IQSRTDVPPFYHSVFTVMNLTGSMFMIFICATEIDKVLEVIGHILKVEDDFMGATVKACTGSLGPLIANVAMALHGYPRMAYASAIGGPFFTVVMSASTVMHVKNLFG-LPVS 540          

HSP 2 Score: 58.151 bits (139), Expect = 3.087e-8
Identity = 45/139 (32.37%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  274 ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFY-FSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
             + + +P L  V++ + M+E++AGVTLLA GN +AD+FS+L++V +         F   L A +FV+ ++ G+I   +PFK+     ++D LF  F +++   F+     +   S +V  ++Y  YILV V+   L  R
Sbjct:   93 CNKYYSPALKAVSRFLCMNEHVAGVTLLAFGNSSADLFSNLASVNAN-----VPVFANSLAAALFVSMVSGGLICYTSPFKMNAYESVRDILFLIFGSMLLQYFLASSAHVPETSFIVMFLVYIFYILVNVVDVYLIRR 226          
BLAST of slc24a-2 vs. Ensembl Fly
Match: CG5348 (gene:FBgn0034156 transcript:FBtr0305318)

HSP 1 Score: 93.2041 bits (230), Expect = 3.636e-19
Identity = 60/230 (26.09%), Postives = 111/230 (48.26%), Query Frame = 1
Query: 1903 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-----------------LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            G ++ F L + P+  + W++    ++ L +I++P + I TL IP+VD      GW K+LN I+ +++                  ++++ L N     +G S+F+L            V + F ++ D PP Y   F  + L  S+  I+  A EI  +L V G + +I    +G +V AF  + G L +N  +A + YP++ +++ +GG  F ++V       +R+  G
Sbjct:  326 GIFRDFFLALRPIKCQAWKQAELLNRVLLLIRAPAVVICTLYIPLVDYEMEKHGWNKLLNAINVVVNPALSISIFLSFMHRKGNFLWYISLQN--TLIYGASSFVL-------TVPFAVFILFHARTDVPPSYHWVFTIMNLTGSMFLIFLCATEIDTVLEVIGNILSIDDNYMGATVKAFTGNLGTLFANTAVAIHGYPKMAFASAIGGSFFTIVVTGNTVAYVRSLVG 546          
BLAST of slc24a-2 vs. Ensembl Fly
Match: CG14743 (gene:FBgn0033326 transcript:FBtr0307023)

HSP 1 Score: 90.1225 bits (222), Expect = 3.659e-18
Identity = 55/209 (26.32%), Postives = 113/209 (54.07%), Query Frame = 1
Query: 1918 FALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWV---LLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIR 2529
            F   I P+D E W      ++ L I+++P   +L L +P+VD      GW K+LNC+  +L+  ++F +   +L + Y   +    F +    +++   + +VV   S+ D PP Y   +  + + T I++ +  A E+  ++S+ GVVF+++   + ++  + + +T DL++   LAK+ Y ++ + A +GG +++L V +GI   ++
Sbjct:  322 FLQAINPIDSEGWYLSGTCARILQILKAPVTLMLHLVVPLVDYQLVKHGWSKMLNCLQIVLTPFVIFALVETMLVHKYAEWYYVPQFRMAIWSLLVTMPLAIVVFLHSRTDIPPFYHSSYCALTISTVIIFFWICAWEMDALISIIGVVFDLAPSYMSITFNSVSAATADLIAYAHLAKHGYGKMAFGAIIGGSVYSLAVNVGIELVLQ 530          
BLAST of slc24a-2 vs. Ensembl Zebrafish
Match: slc8b1 (solute carrier family 8 member B1 [Source:ZFIN;Acc:ZDB-GENE-130530-900])

HSP 1 Score: 98.9821 bits (245), Expect = 2.231e-22
Identity = 64/197 (32.49%), Postives = 100/197 (50.76%), Query Frame = 1
Query:  112 SNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAP---TIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXX-XNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            S  C+Y+     C  + GFI Y    +C F     P   TI ++      L     A+D F  P L  +A T+R++ N+AGVT LALGNGA DVFS+++A    S+P       G L      V ++ AG + ++ PF +  RP ++D +FY +A+ W   +  +  I L  S+ +L +Y  Y+   ++S  +Y R 
Sbjct:   64 SQRCEYVKNTPDCASDEGFIKYPFVTFCLFTPSLLPLAITIYVIWLLFLFLVLGLIASD-FFCPNLSAIASTLRLTHNVAGVTFLALGNGAPDVFSAMAAF---SHPQTAGLAIGALFGAGIFVTTVVAGSVALVKPFTVASRPFLRDVIFYMAAVFWTFTVLYKGHISLGESVGYLGMYIAYVFTVILSSYIYNRQ 256          
BLAST of slc24a-2 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 51.9878 bits (123), Expect = 1.780e-6
Identity = 25/97 (25.77%), Postives = 57/97 (58.76%), Query Frame = 1
Query: 2248 YQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            ++ +F  +  I S +WI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +
Sbjct:  122 WEKYF-MLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMA 217          
BLAST of slc24a-2 vs. Ensembl Zebrafish
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 51.9878 bits (123), Expect = 3.095e-6
Identity = 25/97 (25.77%), Postives = 57/97 (58.76%), Query Frame = 1
Query: 2248 YQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            ++ +F  +  I S +WI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +
Sbjct:  464 WEKYF-MLSFILSTVWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWALQTMA 559          
BLAST of slc24a-2 vs. Ensembl Zebrafish
Match: slc24a6a (solute carrier family 24 member 6a [Source:ZFIN;Acc:ZDB-GENE-100922-39])

HSP 1 Score: 51.6026 bits (122), Expect = 3.908e-6
Identity = 24/98 (24.49%), Postives = 56/98 (57.14%), Query Frame = 1
Query: 2242 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF 2535
            P ++ +F  +  + S LWI   +  +V ++++     +I  V++G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G P+++RT 
Sbjct:  478 PRWERWF-MVTFVASTLWIAVFSYLMVWMVTIISFTLDIPDVVMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNIFDILLGLGFPWALRTL 574          
BLAST of slc24a-2 vs. Ensembl Zebrafish
Match: slc24a3 (solute carrier family 24 member 3 [Source:ZFIN;Acc:ZDB-GENE-090312-67])

HSP 1 Score: 51.6026 bits (122), Expect = 4.347e-6
Identity = 27/107 (25.23%), Postives = 61/107 (57.01%), Query Frame = 1
Query: 2218 FTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            FT      P ++ ++  +  I+S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++L+G+G+P++++T +
Sbjct:  428 FTVPNSANPRWERWY-MVSFISSTIWIAFFSYIMVWMVTVIGYTMGIPDVIMGITFLAAGTSVPDCLASLIVARQGMGDMAISNSIGSNVFDILIGLGLPWALQTLA 533          
BLAST of slc24a-2 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 139.428 bits (350), Expect = 8.641e-34
Identity = 74/204 (36.27%), Postives = 123/204 (60.29%), Query Frame = 1
Query: 1909 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+
Sbjct:  291 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGL 494          

HSP 2 Score: 77.0258 bits (188), Expect = 7.726e-14
Identity = 63/177 (35.59%), Postives = 96/177 (54.24%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            G+INY    +CSF     P  + L     L   I  A  A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +    + +      G  +   ++ AG I I+ PF    RP ++D +FY SA+    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:   69 GYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFV--TTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 243          
BLAST of slc24a-2 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 138.658 bits (348), Expect = 1.519e-33
Identity = 74/204 (36.27%), Postives = 123/204 (60.29%), Query Frame = 1
Query: 1909 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+
Sbjct:  302 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGL 505          

HSP 2 Score: 53.5286 bits (127), Expect = 1.473e-6
Identity = 59/182 (32.42%), Postives = 90/182 (49.45%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVA---KTMRMSENLA----GVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            G+INY    +CSF     P  +           + T    +L   L V A   +T+ M  +L     GVT LA GNGA DVFS+++A + +    + +      G  +   ++ AG I I+ PF    RP ++D +FY SA+    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:   89 GYINYLDGAFCSFLPSLFPLAIF----------LYTLWLLYLFIILAVTAEKNQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFV--TTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 258          
BLAST of slc24a-2 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 137.502 bits (345), Expect = 3.231e-33
Identity = 74/204 (36.27%), Postives = 123/204 (60.29%), Query Frame = 1
Query: 1909 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+
Sbjct:  294 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGL 497          

HSP 2 Score: 63.929 bits (154), Expect = 8.125e-10
Identity = 60/177 (33.90%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            G+INY    +CSF     P  + L     L   I  A  A+ F  P L  ++    ++  L GVT LA GNGA DVFS+++A + +    + +      G  +   ++ AG I I+ PF    RP ++D +FY SA+    FI  +  + L  +LV+L+LY +Y+ V VIS  +Y R
Sbjct:   72 GYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFV--TTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLLYLVYVFVVVISTWIYRR 246          
BLAST of slc24a-2 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 137.117 bits (344), Expect = 4.642e-33
Identity = 74/204 (36.27%), Postives = 123/204 (60.29%), Query Frame = 1
Query: 1909 WKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL-VYXXXXXXXXXXXXXAF-TSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            W+  +  + PVD  +W+++S   +   +I+ P   +L LT+P+VD     + W + LNC+H + + +  V   N  +      N ++ V+  +++       V F T+   +PP Y   F+F+G + S LWI   A EIVN+L  FGV+F +S+ +LGL++LA+ NS GD VS++TLA+  YPR+ +SAC GG +FN+L+G+G+
Sbjct:  278 WQILSSELNPVDSRKWKQKSWKWRTFKLIKVPVEILLLLTVPVVDPDKEEQNWQRPLNCLHLITTPLLCVFTINAGSYGLYIINGVIPVWAVLLIIGTFLAAVVFLTTTNGEPPKYHCLFSFLGFVASALWISAAATEIVNLLRTFGVIFRLSNTVLGLTLLAWGNSIGDFVSDITLARQGYPRMAFSACFGGIIFNVLIGVGL 481          

HSP 2 Score: 55.8398 bits (133), Expect = 2.557e-7
Identity = 48/160 (30.00%), Postives = 74/160 (46.25%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVA---KTMRMSENLA----GVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSL 621
            G+INY    +CSF     P  +           + T    +L   L V A   +T+ M  +L     GVT LA GNGA DVFS+++A + +    + +      G  +   ++ AG I I+ PF    RP ++D +FY SA+    FI  +  + L  +L
Sbjct:   89 GYINYLDGAFCSFLPSLFPLAIF----------LYTLWLLYLFIILAVTAEKNQTISMQCSLTFFLHGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFV--TTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEAL 236          
BLAST of slc24a-2 vs. Ensembl Xenopus
Match: slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:NCBI gene;Acc:549836])

HSP 1 Score: 76.6406 bits (187), Expect = 7.653e-15
Identity = 55/160 (34.38%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLIL 636
            G+INY    +CSF     P  + L     L   I  A  A+ F  P L  +++ +R+S N+AGVT LA GNGA DVFS+++A + +    + +      G  +   ++ AG I I+ PF    RP ++D +FY SA+    FI  +  + L  +LV+L+L
Sbjct:   68 GYINYLDGAFCSFLPSLFPLAIFLYTLWLLYLFIILAVTAEKFFCPNLSAISRILRLSHNVAGVTFLAFGNGAPDVFSAVAAFSDSRTAGLAIGALFGAGVFV--TTVVAGGITIVKPFTAASRPFLRDIVFYISAIFLTFFILYQGFVTLAEALVYLLL 225          
BLAST of slc24a-2 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 136.732 bits (343), Expect = 3.175e-33
Identity = 75/195 (38.46%), Postives = 117/195 (60.00%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS-LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S LV  + L +     +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  255 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGIYEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 449          

HSP 2 Score: 52.373 bits (124), Expect = 2.400e-6
Identity = 33/101 (32.67%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSA 402
            N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVA 160          
BLAST of slc24a-2 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 136.346 bits (342), Expect = 7.160e-33
Identity = 76/196 (38.78%), Postives = 117/196 (59.69%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 78.5666 bits (192), Expect = 1.850e-14
Identity = 71/235 (30.21%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 801
            N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P       G L GAG+ V ++ AG I I+ PF    RP ++D  FY  A+          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQ-------RSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of slc24a-2 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 135.961 bits (341), Expect = 7.208e-33
Identity = 76/196 (38.78%), Postives = 117/196 (59.69%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  294 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 488          

HSP 2 Score: 59.3066 bits (142), Expect = 1.776e-8
Identity = 64/233 (27.47%), Postives = 97/233 (41.63%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 801
            N S+ C ++     C    G+++Y +  +C F     P              I       L   L++     +      GVT LA GNGA D+FS+L A    S+P       G L GAG+ V ++ AG I I+ PF    RP ++D  FY  A+          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPL------------AITLYVFWLLYLFLILGVTAAKFPH---GVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQ-------RSRSLVHSISETPELLSESEEDQMSSNTNS 267          
BLAST of slc24a-2 vs. Ensembl Mouse
Match: Slc8b1 (solute carrier family 8 (sodium/lithium/calcium exchanger), member B1 [Source:MGI Symbol;Acc:MGI:2180781])

HSP 1 Score: 98.2117 bits (243), Expect = 1.013e-20
Identity = 65/194 (33.51%), Postives = 102/194 (52.58%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGI 2508
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS G     +T        +G   C  GP  +LL G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGAGARRIT-------GVGAGQC-PGPQLDLLPGL 495          

HSP 2 Score: 80.4925 bits (197), Expect = 4.685e-15
Identity = 71/235 (30.21%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 801
            N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P       G L GAG+ V ++ AG I I+ PF    RP ++D  FY  A+          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQ-------RSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of slc24a-2 vs. Ensembl Mouse
Match: Slc24a4 (solute carrier family 24 (sodium/potassium/calcium exchanger), member 4 [Source:MGI Symbol;Acc:MGI:2447362])

HSP 1 Score: 56.6102 bits (135), Expect = 1.368e-7
Identity = 29/98 (29.59%), Postives = 57/98 (58.16%), Query Frame = 1
Query: 2242 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF 2535
            P ++ FF  +  IT+ LWI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+GIP+ ++T 
Sbjct:  428 PRWEKFF-MVTFITATLWIAVFSYLMVWLVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGIPWGLQTM 524          
BLAST of slc24a-2 vs. UniProt/SwissProt
Match: sp|Q6J4K2|NCLX_HUMAN (Mitochondrial sodium/calcium exchanger protein OS=Homo sapiens OX=9606 GN=SLC8B1 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 2.279e-32
Identity = 77/196 (39.29%), Postives = 118/196 (60.20%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLS--LVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR +S + K L + + P  F+L LT+P+VD     + W + LNC+H ++S  +V   L    Y   +     + V++ +++       V F +  D +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYMKWRRKSAYWKALKVFKLPVEFLLLLTVPVVDPDKDDQNWKRPLNCLHLVISPLVVVLTLQSGTYGV-YEIGGLVPVWVVVVIAGTALASVTFFATSDSQPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 85.5001 bits (210), Expect = 8.958e-16
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGI--ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            N S+ C +I     C  + G+++Y +  +C F     P  + L     L   +     A  F  P L  ++ T+++S N+AGVT LA GNGA D+FS+L A    S+P+      G L GAG+ V ++ AG I I+ PF    RP  +D +FY  A+     +  R ++ L  +L +L LY  Y++  ++   +Y R 
Sbjct:   60 NVSDRCDFIRTNPDCHSDGGYLDYLEGIFCHFPPSLLPLAVTLYVSWLLYLFLILGVTAAKFFCPNLSAISTTLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPHTAGLALGALFGAGVLVTTVVAGGITILHPFMAASRPFFRDIVFYMVAVFLTFLMLFRGRVTLAWALGYLGLYVFYVVTVILCTWIYQRQ 254          
BLAST of slc24a-2 vs. UniProt/SwissProt
Match: sp|Q6AXS0|NCLX_RAT (Mitochondrial sodium/calcium exchanger protein OS=Rattus norvegicus OX=10116 GN=Slc8b1 PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.808e-32
Identity = 78/196 (39.80%), Postives = 116/196 (59.18%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVD-KPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR QS   K L + + P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  + +PP     FAF+G +TS LWI   A E+VNIL   GVVF +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYRKWRTQSISCKLLKVAKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNSEPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVVFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 79.337 bits (194), Expect = 8.763e-14
Identity = 71/237 (29.96%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  100 SSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 801
            S N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++ ++++S N+AGVT LA GNGA D+FS+L A    S+P       G L GAG+ V ++ AG I I+ PF    RP ++D  FY  A+          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  ++ E Q   N +S
Sbjct:   58 SLNTSDRCDFVKRNPDCHSEGGYLDYLKGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTSLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILRPFMAASRPFLRDITFYMVAVFLTFTALYLGRITLVWALGYLGLYVFYVVTVIICTWVYQRQ-------RSRSLVHSISETPELLTDSEEDQMSSNTNS 284          
BLAST of slc24a-2 vs. UniProt/SwissProt
Match: sp|Q925Q3|NCLX_MOUSE (Mitochondrial sodium/calcium exchanger protein OS=Mus musculus OX=10090 GN=Slc8b1 PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 5.009e-32
Identity = 76/196 (38.78%), Postives = 117/196 (59.69%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDK-PPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            P+D  +WR QS   + L +++ P  F+L LT+P+VD     + W + LNC+  ++S +  VL     VY   +     L V+  +++       V F +  ++ PP     FAF+G +TS LWI   A E+VNIL   GV+F +S+ +LGL++LA+ NS GD  S+ TLA+  YPR+ +SAC GG +FN+LVG+G+
Sbjct:  311 PLDYRKWRTQSISWRVLKVVKLPVEFLLLLTVPVVDPDKDDRNWKRPLNCLQLVISPLVLVLTLQSGVYGI-YEIGGLLPVWAVVVIVGTALASVTFFATSNREPPRLHWLFAFLGFLTSALWINAAATEVVNILRSLGVIFRLSNTVLGLTLLAWGNSIGDAFSDFTLARQGYPRMAFSACFGGIIFNILVGVGL 505          

HSP 2 Score: 78.5666 bits (192), Expect = 1.294e-13
Identity = 71/235 (30.21%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX--XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXX-XXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDS 801
            N S+ C ++     C    G+++Y +  +C F     P  + L     L+L   +   A  F  P L  ++  +++S N+AGVT LA GNGA D+FS+L A    S+P       G L GAG+ V ++ AG I I+ PF    RP ++D  FY  A+          +I L  +L +L LY  Y++  +I   +Y R           +  +    TP+L  E+ E Q   N +S
Sbjct:   60 NTSDRCDFVRRNPDCRSEAGYLDYLEGIFCYFPPNLLPLAITLYVFWLLYLFLILGVTAAKFFCPNLSAISTNLKLSHNVAGVTFLAFGNGAPDIFSALVAF---SDPRTAGLAIGALFGAGVLVTTVVAGGITILHPFMAASRPFLRDIAFYMVAVFLTFTALYLGRITLTWALGYLGLYVFYVVTVIICTWVYQRQ-------RSRSLVHSISETPELLSESEEDQMSSNTNS 284          
BLAST of slc24a-2 vs. UniProt/SwissProt
Match: sp|P34315|NCX6_CAEEL (Putative sodium/calcium exchanger 6 OS=Caenorhabditis elegans OX=6239 GN=ncx-6 PE=3 SV=3)

HSP 1 Score: 135.191 bits (339), Expect = 1.193e-31
Identity = 73/200 (36.50%), Postives = 123/200 (61.50%), Query Frame = 1
Query: 1945 LEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN-TPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            ++EW E + F K ++++ +   F+  LTIP  ++      W K +  + CL+  VF +    V + +PF  S  L +Y  I+   +   V+ FT    +PP Y+   ++ G + SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++AK  YPR+  +A +GG LFNLL+G G+PF+I    G
Sbjct:  330 MDEWDEMNIFQKVIAVLNTIPNFLFKLTIPHSEQP-----WSKPITLLQCLICPVFLLFCIQVCSISPFPNSPGLWMYGLILSVLLTAAVLFFTELHKEPPFYKSLISYAGFLMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVAKQGYPRMAMAAAIGGQLFNLLIGFGLPFTIAKIQG 524          

HSP 2 Score: 87.4261 bits (215), Expect = 2.515e-16
Identity = 53/144 (36.81%), Postives = 88/144 (61.11%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRR-QIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF ++++V S+  P   LA G + GAG+FV ++   + +   PFK      I+D  FY  AL +  F F+    +E+W  + FL +Y IY+   ++S++L+ RH
Sbjct:  114 VSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGAIASVLSSPTPKADLALGELFGAGLFVTTMVLAVTIFTRPFKAEVFSSIRDIAFYLVALAFLAFCFVYYDHVEIWMPITFLGVYLIYVCTVILSQILHNRH 257          
BLAST of slc24a-2 vs. UniProt/SwissProt
Match: sp|P34322|NCX7_CAEEL (Putative sodium/calcium exchanger 7 OS=Caenorhabditis elegans OX=6239 GN=ncx-7 PE=3 SV=3)

HSP 1 Score: 134.035 bits (336), Expect = 5.490e-31
Identity = 72/201 (35.82%), Postives = 118/201 (58.71%), Query Frame = 1
Query: 1942 DLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVY-NTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSG 2541
            + E+W E + FSK ++ I      +  LTIP+ + +     W K L  +H      F +     +  TPF  S  L VY   +   +  +++ FT    +P  Y+  +++ G I SI WIY I++E+VN++++ GVV  +S  +LGL++LA++NS GDL+++V++ K  YPR+  +A +GGPLFNLL+G G+PF+I    G
Sbjct:  411 EAEDWEEMNIFSKVMAYINVVPNLLFKLTIPLNEMS-----WSKPLTLLHAFTCPAFLLFSIQFFLETPFSGSPGLWVYGLAVSIVLAILIMVFTELSVQPKYYKEIYSYSGFIMSIAWIYLISSEVVNVVTMLGVVSRVSHEVLGLTILAWSNSIGDLIADVSVVKQGYPRMAMAAAIGGPLFNLLMGFGLPFTIAKLQG 606          

HSP 2 Score: 85.5001 bits (210), Expect = 1.220e-15
Identity = 52/143 (36.36%), Postives = 88/143 (61.54%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFI-RRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            +++AAD F +P +  +   +R+SE++AGVT +A GNGA DVF S+++V S+  P   LA G + G G+FV ++    I++ +PF +     I+D LFY  AL +  F F+   ++ LW  L FL LY +Y++  + ++ ++ R
Sbjct:  105 VSSAADDFFSPSISSIVAHLRISESVAGVTFMAFGNGAPDVFGSIASVLSSPTPKADLALGELFGGGLFVTTMVVSTIILTSPFDVEVFSTIRDLLFYLVALSFLAFCFVFYNRVTLWMPLTFLGLYLLYVITVIGAQAVHNR 247          
BLAST of slc24a-2 vs. TrEMBL
Match: A0A0H3YKA1 (Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc24a-2 PE=2 SV=1)

HSP 1 Score: 1615.13 bits (4181), Expect = 0.000e+0
Identity = 890/890 (100.00%), Postives = 890/890 (100.00%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLLCLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL 890          
BLAST of slc24a-2 vs. TrEMBL
Match: A0A0H3YFD7 (Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc24a-7 PE=2 SV=1)

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 648/906 (71.52%), Postives = 713/906 (78.70%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVT--ASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNT-RVSF----------GGSLR--NDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYD-YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            M  CTPL FSS NYSN C YIT F  C PN G INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG ILGAG+FVN+ITAGIIMI++PFK+MKRPI+KD LFYF ALIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVR+                              +K N+                     I  NNI IT+T  A+N E+ +    NI      SI DFI I +D +SK N N   N+I IT+  P D + QEN LN     SS+ISDF  I+I RS+T + SF           GSLR  N YSYDNPNY+ +N  D    AST  S+F++NF SIND PN +KE Y DK DHLNVP   YQ K  L+ SQ+SCP++SEC++ KR+   YLN  Q ER YN+    LPS R S   NH K+S SIK+K+ S R+S+ RS+SHRSI S+A+IIID EHEKERME HPT+KK    +S+SLT++NE  LK+ IR+ SM E +K+KSDITNEW I++GN+K+ PENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVT LNLLCLPLMKFQPKRFYGIILI IY+IYFVLVILFAVDIIKVTL
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRN------------------------------EKSNKTI-------------------IQTNNISITITTPATNVENAEIQQQNI--EDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNT----LPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 851          
BLAST of slc24a-2 vs. TrEMBL
Match: A0A0H3YF40 (Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc24a-5 PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.276e-94
Identity = 216/494 (43.72%), Postives = 301/494 (60.93%), Query Frame = 1
Query: 1357 QGKSRLVTSQHSCPHESECNAKKRVYD-----YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKH------HSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENG------DSV---------------VTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            Q + +L T+Q    H+ + +     Y      Y+N  +   S NS  ++L S  S  + N  + S   +R H       S R+    S  +R++GS+A+III+ E+ KE +E     K +   RS+SL +  E P K   R R +S ++++  +I       K N KI        K N+ + EN       DS                V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI Y+AC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I+IY+++ + V+LFA ++IKVTL
Sbjct:  205 QKRGKL-TTQEDTQHKKDESGSNIQYSRENRAYINDVEPCNSLNSLPSSLQSPNS--LTNSNQDS---ERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILE---AKKNMNRKRSLSLDLATEKP-KFNNRKRFISLDQENLKEIKKTE---KENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYAACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKVTL 685          

HSP 2 Score: 245.358 bits (625), Expect = 5.852e-66
Identity = 139/207 (67.15%), Postives = 161/207 (77.78%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            M+ C P N   +   + C Y+    SC  + GFINYFQWQ+C FDNR  PTILM LWFL LL  +A  ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV STS+PNV LA G ILGAGI VN++TAGIIMII PF +M+RPIIKD +FY  AL+WCMFI IRRQIELWSS+VFLI+Y IY+ VT +SR +YV+ 
Sbjct:    1 MESCNPKN--KTFNESFCNYVINRGSCSFDSGFINYFQWQFCGFDNRIIPTILMFLWFLVLLLAVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQ 205          
BLAST of slc24a-2 vs. TrEMBL
Match: A0A267GEZ5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025656g3 PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 7.891e-47
Identity = 110/228 (48.25%), Postives = 153/228 (67.11%), Query Frame = 1
Query: 1864 ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN--TPF-GTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            + GE+ D V     P K F  +++PVDLEE+ E + ++K   II++P +F+L L+ P VD    L GW +ILN +HC ++ VF  L    YN   PF G   F +V + +I+G  +G++V FTS   +PP Y   FAFIG +T+I+WIY  ANE+VNIL   G +F ISS ILGL+VLA+ANS GD+++N  LA+ N+PR+  SAC GGPLFNLL+G+GIPF+I+  S
Sbjct:  597 DAGED-DEVDENQSPIKEFLYSLVPVDLEEFPEMTWYNKVYEIIKAPLLFLLLLSTPFVDYDQPLNGWSRILNSVHCAIAPVFIALAFKGYNWMIPFEGGGGFPIVVIVLIVGIALGILVYFTSSDFEPPKYHAAFAFIGFLTAIVWIYTFANEVVNILESVGSIFRISSTILGLTVLAWANSIGDVIANTVLARQNFPRVAISACFGGPLFNLLLGVGIPFTIKLLS 823          

HSP 2 Score: 154.066 bits (388), Expect = 1.857e-34
Identity = 87/193 (45.08%), Postives = 129/193 (66.84%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX-XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLY 681
            + + +CQ +    SCI N G I Y    YC F +     + ++    + +L G+AT AD F  PCL+V+A TMR+S+N+AGVTLLALGNGA D+FS++S++T+  + + GLAFG +LGAGIFV ++TAG I I+ PF  M RP++KD +FY   + W   +  R+ I L  S+ F++LY +Y+++TV+SR LY
Sbjct:   29 DANTLCQLVNATESCIFNDGHIEYLLGMYCVFKDVVPLGVTLMFLWLIMMLIGLATTADVFFGPCLIVMADTMRLSQNVAGVTLLALGNGAPDIFSAISSITTLKDGDAGLAFGALLGAGIFVTAVTAGAIAIVKPFTAMSRPLMKDIVFYMFTIFWAFIVMFRQTITLVDSIGFIVLYVLYVILTVVSRALY 221          
BLAST of slc24a-2 vs. TrEMBL
Match: A0A267G472 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025656g4 PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 9.203e-47
Identity = 110/228 (48.25%), Postives = 153/228 (67.11%), Query Frame = 1
Query: 1864 ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYN--TPF-GTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            + GE+ D V     P K F  +++PVDLEE+ E + ++K   II++P +F+L L+ P VD    L GW +ILN +HC ++ VF  L    YN   PF G   F +V + +I+G  +G++V FTS   +PP Y   FAFIG +T+I+WIY  ANE+VNIL   G +F ISS ILGL+VLA+ANS GD+++N  LA+ N+PR+  SAC GGPLFNLL+G+GIPF+I+  S
Sbjct:  597 DAGED-DEVDENQSPIKEFLYSLVPVDLEEFPEMTWYNKVYEIIKAPLLFLLLLSTPFVDYDQPLNGWSRILNSVHCAIAPVFIALAFKGYNWMIPFEGGGGFPIVVIVLIVGIALGILVYFTSSDFEPPKYHAAFAFIGFLTAIVWIYTFANEVVNILESVGSIFRISSTILGLTVLAWANSIGDVIANTVLARQNFPRVAISACFGGPLFNLLLGVGIPFTIKLLS 823          

HSP 2 Score: 154.066 bits (388), Expect = 1.840e-34
Identity = 87/193 (45.08%), Postives = 129/193 (66.84%), Query Frame = 1
Query:  106 NYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXX-XXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLY 681
            + + +CQ +    SCI N G I Y    YC F +     + ++    + +L G+AT AD F  PCL+V+A TMR+S+N+AGVTLLALGNGA D+FS++S++T+  + + GLAFG +LGAGIFV ++TAG I I+ PF  M RP++KD +FY   + W   +  R+ I L  S+ F++LY +Y+++TV+SR LY
Sbjct:   29 DANTLCQLVNATESCIFNDGHIEYLLGMYCVFKDVVPLGVTLMFLWLIMMLIGLATTADVFFGPCLIVMADTMRLSQNVAGVTLLALGNGAPDIFSAISSITTLKDGDAGLAFGALLGAGIFVTAVTAGAIAIVKPFTAMSRPLMKDIVFYMFTIFWAFIVMFRQTITLVDSIGFIVLYVLYVILTVVSRALY 221          
BLAST of slc24a-2 vs. Ensembl Cavefish
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:103022341])

HSP 1 Score: 115.161 bits (287), Expect = 4.264e-26
Identity = 76/210 (36.19%), Postives = 121/210 (57.62%), Query Frame = 1
Query: 1912 KHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF 2535
            K F  +I PVD   WR      + L IIQ PF  +L LT+P+VD       W + LNC+H +   +  VL      Y       +F +  L  ++G  +  +V  T+  ++PP Y   F+ +G + S LWI  +A+EIV++L + G+V ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+L G+G+   ++ F
Sbjct:  313 KIFLKSISPVDTRIWRRSHWAWRALKIIQLPFEVVLLLTVPVVDTDKEDHNWKRPLNCLHIITGPLVCVLTFQSGHYGLYLIQGDFPVWLLTALIGVFLSGIVFCTTNNERPPPYHFLFSLLGFVVSALWISTVASEIVSVLHLLGIVLSLSNTVLGLTLLAWGNSIGDCFSDITIARQGYPRMAISACFGGIIFNMLFGVGLGCLLQMF 522          

HSP 2 Score: 93.2041 bits (230), Expect = 3.818e-19
Identity = 58/191 (30.37%), Postives = 99/191 (51.83%), Query Frame = 1
Query:  121 CQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATA--ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR 687
            C+++     C    GFINY +  +C       P  + L     L+  +     A  F  P L  ++ T+R++ N+AGVT LALGNGA DVFS+++A +      + +      G  +   ++ AG + ++ PF +  RP ++D +FY +A+ W   I  +  I+L  +L +L LY +Y++  V+S  +Y R
Sbjct:   74 CEFVLNTPDCAAEGGFINYPKITFCLLAPNLLPLAIFLYIVWLLVMFLVLGLIASQFFCPNLSAISSTLRLTHNVAGVTFLALGNGAPDVFSAMAAFSRPQTAGLAIGALFGAGIFV--TTVVAGSVTLVKPFTVASRPFLRDIIFYMAAVFWTFTILYKGWIDLKEALGYLGLYVLYVITVVVSTYIYRR 262          
BLAST of slc24a-2 vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 56.225 bits (134), Expect = 1.309e-7
Identity = 31/107 (28.97%), Postives = 61/107 (57.01%), Query Frame = 1
Query: 2218 FTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            FT      P ++ +F F   I+S LWI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +
Sbjct:  454 FTVPNCNSPRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLA 559          
BLAST of slc24a-2 vs. Ensembl Cavefish
Match: slc24a3 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:103023188])

HSP 1 Score: 55.8398 bits (133), Expect = 2.009e-7
Identity = 31/107 (28.97%), Postives = 61/107 (57.01%), Query Frame = 1
Query: 2218 FTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            FT      P ++ +F F   I+S LWI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +
Sbjct:  416 FTVPNCNSPRWERWFMFT-FISSTLWIAGFSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNSIGSNVFDILVGLGLPWALQTLA 521          
BLAST of slc24a-2 vs. Ensembl Cavefish
Match: slc24a4a (solute carrier family 24 member 4a [Source:ZFIN;Acc:ZDB-GENE-050417-291])

HSP 1 Score: 53.1434 bits (126), Expect = 1.104e-6
Identity = 30/107 (28.04%), Postives = 58/107 (54.21%), Query Frame = 1
Query: 2218 FTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            FT      P ++ FF  +    S LWI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P+ I+T +
Sbjct:  331 FTVPNCAKPRWERFF-MLSFFLSTLWIAVFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGIQTMA 436          
BLAST of slc24a-2 vs. Ensembl Cavefish
Match: slc24a4b (sodium/potassium/calcium exchanger 4 [Source:NCBI gene;Acc:103043044])

HSP 1 Score: 52.373 bits (124), Expect = 2.501e-6
Identity = 25/99 (25.25%), Postives = 58/99 (58.59%), Query Frame = 1
Query: 2242 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS 2538
            P ++ +F  +  + S +WI   +  +V ++++ G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +
Sbjct:  479 PRWEKYF-MLSFLLSTVWIAIFSYFMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGLPWALQTMA 576          
BLAST of slc24a-2 vs. Ensembl Sea Lamprey
Match: SLC8B1 (solute carrier family 8 member B1 [Source:HGNC Symbol;Acc:HGNC:26175])

HSP 1 Score: 125.176 bits (313), Expect = 2.802e-31
Identity = 77/207 (37.20%), Postives = 125/207 (60.39%), Query Frame = 1
Query: 1903 GPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCL---LSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            G    F L++ P+D  EWR +    + L ++  P   +L LT+P+++     + W + LNC+  +   L+ ++ +     +  P G +  L ++  I+    +  VVAF +  ++PP +Q  FA +G + S LW+  IANE+VN+L  FGVVF ISS +LGL++LA+ NS  D V+++T+A+  YPR+  SAC GG +FN+LVGIG+
Sbjct:   82 GKLYRFLLSLSPLDPAEWRRRGYIWRLLKVVVLPVELLLILTVPVMNVMHEDRKWNRPLNCLQLMTGPLAALYSLNGGLYFMLPVGGT--LPLWSLILAIGCLLAVVAFITTSEQPPAFQLAFAVLGFVVSALWMNAIANEVVNLLQTFGVVFGISSTVLGLTLLAWGNSVPDFVADITMARQGYPRMAISACFGGIVFNILVGIGL 286          
BLAST of slc24a-2 vs. Ensembl Sea Lamprey
Match: slc24a4b (solute carrier family 24 member 4b [Source:ZFIN;Acc:ZDB-GENE-081031-75])

HSP 1 Score: 50.447 bits (119), Expect = 1.609e-6
Identity = 24/86 (27.91%), Postives = 51/86 (59.30%), Query Frame = 1
Query: 2278 ITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF 2535
            + S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T 
Sbjct:  384 VISTIWIAVFSYVMVWMVTVIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALQTL 469          
BLAST of slc24a-2 vs. Ensembl Sea Lamprey
Match: slc24a1 (solute carrier family 24 member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-191])

HSP 1 Score: 49.2914 bits (116), Expect = 3.661e-6
Identity = 39/135 (28.89%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAV-TSTSNPNXXXXXXXXXXXXXXXNSITAGI---IMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYIL 654
            +A   D F  P L V+ + + +S+++AG T +A G  A ++F+SL  V  S SN  +G   G  +   +FV  + A     I+++T +     P+ +D  FY   L   +  F+   I+ W S++ L  Y  Y++
Sbjct:   48 LAIVCDEFFVPALGVITEKLAISDDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSAVFNILFVIGMCAVFSREILVLTWW-----PLFRDVSFYIVGLSMLIIFFLDNLIQWWESMLLLSCYVSYVV 177          
BLAST of slc24a-2 vs. Ensembl Yeast
Match: YDL206W_mRNA (Putative protein of unknown function; YDL206W is not an essential protein [Source:SGD;Acc:S000002365])

HSP 1 Score: 56.225 bits (134), Expect = 1.769e-8
Identity = 28/55 (50.91%), Postives = 33/55 (60.00%), Query Frame = 1
Query: 2347 VFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIG 2511
            VFNIS  ILGL++  + NS GDLVSN+T  K     I   AC G PL   L G+G
Sbjct:  620 VFNISETILGLTIFTWGNSIGDLVSNITFVKIGVLEIAIGACFGSPLLYFLFGVG 674          
BLAST of slc24a-2 vs. Ensembl Yeast
Match: ECM27 (Protein involved in calcium homeostasis and exit from quiescence; required for proper trehalose levels during quiescence; may play a role in cell wall biosynthesis, mutants are hypersensitive to antifungal, Papulacandin B; null mutants have increased plasmid loss; interacts with Pdr5p [Source:SGD;Acc:S000003867])

HSP 1 Score: 52.373 bits (124), Expect = 2.801e-7
Identity = 27/103 (26.21%), Postives = 52/103 (50.49%), Query Frame = 1
Query: 2305 IANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAK---------------NNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGT 2568
            +AN ++ ++ ++  +  +S  ILGL++ A+ NS GDL+SN+++ +                 +  I  ++C+GG + N + GIG       FSG + +   G 
Sbjct:  545 LANSLIEMMEIYQKILGLSKAILGLTIFAWGNSVGDLISNISMCRLYKTQTHYQDRVRLATKFFMISCASCLGGVMLNSMGGIG-------FSGLVSMLFIGA 640          
BLAST of slc24a-2 vs. Ensembl Nematostella
Match: EDO31950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWG6])

HSP 1 Score: 113.62 bits (283), Expect = 1.157e-26
Identity = 71/225 (31.56%), Postives = 116/225 (51.56%), Query Frame = 1
Query: 1855 FNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVL--------LPNVYNTPFGTSNFLLVYXX-XXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLV 2502
            F+L T    +     P P +     +LP    ++     F+K   I+++P   +L +TIP++D     + W K LN +H +   +F VL        L  +Y  P    +++++Y               F S++ K    Q  F ++  I S++WIY  ANEIVNIL  FG+V  +S+ ILGL+ LA+ NS GDLV++ T+A+  +P +   AC GGP+ ++L+
Sbjct:  212 FSLNTHRACNRSANLP-PMQKLVRGVLPFTSADFELSGIFNKVFLILKAPAAVVLNVTIPVIDYDEPYQNWNKWLNVLHLITGPMFCVLATRAAKVSLGRLYKPP--RCHWVVLYKPPRCHWVGFTSRQGFCSQIHKNCFLQ-MFGYLAFIVSVVWIYVTANEIVNILQSFGIVLGLSNAILGLTFLAWGNSIGDLVADTTMARQGFPNMATGACFGGPMLSILL 432          

HSP 2 Score: 86.2705 bits (212), Expect = 1.124e-17
Identity = 62/196 (31.63%), Postives = 98/196 (50.00%), Query Frame = 1
Query:  121 CQYITFFSSCIPNLGFINYFQWQYCSFDNRWA-PTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTS-NPNXXXXXXXXXXXXXXXNSITAGII----------MIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISR 672
            C ++   S C  + GFI Y  + YC          +++ +  LFL   +   AD +  P L V++KT+R+S+N+AGVT LA GNGA D+FS+++AV++ S NPN                 + AGI           +    F L  RP  +D LFY  A+ W      R++I +  ++ F+I Y  Y++V ++ R
Sbjct:    1 CAFVQANSDCDLSDGFIQYIHFIYCKLPKAIPLALVILFVLMLFLFIVLGITADDYFCPSLTVISKTLRLSQNVAGVTFLAYGNGAPDIFSAIAAVSAHSKNPNAA--------------QLGAGIFVTTVVVGSVTLCTGGFHLNNRPFTRDVLFYLGAVSWMFITMYRQRITMLEAIGFIIFYFAYVVVVIVGR 182          
BLAST of slc24a-2 vs. Ensembl Nematostella
Match: EDO35212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM57])

HSP 1 Score: 53.5286 bits (127), Expect = 2.768e-7
Identity = 37/132 (28.03%), Postives = 73/132 (55.30%), Query Frame = 1
Query:  262 IATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILV 657
            +A   D F  P L  +++ + +SE++AG T +A G+ A ++F+S++ VT  S+  VG   G  +   + + ++TA     +   +L  RP+++D + Y  ++ + +      + E++ + V LILY  YI+V
Sbjct:   17 LAIVCDDFFVPSLEAISEKLDLSEDVAGATFMAAGSSAPELFTSIAGVTVDSDVGVGTIVGSAIFNLLVIIALTAAFSGQV--LQLDWRPLLRDSVAYSLSIAFFIIFSWDGKFEMYEAAVLLILYIAYIVV 146          

HSP 2 Score: 52.373 bits (124), Expect = 7.253e-7
Identity = 23/82 (28.05%), Postives = 49/82 (59.76%), Query Frame = 1
Query: 2284 SILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIR 2529
            SI+WI  ++  +V ++   G + N+    +GL ++A   S  D +S++ +A++ +  +  S  +G  +F++ +G+G+PF IR
Sbjct:  364 SIVWIAILSFGLVTVVGRSGCILNVDKFTMGLVIIAIGTSVPDALSSIIVARDGFGDMAVSNAIGSNVFDINLGLGLPFVIR 445          
BLAST of slc24a-2 vs. Ensembl Nematostella
Match: EDO41421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4I7])

HSP 1 Score: 52.373 bits (124), Expect = 7.575e-7
Identity = 39/135 (28.89%), Postives = 69/135 (51.11%), Query Frame = 1
Query:  259 GIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITP--FKLMKRPIIKDFLFYFSALIWCMFIFIRRQ-IELWSSLVFLILYAIYIL 654
             +A A D F  P L V+ + + + E++AG T +A G  A ++F+S   + +  +P   +  G I+G+ +F      G+  + +    +L   P+ +D +FY  ALI  +  F+    I  W SLV L+ Y  Y++
Sbjct:  121 ALAIACDEFFVPSLTVIIEKLELKEDVAGATFMAAGGSAPELFTSF--IGTFIDPKSNVGIGTIVGSAVFNVLFVIGMCAMFSKGVLELTWWPLFRDCIFYSLALIILIIFFLSGDVIVWWESLVLLLCYFAYVI 253          
BLAST of slc24a-2 vs. Ensembl Nematostella
Match: EDO32048 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW69])

HSP 1 Score: 50.8322 bits (120), Expect = 2.076e-6
Identity = 28/88 (31.82%), Postives = 53/88 (60.23%), Query Frame = 1
Query: 2269 IGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRT 2532
            +  I  I+WI   +  +V +++V G  F I   ++GLS++AF +S  D +S++ +A+     +  S  VG  +F++L+ +GIP+ I+T
Sbjct:  323 LSFIICIVWIGVTSYVLVWMVTVIGYTFLIPDSVMGLSLVAFGSSVPDCLSSLFVARKGDGDMAVSHTVGSNVFDILLCLGIPWLIKT 410          
BLAST of slc24a-2 vs. Ensembl Nematostella
Match: EDO48006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKL3])

HSP 1 Score: 49.2914 bits (116), Expect = 7.162e-6
Identity = 25/83 (30.12%), Postives = 53/83 (63.86%), Query Frame = 1
Query: 2284 SILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRT 2532
            SI+W+  ++  +V  +S+ G  F+I   I+GL++LA  +S  D++S++ +AK+    +  + C+G  +F++L  +G+P+ + T
Sbjct:  456 SIIWMAALSYVLVWTVSIIGETFSIPEYIMGLTLLAAGSSVPDVMSSLIVAKHGMGDMALANCIGSNIFDVLC-LGLPWLLAT 537          
BLAST of slc24a-2 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 108.227 bits (269), Expect = 5.369e-24
Identity = 72/195 (36.92%), Postives = 118/195 (60.51%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+
Sbjct:  261 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGL 455          

HSP 2 Score: 88.9669 bits (219), Expect = 6.643e-18
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAP-TIXXXXXXXXXXTGI-ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXX-XNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            GFINY    +C       P TI +   +LF L  I    A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+      G L      V ++ AG + +  PF +  RP ++D +FY  A+ W   +  R    L  +L +L LY +Y+L  +IS  +Y R 
Sbjct:   23 GFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQ 198          
BLAST of slc24a-2 vs. Ensembl Medaka
Match: slc8b1 (solute carrier family 8 member B1 [Source:NCBI gene;Acc:101159512])

HSP 1 Score: 107.457 bits (267), Expect = 6.331e-24
Identity = 72/195 (36.92%), Postives = 118/195 (60.51%), Query Frame = 1
Query: 1936 PVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLL--PNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGI 2514
            PVD  +WR +S   + L ++++P   +L L +P+VD     K W + LNC+H +++ V  VL      Y        F L  L ++LGF +  +V  T+  D PP Y   FA +G + S + I   A+E+V++L + GVV ++S+ +LGL++LA+ NS GD  S++T+A+  YPR+  SAC GG +FN+++G+G+
Sbjct:  231 PVDSRKWRRKSWRWRVLKVLKTPLEVLLLLCVPVVDPDKEDKNWRRPLNCLHLVIAPVVCVLAFQSGKYGNYMIQEQFPLWVLILLLGFFLAAIVFCTTTNDHPPKYHAVFALLGFVVSAVLISAAASEVVSLLHMLGVVLSLSNTVLGLTLLAWGNSIGDCFSDITIAQQGYPRMAISACFGGIIFNMVIGVGL 425          

HSP 2 Score: 88.1965 bits (217), Expect = 9.159e-18
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 1
Query:  163 GFINYFQWQYCSFDNRWAP-TIXXXXXXXXXXTGI-ATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXX-XNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
            GFINY    +C       P TI +   +LF L  I    A  F  P L  ++ ++ ++ N+AGVT LALGNGA D+FS+++A    S+P+      G L      V ++ AG + +  PF +  RP ++D +FY  A+ W   +  R    L  +L +L LY +Y+L  +IS  +Y R 
Sbjct:   23 GFINYLNVVFCLLPPNLTPFTITLCCMWLFFLFMILGLTASKFFCPNLSAISSSLHLTHNVAGVTFLALGNGAPDIFSAMAAF---SHPHTAGLAVGALFGAGVFVTTVVAGSVSLFKPFAVASRPFLRDVIFYMVAVFWTFLMLYRGTTTLGETLGYLSLYVLYVLTVIISTYIYKRQ 198          
BLAST of slc24a-2 vs. Ensembl Medaka
Match: ENSORLT00000000373.2 (sodium/potassium/calcium exchanger 3 [Source:NCBI gene;Acc:101174615])

HSP 1 Score: 55.0694 bits (131), Expect = 2.986e-7
Identity = 31/117 (26.50%), Postives = 66/117 (56.41%), Query Frame = 1
Query: 2242 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTI 2592
            P ++  F  +  ++S LWI  ++  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++++T +      +   S  LIF++
Sbjct:  396 PRWEKCF-MLSFVSSTLWIAGLSYIMVWMVTVIGFTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILVGLGLPWALKTLAINYGSDIKLNSKGLIFSV 511          
BLAST of slc24a-2 vs. Ensembl Medaka
Match: slc24a4b (solute carrier family 24 member 4 [Source:NCBI gene;Acc:101164447])

HSP 1 Score: 54.6842 bits (130), Expect = 4.375e-7
Identity = 31/118 (26.27%), Postives = 66/118 (55.93%), Query Frame = 1
Query: 2242 PIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIM 2595
            P ++ FF  +  I S +WI   +  +V +++V G    I  VI+G++ LA   S  D ++++ +A+     +  S  +G  +F++LVG+G+P++I+T       ++   S  L+++++
Sbjct:  436 PRWERFF-MLSFILSTVWIAIFSYVMVWMVTVAGYTLGIPDVIMGITFLAAGTSVPDCIASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWAIQTICVSYGSEVAINSRGLVYSVV 552          
BLAST of slc24a-2 vs. Ensembl Medaka
Match: ENSORLT00000003048.2 (solute carrier family 24 member 3 [Source:NCBI gene;Acc:101170984])

HSP 1 Score: 51.9878 bits (123), Expect = 3.102e-6
Identity = 24/90 (26.67%), Postives = 53/90 (58.89%), Query Frame = 1
Query: 2266 FIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTF 2535
             +   T+ +WI  ++  +V +++V G    +  VI+G++ LA   S  D +++V +A+     +  S  +G  +F++LVG+G+P++++T 
Sbjct:  497 MVSFFTATIWIAGLSYIMVWMVTVIGFTLGLPDVIMGITFLAAGTSVPDCMASVIVARQGMGDMAISNSIGSNVFDILVGLGLPWALQTL 586          
BLAST of slc24a-2 vs. Planmine SMEST
Match: SMESG000022802.1 (SMESG000022802.1)

HSP 1 Score: 1517.29 bits (3927), Expect = 0.000e+0
Identity = 850/940 (90.43%), Postives = 864/940 (91.91%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFI--------------------------------------------------PIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            MDLCTPLNFSSSNYSNICQYITFFSSCIPN GFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAAD FLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRP+IKDFLFYFS LIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVR+IKSK TTI+TNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKAN+NITVNNIEITVTA NDEDDQKNDL+IAMRKSSSISDFI                                                  PIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQEN LNELKS SSSISDFNCIN+ERSNT VS GGSLRNDYSYDNPNYVH+NHKDHFSRASTTLSSFKSNFSSIN+ P FIKEC+EDKLDHLNVPQ NYQGKSRLVT+QHSCPHESECNAKKRVYDY NSYQFERSYNS E+ L SLRSSII  HQKHSYSIKRKHHSARN MTRSSSHRSIGSLAQIIIDKEHEKER+EKHP SKKI HFRSISLTIINESP KTKIRF SMSENEKSKSDITNEWGIIKGNHKIPPENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVT LNLLCLPLMKFQPKRFYGIILI IY+IYFVLVILFAVDIIKVTL
Sbjct:    1 MDLCTPLNFSSSNYSNICQYITFFSSCIPNSGFINYFQWQYCSFDNRWAPTILMLLWFLFLLTGIATAADGFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSASNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKLMKRPVIKDFLFYFSGLIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRNIKSKTTTIETNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANKNITVNNIEITVTAPNDEDDQKNDLDIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPSKDDIYQENDLNELKSDSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENDLNELKSDSSSISDFNCINVERSNTGVSLGGSLRNDYSYDNPNYVHDNHKDHFSRASTTLSSFKSNFSSINENPKFIKECFEDKLDHLNVPQINYQGKSRLVTTQHSCPHESECNAKKRVYDYSNSYQFERSYNSIESTLSSLRSSII--HQKHSYSIKRKHHSARNFMTRSSSHRSIGSLAQIIIDKEHEKERIEKHPISKKINHFRSISLTIINESPPKTKIRFWSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTALNLLCLPLMKFQPKRFYGIILITIYVIYFVLVILFAVDIIKVTL 938          
BLAST of slc24a-2 vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 789.645 bits (2038), Expect = 0.000e+0
Identity = 448/703 (63.73%), Postives = 512/703 (72.83%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVT--ASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNT-RVSF----------GGSLR--NDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYD-YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 2130
            M  CTPL FSS NYSN C YIT F  C PN G INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG ILGAG+FVN+ITAGIIMI++PFK+MKRPI+KD LFYF ALIWCM IFI++QIELWSSLVFL +Y IYILVTVISRLLYVR+                              +K N+                     I  NNI IT+T  A+N E+ +    NI      SI DFI I +D +SK N N   N+I IT+  P D + QEN LN     SS+ISDF  I+I RS+T + SF           GSLR  N YSYDNPNY+ +N  D    AST  S+F++NF SIND PN +KE Y DK DHLNVP   YQ K  L+ SQ+SCP++SEC++ KR+   YLN  Q ER YN+    LPS R S   NH K+S SIK+K+ S R+S+ RS+SHRSI S+A+IIID EHEKERME HPT+KK    +S+SLT++NE  LK+ IR+ SM E +K+KSDITNEW I++GN+K+ PENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLVFLAIYVIYILVTVISRLLYVRN------------------------------EKSNKTI-------------------IQTNNISITITTPATNVENAEIQQQNI--EDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNT----LPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 648          
BLAST of slc24a-2 vs. Planmine SMEST
Match: SMESG000022803.1 (SMESG000022803.1)

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 445/703 (63.30%), Postives = 509/703 (72.40%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQKDNRDSSTSNSVLIFKDNRSKANQNITVNNIEITVT--ASNDEDDQKNDLNIAMRKSSSISDFIPIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFNCINIERSNT-RVSF----------GGSLR--NDYSYDNPNYVHENHKDHFSRASTTLSSFKSNFSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNAKKRVYD-YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 2130
            M  CTPL FSS NYSN C YIT F  C PN G INY+QWQYC+F NRWAP ILM LWFLFLLTGI T+ADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTS SNPNVGLAFG ILGAG+FVN+ITAGIIMI++PFK+MKRPI+KD LFYF ALIWCM IFI++QIELWSSL    +Y IYILVTVISRLLYVR+                              +K N+                     I  NNI IT+T  A+N E+ +    NI      SI DFI I +D +SK N N   N+I IT+  P D + QEN LN     SS+ISDF  I+I RS+T + SF           GSLR  N YSYDNPNY+ +N  D    AST  S+F++NF SIND PN +KE Y DK DHLNVP   YQ K  L+ SQ+SCP++SEC++ KR+   YLN  Q ER YN+    LPS R S   NH K+S SIK+K+ S R+S+ RS+SHRSI S+A+IIID EHEKERME HPT+KK    +S+SLT++NE  LK+ IR+ SM E +K+KSDITNEW I++GN+K+ PENENENKFN+ETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN
Sbjct:    1 MAACTPLKFSSFNYSNACDYITNFKGCSPNSGLINYYQWQYCAFGNRWAPGILMFLWFLFLLTGITTSADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSNSNPNVGLAFGAILGAGVFVNAITAGIIMILSPFKIMKRPILKDLLFYFVALIWCMIIFIKKQIELWSSLA---IYVIYILVTVISRLLYVRN------------------------------EKSNKTI-------------------IQTNNISITITTPATNVENAEIQQQNI--EDPLSILDFISINRDERSKGNRNLAANSIGITIAVPNDKVDQENDLNRPMKKSSTISDFRSIHIGRSDTNQTSFPRFSHLKSHIAGSLRTNNVYSYDNPNYISDNSIDRVYIASTNRSNFENNFHSINDNPNSLKELYADKSDHLNVPGNIYQKKPNLIKSQNSCPNDSECHSHKRILSGYLNPLQLERFYNT----LPSERPSTEVNHLKYSCSIKQKNLSPRSSIERSASHRSIRSMAKIIIDNEHEKERMENHPTAKKANLIKSLSLTVLNEYALKSNIRYWSMREIQKAKSDITNEWDILEGNYKVHPENENENKFNIETGENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPN 645          
BLAST of slc24a-2 vs. Planmine SMEST
Match: SMESG000022808.1 (SMESG000022808.1)

HSP 1 Score: 357.451 bits (916), Expect = 1.312e-110
Identity = 237/519 (45.66%), Postives = 325/519 (62.62%), Query Frame = 1
Query: 1300 IKECY--EDKLDHLNVPQTN---YQGKSRLVTSQ----HSCPHESECNAK-------KRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQK-HSYSIKRKHHSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHF--RSISLTIINESPL-KTKIRFRSMSEN------------------EKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENGDS-VVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            +K+C   E  ++++ V  TN   +    RL +S+     +C H+   N +       +   ++L   Q+ +   +  N   S  +S++      H  S K  + S   +  RS+SHRS+GS A+III  EHE+E M+K+   K       RS+SL+ +N+  + K KIRF S   N                  +KS SD+ N+              E+     L++  N DS  +TFPG +KHF LTILPVDL++W   S F K L+I+QSP MFILTLTI +V+E  +LKGWCKILNC+HC+LS + W+   +V   P GT  F++ YL +I+G + G+ VA TSK + PPIYQPFFAF+G ITSI WIYEI NEIVN+L   GVVF+I   ILGLS+LAFANS GDLVSN+TLAK NYPRI Y+AC+GGPLFNLLVGIG+PFSI+T   PI + L   ++VL+FTI LVTT+NL+ LP++KF+  + YGIIL+ IYI++F+L+I FA ++I VT+
Sbjct:  207 LKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGEFLKVPQYNQLNRNLNNPTRSAEASVVDIRTSFHRCSRKPIYSSLNLTRVRSTSHRSMGSFAKIIIKNEHEREIMKKNSKVKVSKKCLKRSVSLSALNDCSVPKLKIRFYSADTNMAARRIEEFKNIAVEKLKKKSISDVQNQ------------RTESNLSRILQSNRNDDSSFLTFPGTFKHFLLTILPVDLDDWPRLSVFKKILAIVQSPIMFILTLTISVVEEDVFLKGWCKILNCLHCVLSPLIWITFIHVNMNPIGTDGFIVTYLILIIGLLAGISVAITSKSNSPPIYQPFFAFMGFITSIFWIYEIVNEIVNVLGTLGVVFSIPQTILGLSILAFANSVGDLVSNITLAKRNYPRIAYAACIGGPLFNLLVGIGLPFSIKTAQKPILINLKSDTVVLVFTISLVTTMNLIVLPILKFRVNKIYGIILLTIYIVFFILIISFATNLINVTI 713          

HSP 2 Score: 251.521 bits (641), Expect = 1.415e-71
Identity = 153/292 (52.40%), Postives = 199/292 (68.15%), Query Frame = 1
Query:   70 MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAPTIXXXXXXXXXXTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRHXXXXXXXXXXXXXXXXXRTPDLNVENAEIQQK--DNRDSSTSNSVLIFKDNR-----SKANQNIT---VNNIEITVTASNDEDDQ 915
            M+ C P N + +NYSN CQY+   S+C+ + GF+NYF+WQYC FD+R  PTILM+LWFL LL  +AT ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSA+ S++NPNVGLA G ILGAGI VN+ITAGIIMII PF++M+RPIIKD +FY  AL+WC  I +RR+IE WSS+VFL +Y +Y+ VT ISR LY                        L ++  + Q++  +N + S +N+V+   D R      KAN+N +   +NN +I  +  N+   +
Sbjct:    1 MESCNPKNITGTNYSNECQYVKNVSACLFDSGFLNYFEWQYCGFDSRIVPTILMILWFLVLLLSVATTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAILSSNNPNVGLALGSILGAGILVNTITAGIIMIICPFEIMRRPIIKDIIFYLIALLWCTIILLRRKIEFWSSIVFLSIYIVYVFVTAISRALY------------------------LKLKKCQKQERPIENIEVSVTNTVIFNNDRRLDSSKCKANKNCSHDPLNNGQINASYLNENAGE 268          
BLAST of slc24a-2 vs. Planmine SMEST
Match: SMESG000022809.1 (SMESG000022809.1)

HSP 1 Score: 322.013 bits (824), Expect = 4.107e-98
Identity = 210/462 (45.45%), Postives = 289/462 (62.55%), Query Frame = 1
Query: 1438 YLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKH------HSARNSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIINESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLETGENG------DSV---------------VTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFILTLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLLVYXXXXXXXXXXXXXAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEIVNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSACVGGPLFNLLVGIGIPFSIRTFS-GPIPVQLTGTSIVLIFTIMXXXXXXXXXXXXMKFQPKRFYGXXXXXXXXXXXXXXXXXAVDIIKVTL 2739
            Y+N  +   S NS  ++L S  S  + N  + S   +R H       S R+    S  +R++GS+A+III+ E+ KE +E     K +   RS+SL +  E P K   R R +S ++++  +I       K N KI        K N+ + EN       DS                V FPG +KHF + I+P++ EEW+EQS FSK LS+IQSP MFILTLTIP+V+E  YLKGWCK+LNC+HC+LS + W+        P G+  F+L++L +I+G    +  A TSK + PP Y   FAF+G +TSI WIY IANEIVNIL  FGVV +I   ILGL++LAFANS GDLVSN+ LA+  +PRI YSAC+GGPLFNLLVGIG+PFSI     G I V+L   +IVLI TI+L+T +NL+ LP+M+F+ +  YGII+I+IY+++ + V+LFA ++IK+TL
Sbjct:  185 YINDVEPCNSLNSLPSSLQSPNS--LTNSNQDS---ERNHLSLIPMQSFRSKRIPSIRNRTMGSIAKIIIENEYHKEILE---AKKFMNRKRSLSLDLATEKP-KFNNRKRFISLDQENLKEIKKTE---KENRKIKEFQSPAPKINIISEENQIEKSSVDSTLHTSSESDIDVETKDVQFPGLFKHFLMKIIPINFEEWKEQSLFSKVLSVIQSPIMFILTLTIPVVEEEEYLKGWCKLLNCLHCILSPLIWITFIKFSAVPLGSQGFILIHLVLIIGVCAAISAAITSKANAPPEYYSLFAFVGFLTSIFWIYAIANEIVNILETFGVVLSIPQTILGLTILAFANSIGDLVSNIMLARKKFPRIAYSACIGGPLFNLLVGIGLPFSIANARYGKIKVELKSETIVLISTILLITIMNLIYLPVMRFRLRPVYGIIMIVIYVLFLLFVLLFATNVIKITL 634          

HSP 2 Score: 200.29 bits (508), Expect = 3.165e-54
Identity = 106/144 (73.61%), Postives = 122/144 (84.72%), Query Frame = 1
Query:  259 GIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGNGAADVFSSLSAVTSTSNPNXXXXXXXXXXXXXXXNSITAGIIMIITPFKLMKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVISRLLYVRH 690
             +A  ADSF APCLVVV K +RMS+NLAGVTLLALGNGAADVFSSLSAV STS+PNV LA G ILGAGI VN++TAGIIMII PF +M+RPIIKD +FY  AL+WCMFI IRRQIELWSS+VFLI+Y IY+ VT +SR +YV+ 
Sbjct:   11 AVAVTADSFFAPCLVVVTKILRMSQNLAGVTLLALGNGAADVFSSLSAVISTSSPNVSLALGSILGAGILVNTVTAGIIMIIVPFDVMRRPIIKDLIFYLLALLWCMFILIRRQIELWSSVVFLIIYVIYVTVTGVSRAIYVKQ 154          
The following BLAST results are available for this feature:
BLAST of slc24a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC8B14.816e-3539.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B11.700e-3339.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B14.747e-3339.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B14.747e-3339.29solute carrier family 8 member B1 [Source:HGNC Sym... [more]
SLC8B13.369e-1433.33solute carrier family 8 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncx-69.377e-3336.50Putative sodium/calcium exchanger 6 [Source:UniPr... [more]
ncx-74.316e-3235.82Putative sodium/calcium exchanger 7 [Source:UniPr... [more]
ncx-92.717e-2832.66Mitochondrial sodium/calcium exchanger protein [S... [more]
ncx-86.066e-2733.17Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:O16... [more]
ncx-103.835e-2530.56Na/Ca eXchangers [Source:UniProtKB/TrEMBL;Acc:Q96... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG147442.137e-2027.80gene:FBgn0033324 transcript:FBtr0307024[more]
CG123762.561e-1926.87gene:FBgn0033323 transcript:FBtr0339335[more]
CG123763.588e-1926.87gene:FBgn0033323 transcript:FBtr0088706[more]
CG53483.636e-1926.09gene:FBgn0034156 transcript:FBtr0305318[more]
CG147433.659e-1826.32gene:FBgn0033326 transcript:FBtr0307023[more]
back to top
BLAST of slc24a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b12.231e-2232.49solute carrier family 8 member B1 [Source:ZFIN;Acc... [more]
slc24a4b1.780e-625.77solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a4b3.095e-625.77solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a6a3.908e-624.49solute carrier family 24 member 6a [Source:ZFIN;Ac... [more]
slc24a34.347e-625.23solute carrier family 24 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b18.641e-3436.27solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b11.519e-3336.27solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b13.231e-3336.27solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b14.642e-3336.27solute carrier family 8 (sodium/lithium/calcium ex... [more]
slc8b17.653e-1534.38solute carrier family 8 (sodium/lithium/calcium ex... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc8b13.175e-3338.46solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b17.160e-3338.78solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b17.208e-3338.78solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc8b11.013e-2033.51solute carrier family 8 (sodium/lithium/calcium ex... [more]
Slc24a41.368e-729.59solute carrier family 24 (sodium/potassium/calcium... [more]
back to top
BLAST of slc24a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6J4K2|NCLX_HUMAN2.279e-3239.29Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q6AXS0|NCLX_RAT2.808e-3239.80Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|Q925Q3|NCLX_MOUSE5.009e-3238.78Mitochondrial sodium/calcium exchanger protein OS=... [more]
sp|P34315|NCX6_CAEEL1.193e-3136.50Putative sodium/calcium exchanger 6 OS=Caenorhabdi... [more]
sp|P34322|NCX7_CAEEL5.490e-3135.82Putative sodium/calcium exchanger 7 OS=Caenorhabdi... [more]
back to top
BLAST of slc24a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKA10.000e+0100.00Slc24a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YFD70.000e+071.52Slc24a-7 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF401.276e-9443.72Slc24a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267GEZ57.891e-4748.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G4729.203e-4748.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b14.264e-2636.19solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc24a31.309e-728.97solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a32.009e-728.97solute carrier family 24 member 3 [Source:NCBI gen... [more]
slc24a4a1.104e-628.04solute carrier family 24 member 4a [Source:ZFIN;Ac... [more]
slc24a4b2.501e-625.25sodium/potassium/calcium exchanger 4 [Source:NCBI ... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC8B12.802e-3137.20solute carrier family 8 member B1 [Source:HGNC Sym... [more]
slc24a4b1.609e-627.91solute carrier family 24 member 4b [Source:ZFIN;Ac... [more]
slc24a13.661e-628.89solute carrier family 24 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDL206W_mRNA1.769e-850.91Putative protein of unknown function; YDL206W is n... [more]
ECM272.801e-726.21Protein involved in calcium homeostasis and exit f... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319501.157e-2631.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352122.768e-728.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414217.575e-728.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320482.076e-631.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480067.162e-630.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc24a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc8b15.369e-2436.92solute carrier family 8 member B1 [Source:NCBI gen... [more]
slc8b16.331e-2436.92solute carrier family 8 member B1 [Source:NCBI gen... [more]
ENSORLT00000000373.22.986e-726.50sodium/potassium/calcium exchanger 3 [Source:NCBI ... [more]
slc24a4b4.375e-726.27solute carrier family 24 member 4 [Source:NCBI gen... [more]
ENSORLT00000003048.23.102e-626.67solute carrier family 24 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc24a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022802.10.000e+090.43SMESG000022802.1[more]
SMESG000022803.10.000e+063.73SMESG000022803.1[more]
SMESG000022803.10.000e+063.30SMESG000022803.1[more]
SMESG000022808.11.312e-11045.66SMESG000022808.1[more]
SMESG000022809.14.107e-9845.45SMESG000022809.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013820
GenBankAKN21563.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013820 ID=SMED30013820|Name=slc24a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2821bp
ACTTTTCAATATCATTAGTGTATATAAAGTAAGTATGATGTGATGACAAT
TAATTTATTATAATATTTTATGGATTTATGCACTCCTTTAAACTTCAGTA
GCTCTAACTATTCGAATATATGCCAGTATATTACCTTTTTCAGCAGTTGT
ATTCCAAATTTGGGGTTTATTAATTATTTCCAATGGCAGTATTGTTCGTT
TGATAATCGTTGGGCTCCAACAATACTTATGCTCTTATGGTTTTTATTTT
TGCTCACCGGTATAGCAACTGCGGCTGATAGTTTTTTGGCACCTTGCCTT
GTTGTCGTGGCAAAAACCATGAGAATGAGTGAAAATTTAGCAGGAGTTAC
TTTATTGGCTCTCGGAAATGGGGCTGCTGATGTATTTAGTTCCTTATCAG
CAGTTACATCAACTAGTAATCCGAATGTTGGTTTAGCTTTTGGAGGAATT
TTAGGAGCTGGGATATTTGTCAATTCAATAACCGCTGGTATAATAATGAT
AATTACTCCTTTCAAACTCATGAAGAGGCCAATTATAAAAGATTTTTTGT
TTTATTTTTCGGCCTTAATTTGGTGTATGTTCATTTTTATCAGAAGACAG
ATTGAATTGTGGTCTTCGTTAGTGTTTTTAATATTATACGCCATCTATAT
TTTGGTCACAGTAATATCAAGATTACTTTATGTTCGACATATTAAATCAA
AAGCGACAACCATTAAAACAAATAATTCAAACATAACAATTAGAACACCT
GATTTGAATGTAGAAAATGCAGAAATTCAACAAAAAGACAACAGAGACTC
TTCAACTTCAAATTCAGTTCTCATTTTCAAAGACAACAGATCTAAAGCAA
ATCAAAATATAACTGTAAATAATATTGAAATCACCGTTACGGCCTCAAAC
GATGAAGATGATCAAAAAAATGATTTAAATATAGCAATGAGGAAGTCATC
GTCGATTTCAGATTTTATTCCCATTTACAAAGACATCAAATCTAAAACAA
ATACAAATAAAATTGTAAATAATATTGAAATAACGGTTACACCGCCTAAA
GACGATATTTATCAAGAAAATTATTTGAATGAACTAAAAAGCATATCATC
GTCGATTTCGGATTTCAACTGCATTAATATCGAAAGATCAAATACAAGAG
TGTCCTTTGGAGGAAGTTTGAGAAACGATTACTCTTATGACAATCCAAAT
TATGTTCATGAGAACCACAAAGACCACTTTAGCAGAGCTTCAACTACTCT
TTCGAGTTTCAAAAGCAATTTCAGTTCCATAAATGACAAACCAAACTTTA
TCAAAGAATGTTATGAAGACAAATTGGATCATTTAAATGTACCTCAAACC
AACTATCAAGGAAAATCTAGGCTAGTCACATCTCAACATTCTTGTCCGCA
TGAATCGGAATGCAATGCAAAAAAGAGGGTATATGACTATTTAAATTCAT
ACCAATTTGAAAGATCTTACAATTCTTTTGAAAACGCTTTGCCATCATTG
AGATCTTCGATTATAGGAAACCACCAAAAGCATTCTTATTCCATCAAAAG
AAAGCACCATTCTGCTAGAAATTCCATGACCAGATCATCAAGTCATAGAT
CAATCGGATCTTTGGCACAAATAATTATAGATAAAGAACATGAGAAAGAA
AGAATGGAAAAACATCCAACATCTAAGAAAATTACTCATTTTAGATCTAT
TTCATTGACAATTATAAATGAAAGTCCCCTTAAAACTAAAATACGCTTTA
GGTCCATGAGTGAAAATGAAAAATCTAAATCAGATATTACAAATGAATGG
GGCATTATAAAAGGCAATCATAAAATCCCTCCAGAAAATGAAAATGAAAA
TAAATTTAACCTTGAAACTGGTGAAAATGGAGATTCCGTCGTTACTTTTC
CAGGCCCGTGGAAACATTTTGCATTGACGATTTTACCTGTAGACTTGGAA
GAATGGCGAGAGCAGTCGGGTTTCTCAAAGTTTCTCTCAATTATTCAATC
TCCTTTTATGTTTATTTTAACATTAACAATTCCAATAGTTGATGAAACTG
CTTATCTCAAAGGCTGGTGTAAAATCCTGAACTGTATTCACTGTTTATTA
TCCCTTGTTTTTTGGGTCTTACTGCCTAATGTATACAATACCCCTTTTGG
AACGAGTAACTTCTTGTTGGTATATTTATTCATAATTTTGGGATTTATTG
TCGGTGTTGTTGTCGCATTTACCTCAAAAGTCGACAAACCTCCAATATAT
CAGCCATTTTTTGCTTTTATTGGCCTCATCACTTCAATATTGTGGATATA
TGAAATTGCAAATGAAATAGTCAACATTCTTTCAGTTTTTGGAGTAGTTT
TCAATATATCTTCCGTGATTTTAGGGCTGAGTGTATTGGCCTTTGCTAAT
TCAACCGGAGATTTGGTTTCCAATGTCACTCTTGCGAAAAATAATTATCC
ACGGATTGGTTATTCAGCTTGTGTTGGAGGTCCACTCTTTAATCTTTTAG
TTGGAATTGGAATTCCATTTTCAATTAGGACTTTCAGTGGTCCTATACCA
GTTCAGCTAACAGGAACTTCAATTGTTTTAATATTCACAATCATGCTAGT
TACCACCTTGAACTTGTTATGCTTACCCTTGATGAAGTTTCAACCAAAAA
GATTTTACGGAATAATTCTGATAATCATATATATCATATATTTTGTTTTG
GTCATTCTTTTTGCTGTTGATATTATCAAAGTTACGTTATAAAGATAGAT
TAGATTATATATATTAGGTTAATTACTTATTTTTTATGATGGATGTATTT
TCAGATTTTATTAAAACAAAG
back to top

protein sequence of SMED30013820-orf-1

>SMED30013820-orf-1 ID=SMED30013820-orf-1|Name=SMED30013820-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=891bp
MDLCTPLNFSSSNYSNICQYITFFSSCIPNLGFINYFQWQYCSFDNRWAP
TILMLLWFLFLLTGIATAADSFLAPCLVVVAKTMRMSENLAGVTLLALGN
GAADVFSSLSAVTSTSNPNVGLAFGGILGAGIFVNSITAGIIMIITPFKL
MKRPIIKDFLFYFSALIWCMFIFIRRQIELWSSLVFLILYAIYILVTVIS
RLLYVRHIKSKATTIKTNNSNITIRTPDLNVENAEIQQKDNRDSSTSNSV
LIFKDNRSKANQNITVNNIEITVTASNDEDDQKNDLNIAMRKSSSISDFI
PIYKDIKSKTNTNKIVNNIEITVTPPKDDIYQENYLNELKSISSSISDFN
CINIERSNTRVSFGGSLRNDYSYDNPNYVHENHKDHFSRASTTLSSFKSN
FSSINDKPNFIKECYEDKLDHLNVPQTNYQGKSRLVTSQHSCPHESECNA
KKRVYDYLNSYQFERSYNSFENALPSLRSSIIGNHQKHSYSIKRKHHSAR
NSMTRSSSHRSIGSLAQIIIDKEHEKERMEKHPTSKKITHFRSISLTIIN
ESPLKTKIRFRSMSENEKSKSDITNEWGIIKGNHKIPPENENENKFNLET
GENGDSVVTFPGPWKHFALTILPVDLEEWREQSGFSKFLSIIQSPFMFIL
TLTIPIVDETAYLKGWCKILNCIHCLLSLVFWVLLPNVYNTPFGTSNFLL
VYLFIILGFIVGVVVAFTSKVDKPPIYQPFFAFIGLITSILWIYEIANEI
VNILSVFGVVFNISSVILGLSVLAFANSTGDLVSNVTLAKNNYPRIGYSA
CVGGPLFNLLVGIGIPFSIRTFSGPIPVQLTGTSIVLIFTIMLVTTLNLL
CLPLMKFQPKRFYGIILIIIYIIYFVLVILFAVDIIKVTL*
back to top
Aliases
The feature 'slc24a-2' has the following synonyms
Synonym
slc24a-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004837NaCa_Exmemb
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004837Sodium/calcium exchanger membrane regionPFAMPF01699Na_Ca_excoord: 730..877
e-value: 4.5E-22
score: 78.6
coord: 55..197
e-value: 2.4E-18
score: 66.6
NoneNo IPR availableGENE3DG3DSA:1.20.1420.30coord: 669..880
e-value: 8.5E-9
score: 37.0
coord: 86..200
e-value: 3.6E-12
score: 47.9
NoneNo IPR availableGENE3DG3DSA:1.20.58.1130coord: 75..85
e-value: 3.6E-12
score: 47.9
NoneNo IPR availablePANTHERPTHR12266NA+/CA2+ K+ INDEPENDENT EXCHANGERcoord: 11..884
NoneNo IPR availablePANTHERPTHR12266:SF0MITOCHONDRIAL SODIUM/CALCIUM EXCHANGER PROTEINcoord: 11..884
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 696..715
NoneNo IPR availableTMHMMTMhelixcoord: 862..884
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 667..686
NoneNo IPR availableTMHMMTMhelixcoord: 794..813
NoneNo IPR availableTMHMMTMhelixcoord: 751..773
NoneNo IPR availableTMHMMTMhelixcoord: 159..178
NoneNo IPR availableTMHMMTMhelixcoord: 722..741
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 828..850
NoneNo IPR availableTMHMMTMhelixcoord: 92..114