fos-1

Overview
Namefos-1 (AFJ24714.1)
Smed IDSMED30013808
Length (bp)1713
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of fos-1 (SMED30013808) t-SNE clustered cells

Violin plots show distribution of expression levels for fos-1 (SMED30013808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of fos-1 (SMED30013808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for fos-1 (SMED30013808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013808SMESG000003328.1 dd_Smed_v4_2789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013808SMESG000003328.1 dd_Smed_v4_2789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013808SMESG000003328.1 dd_Smed_v4_2789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013808SMESG000003328.1 dd_Smed_v4_2789_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of fos-1 vs. TrEMBL
Match: I1ZI60 (Fos-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 321/321 (100.00%), Postives = 321/321 (100.00%), Query Frame = 1
Query:  211 MPESXXXXXXXXXDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH 1173
            MPESKNNNKENNNDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDRRAKRRERNRIAAAKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH
Sbjct:    1 MPESKNNNKENNNDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDRRAKRRERNRIAAAKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH 321          
BLAST of fos-1 vs. TrEMBL
Match: T1DBN6 (Fos-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.567e-94
Identity = 200/376 (53.19%), Postives = 260/376 (69.15%), Query Frame = 1
Query:   94 MNSTSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYMPES--XXXXXXXXXDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHF-----------NTTNKQFVPHNCNYPT---TDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSE-TSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNS 1170
            M +  TIISEKQ EHLLS LSP KI ALEKTLK+YQSK   +     +N + NND DE ++ +KSEPV+ TKPFLN+H+TKNRGLTYENGRRNLK+E V+ EE +RRAKRRERNRIAA KCRERRQ Q+DELQ QV++LRSTE  L STLK L  EE EL+ KLS+HNC+I+E+NNGE+S  + N+F           ++ N  +   + N P+    D+ Y    V  SS+S  RP SLPV C N + +        + SLD+ I++DD+LTPLLSPD++T+LK  +KT+ TPTTP RT+D   ++K   +++S   +AFSW++S+VDQLSM C E +SN  YL+TP VD  FY ++SY    N+     M+WNS
Sbjct:    1 MTTNQTIISEKQLEHLLSTLSPTKIAALEKTLKTYQSKCHSDEVISVSNDKENNDFDE-NVTIKSEPVSTTKPFLNNHKTKNRGLTYENGRRNLKSEPVTAEEKERRAKRRERNRIAAQKCRERRQQQIDELQLQVDVLRSTEQTLYSTLKDLSDEENELKMKLSDHNCLISETNNGELSFTLNNNFQPQCGQSTQGRSSDNMLYQSSHINSPSHSHADLSY--CHVDSSSYSHSRPHSLPVSCHNFTPS-------HSISLDQFISKDDALTPLLSPDSYTMLKFHIKTEETPTTPCRTVD--SSVK---QTDSRTKVAFSWSNSVVDQLSMPCLELSSNCNYLTTPVVDVPFYSSDSYGH--NDNQLQDMEWNS 359          
BLAST of fos-1 vs. TrEMBL
Match: A0A5K4F7Y4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.048e-7
Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 1
Query:  271 VVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNH 588
            +++S+PV  ++ F+        G T+ENGRR+LK E VS +E  RRAKRRERNR+AAAKCR+RRQ Q++ELQH+V+ L  T   L+S+L  L+ E   L S +  H
Sbjct:  561 IIESDPV-VSEVFM--------GKTFENGRRSLKEEPVSDDEARRRAKRRERNRVAAAKCRQRRQDQIEELQHRVDALTRTGQELRSSLHSLDLERARLESLVEEH 657          
BLAST of fos-1 vs. TrEMBL
Match: A0A095AU41 (BZIP domain-containing protein OS=Schistosoma haematobium OX=6185 GN=MS3_06370 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 4.086e-7
Identity = 48/84 (57.14%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  337 GLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNH 588
            G T+ENGRR+LK E VS +E  RRAKRRERNR+AAAKCR+RRQ Q++ELQH+V+ L  T   L+S+L  L+ E   L S +  H
Sbjct:  575 GKTFENGRRSLKEEPVSDDEARRRAKRRERNRVAAAKCRQRRQDQIEELQHRVDALTRTGQELRSSLHSLDLERARLESLVEEH 658          
BLAST of fos-1 vs. TrEMBL
Match: G4LXW5 (Fos transcription factor-related OS=Schistosoma mansoni OX=6183 GN=Smp_170130 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.375e-7
Identity = 52/106 (49.06%), Postives = 72/106 (67.92%), Query Frame = 1
Query:  271 VVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNH 588
            +++S+PV  ++ F+        G T+ENGRR+LK E VS +E  RRAKRRERNR+AAAKCR+RRQ Q++ELQH+V+ L  T   L+S+L  L+ E   L S +  H
Sbjct:  345 IIESDPV-VSEVFM--------GKTFENGRRSLKEEPVSDDEARRRAKRRERNRVAAAKCRQRRQDQIEELQHRVDALTRTGQELRSSLHSLDLERARLESLVEEH 441          
BLAST of fos-1 vs. Planmine SMEST
Match: SMESG000003328.1 (SMESG000003328.1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 360/360 (100.00%), Postives = 360/360 (100.00%), Query Frame = 1
Query:   94 MNSTSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYMPESXXXXXXXXXDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH 1173
            MNSTSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYMPESKNNNKENNNDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDRRAKRRERNRIAAAKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH
Sbjct:    1 MNSTSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYMPESKNNNKENNNDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDRRAKRRERNRIAAAKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYPTTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRIIARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESIDNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQTRNSMDWNSH 360          
BLAST of fos-1 vs. Planmine SMEST
Match: SMESG000057821.1 (SMESG000057821.1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.726e-12
Identity = 68/186 (36.56%), Postives = 107/186 (57.53%), Query Frame = 1
Query:  103 TSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYM-----------PESXXXXXXXXXDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVEEMDXXXXXXXXXXXXXXKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQLEAEEVELRSKLSNHNCVITE---SNNG 618
            T+   +E +  + + +L P+ I +LE+ LKS +  +             E KN+ KE +   +++D+   S  ++ T   ++       G TYENGRRNLK E VS EE  RRAKRRERNR+AAAKCR+RRQ +++ LQ +V  L+     L S ++   +E+++L + +++H C + E   SNNG
Sbjct:    2 TNKAFTEGELRNWVLSLPPDSIKSLEEALKSIRDNHFNSIECNASNSSREEKNSIKEKSEIREDIDVFPPSRTISPTSSNISIQSRNKFGKTYENGRRNLKGEEVSQEEATRRAKRRERNRLAAAKCRKRRQDKIETLQERVSKLKEELDMLNSNIEFNSSEQLKLNTIIASHKCNLQENHNSNNG 187          
The following BLAST results are available for this feature:
BLAST of fos-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI600.000e+0100.00Fos-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
T1DBN61.567e-9453.19Fos-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A5K4F7Y43.048e-749.06Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A095AU414.086e-757.14BZIP domain-containing protein OS=Schistosoma haem... [more]
G4LXW54.375e-749.06Fos transcription factor-related OS=Schistosoma ma... [more]
back to top
BLAST of fos-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of fos-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000003328.10.000e+0100.00SMESG000003328.1[more]
SMESG000057821.13.726e-1236.56SMESG000057821.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013808
GenBankAFJ24714.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013808 ID=SMED30013808|Name=fos-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1713bp
AAATTTAGTATCAAAACTACTTTAAATTGATAAGTAGTTGTTCGTTGTAA
TCATTGTGTCAATTTTCAGTATTTTTTGCTTATACGAAAAATTATGAATT
CAACTTCAACGATTATTTCAGAAAAGCAATGGGAACACCTTCTGTCGAAT
TTATCACCGAATAAAATCGTGGCTTTGGAGAAAACATTAAAATCTTATCA
AAGCAAATATATGCCAGAGTCGAAGAACAACAATAAAGAAAACAACAACG
ATATGGACGAGCTAGATATTGTTGTCAAATCTGAACCTGTAACTGCAACT
AAGCCTTTTCTCAATAGTCATCGTACGAAAAACCGTGGATTGACCTATGA
AAATGGTAGACGAAATTTAAAAGCAGAACGAGTAAGTGTGGAAGAAATGG
ACAGGCGAGCTAAACGCCGTGAACGCAATCGGATTGCTGCTGCAAAATGT
CGTGAACGACGCCAATTTCAGTTAGATGAATTGCAGCATCAAGTCGAAAT
GTTGCGTTCTACAGAATTTAATTTACAATCGACACTCAAACAACTCGAAG
CGGAAGAAGTGGAATTGCGATCGAAATTATCCAATCATAACTGCGTCATC
ACAGAGTCTAACAATGGTGAAATTTCTATATTGATTCCAAACCATTTTAA
TACAACAAATAAACAATTTGTGCCTCACAACTGTAATTATCCTACCACAG
ATATTGTCTATGAAGCCACCCCGGTAGTTGTTTCATCCCACTCAATTTGT
CGTCCTCGCAGTCTTCCAGTACCTTGTCAAAATTGTTCCAATGCAACAAC
AGATTCTTTCTTTGATAAAACTCCTTCATTGGATCGAATCATTGCGAGGG
ACGATTCATTAACTCCTTTGTTAAGTCCAGATACTTTCACTTTATTGAAA
GGTCAATTAAAGACTGACAACACTCCGACAACTCCAATCAGAACGATTGA
TCATAAACCGAACATCAAAGTGAACGTTAAATCAGAATCAATTGATAATA
TGGCATTTTCTTGGAATCACTCAATCGTAGATCAACTGTCGATGTCGTGT
TCAGAAACCTCAAACACGCAGTATCTCTCTACTCCAACAGTCGACGCCTC
GTTTTATGGAAACGAATCGTATTCCTCTCAATTAAACAATCAGACTCGCA
ACTCAATGGACTGGAACTCCCATTAAATTTTGGCATTGGTTTGTATTCTA
TAATGACCTTGAACGTTCGTACTTCTGTTCACATTGAAAAATAAAAATCG
ATTTTTGATTGATGCATACAGATTTCTAAAAATCGTTCTGAGATTTCTAC
TGTTCCTGATATTGAATGAACACACAAACGCATTGAAGCACACATTCATG
AAATGCAGGTAACCTGTGTGTAATTTGGAAGGCTGCGTGTGCGTGTGTGT
GCGCGCGGCGTGTGTACAGAGAAATTCGTGGATTGAATTGGAAAAAACCG
ATTTTTCAGCTCATGCATTTTTGCAATGAACAATATATTTTTATGACTAA
ATGAAGTTTTAGGACTGCTTTTTTAATTTTGTATTAAATTTATGTATATC
AATCAATCCGATCTGGATCATTTATATTGATTTTTATTTTCTGTTTAAAT
TTTTTTTTTCATTTGTAATATCAATCGGATGTGAATTATGTTTATAGATA
ATATTTATTTTGTCATCAGCAAGTTTTGTTTTAATAAGATAATATATTTG
TTAATAATTAAAA
back to top

protein sequence of SMED30013808-orf-1

>SMED30013808-orf-1 ID=SMED30013808-orf-1|Name=SMED30013808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=361bp
MNSTSTIISEKQWEHLLSNLSPNKIVALEKTLKSYQSKYMPESKNNNKEN
NNDMDELDIVVKSEPVTATKPFLNSHRTKNRGLTYENGRRNLKAERVSVE
EMDRRAKRRERNRIAAAKCRERRQFQLDELQHQVEMLRSTEFNLQSTLKQ
LEAEEVELRSKLSNHNCVITESNNGEISILIPNHFNTTNKQFVPHNCNYP
TTDIVYEATPVVVSSHSICRPRSLPVPCQNCSNATTDSFFDKTPSLDRII
ARDDSLTPLLSPDTFTLLKGQLKTDNTPTTPIRTIDHKPNIKVNVKSESI
DNMAFSWNHSIVDQLSMSCSETSNTQYLSTPTVDASFYGNESYSSQLNNQ
TRNSMDWNSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000837AP-1
IPR004827bZIP
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 134..168
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 103..158
e-value: 1.8E-11
score: 46.0
NoneNo IPR availableCDDcd14699bZIP_Fos_likecoord: 114..162
e-value: 3.53831E-16
score: 69.9815
NoneNo IPR availableCDDcd09848M28_TfRcoord: 245..341
e-value: 0.00977564
score: 35.0425
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 104..162
IPR000837AP-1 transcription factorPRINTSPR00042LEUZIPPRFOScoord: 112..128
score: 57.84
coord: 130..151
score: 28.22
coord: 95..111
score: 52.21
IPR000837AP-1 transcription factorPANTHERPTHR23351FOS TRANSCRIPTION FACTOR-RELATEDcoord: 34..262
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 100..164
e-value: 8.4E-10
score: 48.6
IPR004827Basic-leucine zipper domainPFAMPF00170bZIP_1coord: 101..162
e-value: 8.2E-10
score: 38.6
IPR004827Basic-leucine zipper domainPROSITEPS00036BZIP_BASICcoord: 107..122
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 102..165
score: 11.852