Teashirt

Overview
NameTeashirt (AIZ98417.1)
Smed IDSMED30013810
Length (bp)3755
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Teashirt (SMED30013810) t-SNE clustered cells

Violin plots show distribution of expression levels for Teashirt (SMED30013810) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Teashirt (SMED30013810) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Teashirt (SMED30013810) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013810

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30013810SMESG000008973.1 dd_Smed_v4_9287_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
tailSMED30013810SMESG000008973.1 dd_Smed_v4_9287_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
head marginSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
epidermisSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
pharynx pouchSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx pouchSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
posterior region of the whole animalSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30013810SMESG000008973.1 KP003815.1smed_ncbi_20200123PMID:25725068
Owen et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30013810SMESG000008973.1 dd_Smed_v4_9287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30013810SMESG000008973.1 dd_Smed_v6_9287_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013810SMESG000008973.1 dd_Smed_v4_9287_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Teashirt vs. Ensembl Human
Match: TSHZ2 (teashirt zinc finger homeobox 2 [Source:HGNC Symbol;Acc:HGNC:13010])

HSP 1 Score: 53.5286 bits (127), Expect = 3.157e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 3
Query: 1494 LTGRYRETVFNC-SCGEEFENLYSFTIHM-KTTHHLPNSTKIDR------TIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM +T H+  ++ K D+      + P+    QDM    + E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  209 FTGASR---FRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDM----DKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKV 303          
BLAST of Teashirt vs. Ensembl Human
Match: TSHZ2 (teashirt zinc finger homeobox 2 [Source:HGNC Symbol;Acc:HGNC:13010])

HSP 1 Score: 53.1434 bits (126), Expect = 3.492e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 3
Query: 1494 LTGRYRETVFNC-SCGEEFENLYSFTIHM-KTTHHLPNSTKIDR------TIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM +T H+  ++ K D+      + P+    QDM    + E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  206 FTGASR---FRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDM----DKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKV 300          
BLAST of Teashirt vs. Ensembl Human
Match: TSHZ2 (teashirt zinc finger homeobox 2 [Source:HGNC Symbol;Acc:HGNC:13010])

HSP 1 Score: 53.1434 bits (126), Expect = 3.492e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 3
Query: 1494 LTGRYRETVFNC-SCGEEFENLYSFTIHM-KTTHHLPNSTKIDR------TIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM +T H+  ++ K D+      + P+    QDM    + E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  206 FTGASR---FRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDM----DKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKV 300          
BLAST of Teashirt vs. Ensembl Fly
Match: tio (gene:FBgn0028979 transcript:FBtr0335391)

HSP 1 Score: 79.7221 bits (195), Expect = 1.260e-14
Identity = 47/143 (32.87%), Postives = 61/143 (42.66%), Query Frame = 3
Query: 1518 VFNCS-CGEEFENLYSFTIHMKTTHH------------------LPNSTK-------------------------------IDRTIP---KLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYND 1787
            VF C  C + F  L + T HMK T H                   P  T+                               I  T+P   KLVRGQD+W+    EQT++IL+CM C QSFR+L E+T HM ET HY+ I+  +
Sbjct:  316 VFKCVWCKQSFSTLANLTAHMKETQHCGVQIPSPLPTGGVGTPSAPPPTRLATSASNSACSSSSSSTSSSSNSSKSELNMLIKETMPLPRKLVRGQDVWLGKGAEQTRQILKCMWCGQSFRSLAEMTSHMQETQHYTNIISQE 458          
BLAST of Teashirt vs. Ensembl Fly
Match: tio (gene:FBgn0028979 transcript:FBtr0089377)

HSP 1 Score: 79.7221 bits (195), Expect = 1.260e-14
Identity = 47/143 (32.87%), Postives = 61/143 (42.66%), Query Frame = 3
Query: 1518 VFNCS-CGEEFENLYSFTIHMKTTHH------------------LPNSTK-------------------------------IDRTIP---KLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYND 1787
            VF C  C + F  L + T HMK T H                   P  T+                               I  T+P   KLVRGQD+W+    EQT++IL+CM C QSFR+L E+T HM ET HY+ I+  +
Sbjct:  316 VFKCVWCKQSFSTLANLTAHMKETQHCGVQIPSPLPTGGVGTPSAPPPTRLATSASNSACSSSSSSTSSSSNSSKSELNMLIKETMPLPRKLVRGQDVWLGKGAEQTRQILKCMWCGQSFRSLAEMTSHMQETQHYTNIISQE 458          
BLAST of Teashirt vs. Ensembl Fly
Match: tsh (gene:FBgn0003866 transcript:FBtr0085906)

HSP 1 Score: 74.3294 bits (181), Expect = 5.473e-13
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query: 1629 KLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNEN 1820
            KLVRGQ++W+    EQ  +IL+CMRC +SFR+L E+T HM ET HY+ I+  +    +   N N
Sbjct:  446 KLVRGQNVWLGKGVEQAMQILKCMRCGESFRSLGEMTKHMQETQHYTNILSQEQSISIKSGNAN 509          
BLAST of Teashirt vs. Ensembl Zebrafish
Match: tshz3a (teashirt zinc finger homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-100322-1])

HSP 1 Score: 55.8398 bits (133), Expect = 3.934e-7
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 3
Query: 1521 FNC-SCGEEFENLYSFTIHMKTTHH-----LPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F+C SC   ++ L   T+HM  T H     L +++K  ++  K  R + +      E  +++LRCM C  SF +L +L++HM++T HY ++
Sbjct:  215 FHCKSCSAAYDTLLDLTVHMNETDHYRDDNLESASKSGKSWSK-PRKRSLLEMEGKEDAQKVLRCMYCGHSFESLQDLSVHMIKTKHYQKV 304          
BLAST of Teashirt vs. Ensembl Zebrafish
Match: tshz3a (teashirt zinc finger homeobox 3a [Source:ZFIN;Acc:ZDB-GENE-100322-1])

HSP 1 Score: 55.8398 bits (133), Expect = 4.072e-7
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 3
Query: 1521 FNC-SCGEEFENLYSFTIHMKTTHH-----LPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F+C SC   ++ L   T+HM  T H     L +++K  ++  K  R + +      E  +++LRCM C  SF +L +L++HM++T HY ++
Sbjct:  158 FHCKSCSAAYDTLLDLTVHMNETDHYRDDNLESASKSGKSWSK-PRKRSLLEMEGKEDAQKVLRCMYCGHSFESLQDLSVHMIKTKHYQKV 247          
BLAST of Teashirt vs. Ensembl Xenopus
Match: TSHZ3 (teashirt zinc finger homeobox 3 [Source:HGNC Symbol;Acc:HGNC:30700])

HSP 1 Score: 52.373 bits (124), Expect = 6.642e-6
Identity = 27/90 (30.00%), Postives = 49/90 (54.44%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHM-KTTHHLPNSTKIDRTIPKL---VRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM +T H+  ++ + D   PK     R + +      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  186 FRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 275          
BLAST of Teashirt vs. Ensembl Xenopus
Match: tspan2 (tetraspanin 2 [Source:Xenbase;Acc:XB-GENE-6460649])

HSP 1 Score: 51.9878 bits (123), Expect = 7.587e-6
Identity = 27/91 (29.67%), Postives = 46/91 (50.55%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKL-----VRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM  T H  +  + DR   K       R + +      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  248 FRCKDCSAAYDTLVELTVHMNETGHYRDDNR-DRNAEKTRRWSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 337          
BLAST of Teashirt vs. Ensembl Xenopus
Match: tspan2 (tetraspanin 2 [Source:Xenbase;Acc:XB-GENE-6460649])

HSP 1 Score: 51.6026 bits (122), Expect = 9.656e-6
Identity = 27/91 (29.67%), Postives = 46/91 (50.55%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKL-----VRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM  T H  +  + DR   K       R + +      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  267 FRCKDCSAAYDTLVELTVHMNETGHYRDDNR-DRNAEKTRRWSKPRKRSLMEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 356          
BLAST of Teashirt vs. Ensembl Mouse
Match: Tshz2 (teashirt zinc finger family member 2 [Source:MGI Symbol;Acc:MGI:2153084])

HSP 1 Score: 53.5286 bits (127), Expect = 2.297e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 3
Query: 1494 LTGRYRETVFNC-SCGEEFENLYSFTIHM-KTTHHLPNSTKIDR------TIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM +T H+  ++ K D+      + P+    QDM    + E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  210 FTGASR---FRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDM----DKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKV 304          
BLAST of Teashirt vs. Ensembl Mouse
Match: Tshz2 (teashirt zinc finger family member 2 [Source:MGI Symbol;Acc:MGI:2153084])

HSP 1 Score: 53.5286 bits (127), Expect = 2.297e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 3
Query: 1494 LTGRYRETVFNC-SCGEEFENLYSFTIHM-KTTHHLPNSTKIDR------TIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM +T H+  ++ K D+      + P+    QDM    + E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  210 FTGASR---FRCRQCSAAYDTLVELTVHMNETGHYQDDNRKKDKLRPTSYSKPRKRAFQDM----DKEDAQKVLKCMFCGDSFDSLQDLSVHMIKTKHYQKV 304          
BLAST of Teashirt vs. Ensembl Mouse
Match: Tshz3 (teashirt zinc finger family member 3 [Source:MGI Symbol;Acc:MGI:2442819])

HSP 1 Score: 51.6026 bits (122), Expect = 8.934e-6
Identity = 27/90 (30.00%), Postives = 49/90 (54.44%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHM-KTTHHLPNSTKIDRTIPKL---VRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM +T H+  ++ + D   PK     R + +      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  214 FRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 303          
BLAST of Teashirt vs. UniProt/SwissProt
Match: sp|Q9U3V5|TIPT_DROME (Protein tiptop OS=Drosophila melanogaster OX=7227 GN=tio PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.263e-13
Identity = 47/143 (32.87%), Postives = 61/143 (42.66%), Query Frame = 3
Query: 1518 VFNCS-CGEEFENLYSFTIHMKTTHH------------------LPNSTK-------------------------------IDRTIP---KLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYND 1787
            VF C  C + F  L + T HMK T H                   P  T+                               I  T+P   KLVRGQD+W+    EQT++IL+CM C QSFR+L E+T HM ET HY+ I+  +
Sbjct:  316 VFKCVWCKQSFSTLANLTAHMKETQHCGVQIPSPLPTGGVGTPSAPPPTRLATSASNSACSSSSSSTSSSSNSSKSELNMLIKETMPLPRKLVRGQDVWLGKGAEQTRQILKCMWCGQSFRSLAEMTSHMQETQHYTNIISQE 458          
BLAST of Teashirt vs. UniProt/SwissProt
Match: sp|P22265|TSH_DROME (Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 5.922e-12
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query: 1629 KLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNEN 1820
            KLVRGQ++W+    EQ  +IL+CMRC +SFR+L E+T HM ET HY+ I+  +    +   N N
Sbjct:  446 KLVRGQNVWLGKGVEQAMQILKCMRCGESFRSLGEMTKHMQETQHYTNILSQEQSISIKSGNAN 509          
BLAST of Teashirt vs. TrEMBL
Match: A0A0A7NXG7 (Teashirt (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 809/810 (99.88%), Postives = 809/810 (99.88%), Query Frame = 3
Query:  408 MELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVLQNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLFQNMLNSIAQXXXXXXXIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFXXXXXXXXXXXXGHRLSKSINHSFHXXXXXXXXXXXXXXXXXXXXXXXXXTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGXXXXXXXXXXXXXXXXXDEKKRVNY 2837
            MELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVLQNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFTPPIHPPPHSTVPVPPSPLFSSNSSFLPPTPSSVLFQNMLNSIAQSSSSTSSIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRPSNIFNNNNFISPTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVSSNSDKSNKDSHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKSHSTVTSSPIPSSPGEIIRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFINSSLITTSTNSGHRLSKSINHSFHSSNTKLSSSKSTTNNNEKLPKPENKTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGTTAN SCSISSTSITQSDEKKRVNY
Sbjct:    1 MELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVLQNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFTPPIHPPPHSTVPVPPSPLFSSNSSFLPPTPSSVLFQNMLNSIAQSSSSTSSIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRPSNIFNNNNFISPTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVSSNSDKSNKDSHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKSHSTVTSSPIPSSPGEIIRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFINSSLITTSTNSGHRLSKSINHSFHSSNTKLSSSKSTTNNNEKLPKPENKTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGTTANASCSISSTSITQSDEKKRVNY 810          
BLAST of Teashirt vs. TrEMBL
Match: A0A0R3SRC7 (C2H2-type domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7713 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 6.191e-47
Identity = 145/438 (33.11%), Postives = 208/438 (47.49%), Query Frame = 3
Query: 1083 PESFGVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNSTSINSI-MNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYL------NNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSNSNDSDIGEEINFKFRKISASP----ISSSNDTEID--------VGMKSDKYIDDELNDKESKNQE---------KITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGS-----DSVIRQIENFVEKNLP 2297
            P   G+S+RGNQKYS +YQ                              H+S    +S R+       S   + P FH    +L  +S R  G+S  ++               H    + +S+    M   + + L    R RET F CSCGE+FE+LY FT+HM+ T H P S++ +R IPKLVRGQDMWINSETEQT+EILRCMRC+QSFR+LPELTMHM++T+HYSEIVY+D G+ +        ++ N    S +  +S             +KR          G         +   P    I+S ++ +++         G+KS +  + +  ++ + + E              E+L    +LQ     SGTS P+ ++D   + Y N     +ENN     +G   S     DSVIRQIE+FVEK+LP
Sbjct:  244 PPMSGISMRGNQKYSAFYQHNRK--------------------------HQSTEESESFRQ-------STAPNAPQFH----RLGFTSRRISGSSLPNQ------------ARCHFPNPSESSLKPAGMGPRMQNELTSPPRSRETAFLCSCGEDFESLYVFTLHMRDTGHKPRSSQPERDIPKLVRGQDMWINSETEQTREILRCMRCNQSFRSLPELTMHMMKTSHYSEIVYSDAGRNLLASQTFSSSDRNRSGGSSTNSSSWGGGLKSNSASTAMKRPLR-------GNAAALPQNGLGVPPEIPKITSESEKKVNGHPENLQRAGIKSPRLEEPQKRERPASSHEMHVVKPSPKPAASPEALSCPSELQ----RSGTSSPRNENDRSEQKYLNSPTSSRENN-SPKASGDEPSRRGCTDSVIRQIESFVEKSLP 620          

HSP 2 Score: 69.3218 bits (168), Expect = 6.641e-8
Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 3
Query: 3288 ISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLR 3389
            I+KKAKCHFC KPFANKGQVRLHISK KCP LL+
Sbjct:  909 ITKKAKCHFCGKPFANKGQVRLHISKNKCPCLLQ 942          
BLAST of Teashirt vs. TrEMBL
Match: A0A068Y850 (Protein tiptop OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 7.171e-47
Identity = 145/433 (33.49%), Postives = 208/433 (48.04%), Query Frame = 3
Query: 1095 GVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNS-------TSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVY-------LNNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSNSNDSDIGEEINFKFRK-ISASPISSSNDTEID---VGMKSDKYIDDELNDKESKNQE---------KITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENN----MDSTVNGLNGSDSVIRQIENFVEKNLPK 2300
            G+S+RGNQKYS +YQ                              H+     +S R+S            P FH    +L   S R +G +                  SH +G+ S        S+  +++Q L S +    R RET F CSCG++FE+LY FT+HM+ T H P S++ +R IPKLVRGQDMWINSETEQT+EILRCMRC+QSFR+LPELTMHM++T+HYSEIVY+D G+ +        +   N    S +T   +P           +KR    S  S  G  ++ +  K I +S I    +  ++   +G KS +  + +  ++ + + E              E+L    DLQ     S  S P+ + +   + Y N     +EN      +   +    +DSVIRQIE+FVEK+LPK
Sbjct:  267 GISMRGNQKYSAFYQHNRK--------------------------HQVIEEAESLRQSV-------ATPTPPFH----RLGFPSRRVNGPA----------------LPSHTKGHFSNPSGGLEPSLKPVISQRLQSEITSPPRSRETAFLCSCGDDFESLYGFTLHMRDTGHKPRSSQPERDIPKLVRGQDMWINSETEQTREILRCMRCNQSFRSLPELTMHMMKTSHYSEIVYSDAGRNLLASQTFSSVAERNRSGSSMNTSLWNPTGLKTSSSSMPLKRPIRGSVPSQNGLAMSSEPTKNIESSTIEKKVNGHLEAPHIGTKSSRLKEPQKCERPASSYEMHVVKPSPKPAASPEALSCPSDLQ----RSAASSPRNEGEKQEQKYLNSPTSSRENTSPRASEEEASRRGCTDSVIRQIESFVEKSLPK 642          

HSP 2 Score: 70.0922 bits (170), Expect = 3.821e-8
Identity = 34/55 (61.82%), Postives = 39/55 (70.91%), Query Frame = 3
Query: 3258 VNIHRNSPPT-----------ISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLR 3389
            +++H N PPT           I+KKAKCHFC KPFANKGQVRLHISK KCP LL+
Sbjct:  914 LSVHMN-PPTMTSAGPSIVANITKKAKCHFCGKPFANKGQVRLHISKNKCPCLLQ 967          
BLAST of Teashirt vs. TrEMBL
Match: A0A564Y789 (C2H2-type domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3116 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 9.841e-47
Identity = 146/432 (33.80%), Postives = 206/432 (47.69%), Query Frame = 3
Query: 1083 PESFGVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNSTSINSI-MNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYL------NNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSN------SNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQE---------KITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGS-----DSVIRQIENFVEKNLP 2297
            P   G+S+RGNQKYS +YQ                              H+S    +S R+       S   + P FH    +L  +S R  G+S  ++               H    + +S+    M   + + L    R RET F CSCGE+FE+LY FT+HM+ T H P S++ +R IPKLVRGQDMWINSETEQT+EILRCMRC+QSFR+LPELTMHM++T+HYSEIVY+D G+ +        ++ N    S +  +S             +KR           N   +  EI  K    S   ++   +     G+KS +  + +  ++ + + E              E+L    +LQ     SGTS P+ ++D   + Y N     +ENN     +G   S     DSVIRQIE+FVEK+LP
Sbjct:  309 PPMSGISMRGNQKYSAFYQHNRK--------------------------HQSTEESESFRQ-------STAPNAPQFH----RLGFTSRRISGSSLPNQ------------ARCHFPNPSESSLKPAGMGPRMQNELTSPPRSRETAFLCSCGEDFESLYVFTLHMRDTGHKPRSSQPERDIPKLVRGQDMWINSETEQTREILRCMRCNQSFRSLPELTMHMMKTSHYSEIVYSDAGRNLLASQTFSSSDRNRSGGSSTNSSSWGGGLKSNSASTAMKRPLRGNAAALPQNGLGVPPEIP-KITSESEKKVNGHPENLQRAGIKSPRLEEPQKRERPASSHEMHVVKPSPKPAASPEALSCPSELQ----RSGTSSPRNENDRSEQKYLNSPTSSRENN-SPKASGDEPSRRGCTDSVIRQIESFVEKSLP 685          

HSP 2 Score: 69.3218 bits (168), Expect = 7.655e-8
Identity = 29/34 (85.29%), Postives = 31/34 (91.18%), Query Frame = 3
Query: 3288 ISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLR 3389
            I+KKAKCHFC KPFANKGQVRLHISK KCP LL+
Sbjct:  974 ITKKAKCHFCGKPFANKGQVRLHISKNKCPCLLQ 1007          
BLAST of Teashirt vs. TrEMBL
Match: W6UJW4 (Protein tiptop OS=Echinococcus granulosus OX=6210 GN=EGR_03716 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 3.014e-46
Identity = 144/426 (33.80%), Postives = 209/426 (49.06%), Query Frame = 3
Query: 1095 GVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVY-------LNNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSNSNDSDIGEEINFKFRK-ISASPISSSNDTEID---VGMKSDKYIDDELNDKESKNQE---------KITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENN----MDSTVNGLNGSDSVIRQIENFVEKNLPK 2300
            G+S+RGNQKYS +YQ                           +  H+     +S R+S            P FH    +L   S R +G        P   +  K +  +   G   +   S+++Q L S +    R RET F CSCG++FE+LY FT+HM+ T H P S++ +R IPKLVRGQDMWINSETEQT+EILRCMRC+QSFR+LPELTMHM++T+HYSEIVY+D G+ +        +   N    S +T + +P          ++KR    S  S  G  ++ +  K I +S I    +   +   +G KS +  + +  ++ + + E              E+L    DLQ     S  S P+ + +   + Y N     +EN      +   +    +DSVIRQIE+FVEK+LPK
Sbjct:  269 GISMRGNQKYSAFYQH--------------------------TRKHQVIEEAESLRQSV-------ATPAPPFH----RLGFPSRRVNG--------PALPSHTKGHFSNPSGGLEPSLKPSVISQRLQSEITSPPRSRETAFLCSCGDDFESLYGFTLHMRDTGHKPRSSQPERDIPKLVRGQDMWINSETEQTREILRCMRCNQSFRSLPELTMHMMKTSHYSEIVYSDAGRNLLASQTFSSVAERNRSGSSMNTSSWNPTGLKTSSSSMSLKRPIRGSVPSQNGLAMSSEPTKNIESSTIEKKVNGHPEAPHIGNKSSRLEEPQKCERPASSYEMHVVKPSPKPAASPEALSCPSDLQ----RSAASSPRNEGEKQEQKYLNSPTSSRENTSPRASEEEASRRGCTDSVIRQIESFVEKSLPK 645          

HSP 2 Score: 70.0922 bits (170), Expect = 3.791e-8
Identity = 34/55 (61.82%), Postives = 39/55 (70.91%), Query Frame = 3
Query: 3258 VNIHRNSPPT-----------ISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLR 3389
            +++H N PPT           I+KKAKCHFC KPFANKGQVRLHISK KCP LL+
Sbjct:  917 LSVHMN-PPTMTSAGPSIVANITKKAKCHFCGKPFANKGQVRLHISKNKCPCLLQ 970          
BLAST of Teashirt vs. Ensembl Cavefish
Match: tshz3a (teashirt homolog 3-like [Source:NCBI gene;Acc:103039303])

HSP 1 Score: 59.3066 bits (142), Expect = 3.169e-8
Identity = 32/100 (32.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query: 1521 FNC-SCGEEFENLYSFTIHMKTTHHLPN-----STKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCV 1802
            F+C SC   ++ L   T+HM  T H  +     S K  +T  K  R + +      E  +++LRCM C  SF +L +L++HM++T HY ++   +TG  +
Sbjct:  224 FHCKSCSASYDTLVDLTVHMNDTGHYRDDNHEKSGKGAKTWSK-PRKRSLLEMEGKEDAQKVLRCMYCGHSFESLQDLSVHMIKTKHYQKVPLKETGTAI 322          
BLAST of Teashirt vs. Ensembl Cavefish
Match: TSHZ1 (teashirt zinc finger homeobox 1 [Source:NCBI gene;Acc:103045577])

HSP 1 Score: 51.6026 bits (122), Expect = 6.760e-6
Identity = 27/95 (28.42%), Postives = 44/95 (46.32%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSET---------EQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM  T H  +  K      K   G+  W              E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  270 FRCKDCSAAYDTLVGLTVHMNETGHYRDDNKD-----KEEDGRKRWSKPRKRSLMEMESKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 359          
BLAST of Teashirt vs. Ensembl Cavefish
Match: TSHZ1 (teashirt zinc finger homeobox 1 [Source:NCBI gene;Acc:103045577])

HSP 1 Score: 51.2174 bits (121), Expect = 7.475e-6
Identity = 26/90 (28.89%), Postives = 44/90 (48.89%), Query Frame = 3
Query: 1521 FNCS-CGEEFENLYSFTIHMKTTHHLPNSTKI----DRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
            F C  C   ++ L   T+HM  T H  +  K      R      R + +      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  265 FRCKDCSAAYDTLVGLTVHMNETGHYRDDNKDKEEDGRKRWSKPRKRSLMEMESKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHYQKV 354          
BLAST of Teashirt vs. Ensembl Cavefish
Match: tshz2 (teashirt zinc finger homeobox 2 [Source:NCBI gene;Acc:103035208])

HSP 1 Score: 50.8322 bits (120), Expect = 9.410e-6
Identity = 29/99 (29.29%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 1494 LTGRYRETVFNCS-CGEEFENLYSFTIHMKTTHHLP----NSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEI 1775
             TG  R   F C  C   ++ L   T+HM  + H      N   I  T     R +++      E  +++L+CM C  SF +L +L++HM++T HY ++
Sbjct:  212 FTGASR---FRCKDCSAAYDTLVELTVHMNKSGHYQDDNNNRQGIASTSTSKSRKRNLQDMEGKEDAQKVLKCMFCGHSFDSLQDLSVHMIKTKHYQKV 307          
BLAST of Teashirt vs. Planmine SMEST
Match: SMESG000008973.1 (SMESG000008973.1)

HSP 1 Score: 1944.86 bits (5037), Expect = 0.000e+0
Identity = 1154/1157 (99.74%), Postives = 1155/1157 (99.83%), Query Frame = 3
Query:  201 MATPTTEDVKPILSPLDLSLKINANDSYQKSVSSNEIQEEKLKSFDXXXXXXXXXXXXXXXXXXXXXXTMELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVLQNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLFQNMLNSIAQXXXXXXXIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRXXXXXXXXXXXXXTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVXXXXXXXXXXXHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKXXXXXXXXXXXXXXXXXXRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIESLKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFXXXXXXXXXXXXGHRLSKSINHSFHXXXXXXXXXXXXXXXXXXXXXXXXXTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGXXXXXXXXXXXXXXXXXDEKKRVNYMNSDICKSFTPHDVIDSSTTILSWYHKLGELLGLPQALSQAMLTPDALKDLANSVLMIHNSKKSHSESLKSNESHGICTEDDNNNQNIYEKTNSTPNSTSHQRECDPLEQLKNLLHTTTDLGXXXXXXXXXXXXXXXXXGVNIHRNSPPTISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLRSCSSNCNPTESKVNSNMSPLNFESNFHHFGRMNDGTDPNIKLESENCQKMSPNENVLISKSVNMIREYFKFARQMIGNEEPSKSPKNLIENEIE 3671
            MATPTTEDVKPILSPLDLSLKINANDSYQKSVSSNEIQEEKLKSFDEYKSVSSEELLSLKLLHDRLSKTMELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEV QNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFTPPIHPPPHSTVPVPPSPLFSSNSSFLPPTPSSVLFQNMLNSIAQSSSSTSSIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRPSNIFNNNNFISPTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVSSNSDKSNKDSHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKSHSTVTSSPIPSSPGEIIRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIES+KESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFINSSLITTSTNSGHRLSKSINHSFHSSNTKLSSSKSTTNNNEKLPKPENKTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGTTAN SCSISSTSITQSDEKKRVNYMNSDICKSFTPHDVIDSSTTILSWYHKLGELLGLPQALSQAMLTPDALKDLANSVLMIHNSKKSHSESLKSNESHGICTEDDNNNQNIYEKTNSTPNSTSHQRECDPLEQLKNLLHTTTDLGNNNSNHNHPSSSNKFHNGVNIHRNSPPTISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLRSCSSNCNPTESKVNSNMSPLNFESNFHHFGRMNDGTDPNIKLESENCQKMSPNENVLISKSVNMIREYFKFARQMIGNEEPSKSPKNLIENEIE
Sbjct:    1 MATPTTEDVKPILSPLDLSLKINANDSYQKSVSSNEIQEEKLKSFDEYKSVSSEELLSLKLLHDRLSKTMELLMPQDKLKMFDEKTSQTSSGIQTLDENQPSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVHQNSFDENKTPTQSKLLTPNFDIWSYWHEYLLSLYVMNSTLSSFTPPIHPPPHSTVPVPPSPLFSSNSSFLPPTPSSVLFQNMLNSIAQSSSSTSSIPPNTEENNLKHYIIQENLFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGVSLRGNQKYSIYYQQRPSNIFNNNNFISPTCQSSFSGKTNTSTSHKSFSNDDSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVSSNSDKSNKDSHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFENLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCMRCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKSHSTVTSSPIPSSPGEIIRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTEIDVGMKSDKYIDDELNDKESKNQEKITKIESVKESKDLQITEADSGTSDPQPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPKPISAEFINSSLITTSTNSGHRLSKSINHSFHSSNTKLSSSKSTTNNNEKLPKPENKTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSSLQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQALVAGTTANASCSISSTSITQSDEKKRVNYMNSDICKSFTPHDVIDSSTTILSWYHKLGELLGLPQALSQAMLTPDALKDLANSVLMIHNSKKSHSESLKSNESHGICTEDDNNNQNIYEKTNSTPNSTSHQRECDPLEQLKNLLHTTTDLGNNNSNHNHPSSSNKFHNGVNIHRNSPPTISKKAKCHFCNKPFANKGQVRLHISKGKCPSLLRSCSSNCNPTESKVNSNMSPLNFESNFHHFGRMNDGTDPNIKLESENCQKMSPNENVLISKSVNMIREYFKFARQMIGNEEPSKSPKNLIENEIE 1157          
The following BLAST results are available for this feature:
BLAST of Teashirt vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSHZ23.157e-631.37teashirt zinc finger homeobox 2 [Source:HGNC Symbo... [more]
TSHZ23.492e-631.37teashirt zinc finger homeobox 2 [Source:HGNC Symbo... [more]
TSHZ23.492e-631.37teashirt zinc finger homeobox 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Teashirt vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teashirt vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tio1.260e-1432.87gene:FBgn0028979 transcript:FBtr0335391[more]
tio1.260e-1432.87gene:FBgn0028979 transcript:FBtr0089377[more]
tsh5.473e-1346.88gene:FBgn0003866 transcript:FBtr0085906[more]
back to top
BLAST of Teashirt vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tshz3a3.934e-731.87teashirt zinc finger homeobox 3a [Source:ZFIN;Acc:... [more]
tshz3a4.072e-731.87teashirt zinc finger homeobox 3a [Source:ZFIN;Acc:... [more]
back to top
BLAST of Teashirt vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TSHZ36.642e-630.00teashirt zinc finger homeobox 3 [Source:HGNC Symbo... [more]
tspan27.587e-629.67tetraspanin 2 [Source:Xenbase;Acc:XB-GENE-6460649][more]
tspan29.656e-629.67tetraspanin 2 [Source:Xenbase;Acc:XB-GENE-6460649][more]
back to top
BLAST of Teashirt vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tshz22.297e-631.37teashirt zinc finger family member 2 [Source:MGI S... [more]
Tshz22.297e-631.37teashirt zinc finger family member 2 [Source:MGI S... [more]
Tshz38.934e-630.00teashirt zinc finger family member 3 [Source:MGI S... [more]
back to top
BLAST of Teashirt vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9U3V5|TIPT_DROME1.263e-1332.87Protein tiptop OS=Drosophila melanogaster OX=7227 ... [more]
sp|P22265|TSH_DROME5.922e-1246.88Protein teashirt OS=Drosophila melanogaster OX=722... [more]
back to top
BLAST of Teashirt vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7NXG70.000e+099.88Teashirt (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0R3SRC76.191e-4733.11C2H2-type domain-containing protein OS=Hymenolepis... [more]
A0A068Y8507.171e-4733.49Protein tiptop OS=Echinococcus multilocularis OX=6... [more]
A0A564Y7899.841e-4733.80C2H2-type domain-containing protein OS=Hymenolepis... [more]
W6UJW43.014e-4633.80Protein tiptop OS=Echinococcus granulosus OX=6210 ... [more]
back to top
BLAST of Teashirt vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tshz3a3.169e-832.00teashirt homolog 3-like [Source:NCBI gene;Acc:1030... [more]
TSHZ16.760e-628.42teashirt zinc finger homeobox 1 [Source:NCBI gene;... [more]
TSHZ17.475e-628.89teashirt zinc finger homeobox 1 [Source:NCBI gene;... [more]
tshz29.410e-629.29teashirt zinc finger homeobox 2 [Source:NCBI gene;... [more]
back to top
BLAST of Teashirt vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teashirt vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teashirt vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teashirt vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Teashirt vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008973.10.000e+099.74SMESG000008973.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013810
GenBankAIZ98417.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013810 ID=SMED30013810|Name=Teashirt|organism=Schmidtea mediterranea sexual|type=transcript|length=3755bp
TTTAGTTGTTATTGAGTGACTGCTTATTATTATTGCTCTATCTAAGTGTC
TCATTATTATTGGTTCATTCAATTGGGATTTTTATTCAGATTTTTTTCAA
AAAATAATTTTTTTCTCTCGCTTCGAAAATTCCAAATGCCATCTTGGATA
AAGATTTTATAAAAATTTATCAGTAGAACATTTGATTTCATTGTTTCCTT
ATGGCAACACCGACGACTGAAGATGTTAAGCCGATTCTTTCGCCTTTAGA
TTTATCACTAAAAATCAACGCAAACGATTCATATCAAAAGTCAGTCAGTT
CCAACGAAATCCAGGAGGAAAAGTTAAAATCTTTCGACGAATACAAATCA
GTTAGCAGTGAAGAATTGTTGAGTTTGAAACTCCTTCACGATAGATTGAG
CAAAACAATGGAGTTATTAATGCCTCAGGATAAGTTGAAAATGTTCGATG
AAAAAACTTCTCAGACTTCTTCTGGCATACAAACTCTCGATGAAAATCAA
CCATCTTTTGATAAATCCATTGAAAATTTTGATTACCGAACTACAATGAA
AGCCCTTTTATCACTGGTCGGTTCAGATAACCCAACGAAATCTTTAGGGT
CAGAAGTACTTCAGAATTCTTTTGATGAAAATAAAACCCCAACTCAAAGT
AAATTGTTAACTCCAAACTTTGACATATGGTCATATTGGCATGAATATTT
ATTGTCGTTGTATGTAATGAATTCAACTCTCTCTTCATTTACCCCTCCAA
TTCACCCTCCTCCTCATTCAACAGTTCCAGTACCTCCATCTCCTTTATTC
TCCTCAAATTCCTCGTTTTTACCTCCAACACCGTCTTCAGTTCTATTTCA
GAACATGTTGAACAGTATCGCACAAAGCTCTTCGTCGACATCGTCAATTC
CACCGAACACCGAAGAAAACAATTTAAAGCATTACATCATTCAAGAAAAT
CTTTTTCCAGATTTTAGCTATAAAAATAAAAAACAAAATTCCTATCAGCT
TTTAAAAGATTCGAATTTTTTATACAACTCTTTTGCATTCAATCGAAATC
TTGGTTTAACCAAAAACAAACTCCTCGACAGTCCAGAATCGTTCGGGGTT
TCGTTGCGGGGTAATCAAAAGTATAGTATATATTATCAACAAAGACCGAG
TAATATTTTCAATAATAACAATTTCATATCCCCAACATGTCAGTCATCCT
TTTCCGGGAAAACAAATACGAGTACGTCTCATAAAAGTTTTTCCAATGAT
GATTCGACTCGTAGATCACAAAATTTCAGTGATATTTCAAACAAAAAATC
CTTACCAACCTTTCATTCGAATAGTTGTAAATTATCGAAATCCTCGACTC
GAAATGATGGGAATTCTTCCAATCATAAGTTTACTCCAGTCTCTTCTAAT
AGTGACAAATCAAATAAAGATTCCCACTTAGAAGGATACAATAGCACCAG
CATTAACAGTATAATGAATCAAACCTTACCATCAAATCTACATTTAACTG
GCCGATATCGGGAAACTGTATTTAATTGTTCTTGTGGAGAAGAATTTGAA
AATCTTTACTCTTTCACAATTCACATGAAGACTACGCATCACTTGCCGAA
TTCTACCAAAATCGACCGAACAATACCGAAACTCGTCCGAGGTCAAGACA
TGTGGATTAACAGTGAAACGGAACAAACCAAAGAAATTCTCCGTTGCATG
AGATGCCATCAGTCGTTTCGTACCTTACCAGAATTGACAATGCATATGGT
AGAAACGAATCACTACTCAGAAATAGTCTACAATGACACCGGGAAATGTG
TCTATCTCAACAATGAAAACGACAAAACAAAATCTCATTCCACTGTTACC
AGTAGTCCGATTCCTTCTTCTCCAGGAGAAATTATCCGCAATATAAAGCG
AACTTGGTCAAATTCCAATGACTCCGATATTGGAGAAGAGATCAACTTTA
AATTTAGAAAAATATCCGCCAGCCCAATTAGTTCATCAAACGACACAGAA
ATAGACGTTGGAATGAAAAGCGACAAATATATAGACGATGAACTAAATGA
CAAAGAGAGCAAAAATCAAGAAAAAATTACCAAAATTGAATCATTAAAAG
AGAGTAAAGACTTACAGATAACGGAAGCCGATTCCGGAACGAGTGATCCC
CAACCTGATAGCGACTGTCATGTTAAATCATATCATAATATAAAAGAATG
CAAAAAAGAGAACAATATGGATTCGACAGTTAATGGATTGAACGGGTCTG
ATTCTGTGATAAGACAAATTGAGAACTTTGTTGAAAAAAATCTCCCAAAA
CCCATCAGTGCAGAATTTATCAATTCGTCTTTGATTACCACTTCAACAAA
TTCGGGTCATCGTTTATCGAAATCTATAAATCACTCTTTCCATTCAAGTA
ACACTAAACTTTCATCATCAAAATCCACTACCAACAATAACGAAAAGTTA
CCTAAGCCAGAAAACAAAACTTCCCAGTCAGAAAAATCCGATTTCAGTTC
TTCTGTTAAAACAAAATCTATCGATGAGATCTTTAGCAACTTCAACTATA
GGTCATATCAATCTTTTGCAACAGATCTTAATGAAAATCCTCTTTCGAGT
CTTCAAAGTTTAGTAGAAACAATTCAAAAAAATCCTCCTCAAAATAAAGA
GCAAAACATAGGAAAAAGCTCATCACATTCTGTACAGACAAAAGACTATA
ATCATTCTAAGTCCCCCATATCCTGTGACAGCTTAAATCAGTTGCAAGCG
CTAGTTGCTGGAACGACTGCTAACACTTCTTGTTCGATCTCATCAACGTC
TATAACTCAAAGTGATGAAAAGAAACGTGTCAATTACATGAACAGTGACA
TCTGTAAAAGTTTCACTCCCCATGATGTAATTGATTCATCAACAACTATT
TTGAGTTGGTATCATAAACTAGGAGAACTGTTAGGTTTACCTCAAGCTCT
TTCTCAAGCAATGTTGACTCCAGACGCCTTAAAAGATCTGGCAAATAGTG
TCCTGATGATTCACAATTCTAAAAAATCTCACTCAGAATCATTGAAGTCA
AATGAATCTCACGGAATTTGTACAGAAGATGACAACAATAATCAAAATAT
TTACGAAAAAACAAATTCTACTCCGAATTCAACTTCCCATCAGAGAGAAT
GTGACCCTCTCGAACAACTAAAAAATCTCCTCCACACAACGACAGACCTA
GGAAATAATAATTCAAACCACAATCATCCTTCCAGTTCAAACAAATTCCA
CAATGGGGTTAATATCCATCGAAACAGTCCACCGACAATATCAAAGAAAG
CAAAATGTCATTTTTGTAATAAACCATTTGCAAATAAAGGTCAAGTTCGG
CTTCACATCAGCAAAGGAAAGTGTCCATCATTACTGAGATCTTGTAGTTC
AAATTGCAACCCCACAGAATCGAAAGTCAATTCCAATATGTCTCCGTTGA
ATTTCGAATCCAATTTTCATCATTTTGGACGAATGAACGACGGAACTGAT
CCCAATATCAAATTAGAGTCAGAAAATTGTCAGAAAATGTCTCCAAATGA
AAATGTCCTCATTTCCAAATCTGTCAACATGATAAGGGAGTATTTTAAAT
TCGCCCGCCAAATGATCGGAAATGAAGAACCGTCCAAGAGTCCAAAGAAT
TTAATCGAGAATGAAATTGAATGAATTTTTGATTGATATTATAATATGTA
CAGACGAGATATTAATATCTGTATTATAGTTTAAAAAAAATTTGATTCTT
TCGTT
back to top

protein sequence of SMED30013810-orf-1

>SMED30013810-orf-1 ID=SMED30013810-orf-1|Name=SMED30013810-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1158bp
MATPTTEDVKPILSPLDLSLKINANDSYQKSVSSNEIQEEKLKSFDEYKS
VSSEELLSLKLLHDRLSKTMELLMPQDKLKMFDEKTSQTSSGIQTLDENQ
PSFDKSIENFDYRTTMKALLSLVGSDNPTKSLGSEVLQNSFDENKTPTQS
KLLTPNFDIWSYWHEYLLSLYVMNSTLSSFTPPIHPPPHSTVPVPPSPLF
SSNSSFLPPTPSSVLFQNMLNSIAQSSSSTSSIPPNTEENNLKHYIIQEN
LFPDFSYKNKKQNSYQLLKDSNFLYNSFAFNRNLGLTKNKLLDSPESFGV
SLRGNQKYSIYYQQRPSNIFNNNNFISPTCQSSFSGKTNTSTSHKSFSND
DSTRRSQNFSDISNKKSLPTFHSNSCKLSKSSTRNDGNSSNHKFTPVSSN
SDKSNKDSHLEGYNSTSINSIMNQTLPSNLHLTGRYRETVFNCSCGEEFE
NLYSFTIHMKTTHHLPNSTKIDRTIPKLVRGQDMWINSETEQTKEILRCM
RCHQSFRTLPELTMHMVETNHYSEIVYNDTGKCVYLNNENDKTKSHSTVT
SSPIPSSPGEIIRNIKRTWSNSNDSDIGEEINFKFRKISASPISSSNDTE
IDVGMKSDKYIDDELNDKESKNQEKITKIESLKESKDLQITEADSGTSDP
QPDSDCHVKSYHNIKECKKENNMDSTVNGLNGSDSVIRQIENFVEKNLPK
PISAEFINSSLITTSTNSGHRLSKSINHSFHSSNTKLSSSKSTTNNNEKL
PKPENKTSQSEKSDFSSSVKTKSIDEIFSNFNYRSYQSFATDLNENPLSS
LQSLVETIQKNPPQNKEQNIGKSSSHSVQTKDYNHSKSPISCDSLNQLQA
LVAGTTANTSCSISSTSITQSDEKKRVNYMNSDICKSFTPHDVIDSSTTI
LSWYHKLGELLGLPQALSQAMLTPDALKDLANSVLMIHNSKKSHSESLKS
NESHGICTEDDNNNQNIYEKTNSTPNSTSHQRECDPLEQLKNLLHTTTDL
GNNNSNHNHPSSSNKFHNGVNIHRNSPPTISKKAKCHFCNKPFANKGQVR
LHISKGKCPSLLRSCSSNCNPTESKVNSNMSPLNFESNFHHFGRMNDGTD
PNIKLESENCQKMSPNENVLISKSVNMIREYFKFARQMIGNEEPSKSPKN
LIENEIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000044cephalic ganglia
PLANA:0000062esophagus
PLANA:0000081pharynx pouch
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000421tail
PLANA:0003116parenchymal cell
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR027008Teashirt_fam
IPR026807Tio/Tsh
IPR007087Znf_C2H2
IPR011528NERD
IPR015880Znf_C2H2-like
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0010468regulation of gene expression
GO:0048730epidermis morphogenesis
GO:0048749compound eye development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 1034..1054
e-value: 48.0
score: 7.2
coord: 441..463
e-value: 18.0
score: 11.0
coord: 497..521
e-value: 0.44
score: 19.6
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 499..521
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 479..528
e-value: 9.0E-14
score: 53.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 341..403
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 729..766
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 729..753
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 630..655
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 811..835
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 341..409
IPR027008Teashirt familyPANTHERPTHR12487TEASHIRT-RELATEDcoord: 477..527
IPR026807Protein tiptop/teashirtPANTHERPTHR12487:SF7PROTEIN TEASHIRT-RELATEDcoord: 477..527