Aromatic amino acid decarboxylase

Overview
NameAromatic amino acid decarboxylase
Smed IDSMED30013807
Length (bp)1690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aromatic amino acid decarboxylase (SMED30013807) t-SNE clustered cells

Violin plots show distribution of expression levels for Aromatic amino acid decarboxylase (SMED30013807) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aromatic amino acid decarboxylase (SMED30013807) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aromatic amino acid decarboxylase (SMED30013807) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013807

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013807h1SMcG0013766 SmedASXL_011120SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30013807h1SMcG0013766 dd_Smed_v4_21108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013807h1SMcG0013766 dd_Smed_v4_21108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013807h1SMcG0013766 dd_Smed_v4_21108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013807h1SMcG0013766 dd_Smed_v6_21108_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013807h1SMcG0013766 Contig51335uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30013807h1SMcG0013766 Contig51335newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 417.542 bits (1072), Expect = 9.086e-141
Identity = 201/476 (42.23%), Postives = 292/476 (61.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD++ +Y + I   +V P VEPGYL+ L+P++AP+    F++I+  V+  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LP+ FL+  +  GGG I  SASEATL+ L+  R ++I + +  +P L+   I++K+  Y S QAHSSVERA +I  +K K I +D N ++    L   +++DK   LIP  +V + G+T+ C+FDNL ++G IC +  +  HVDAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V   +E I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDK--FVLRFAICSRTVESAHVQRAWEHIKELAADV 474          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 417.542 bits (1072), Expect = 9.086e-141
Identity = 201/476 (42.23%), Postives = 292/476 (61.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD++ +Y + I   +V P VEPGYL+ L+P++AP+    F++I+  V+  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LP+ FL+  +  GGG I  SASEATL+ L+  R ++I + +  +P L+   I++K+  Y S QAHSSVERA +I  +K K I +D N ++    L   +++DK   LIP  +V + G+T+ C+FDNL ++G IC +  +  HVDAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V   +E I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDK--FVLRFAICSRTVESAHVQRAWEHIKELAADV 474          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Match: HDC (histidine decarboxylase [Source:HGNC Symbol;Acc:HGNC:4855])

HSP 1 Score: 399.438 bits (1025), Expect = 2.325e-131
Identity = 192/479 (40.08%), Postives = 285/479 (59.50%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL*NLH 1627
            ME E++R + +E+VD++  Y   + +  V P V+PGYL+  LP SAPE+   +D I   ++  I+PG+ HW  P+ +A+YP   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL K + LPE FL    S  GGG + S+ SE+TL+ L+  R   I + K   P+  +  +  ++  Y S QAHSSVE+A +ISL+K K +  D+N S+  + L + I++DK+  L+P+ V  + G+T +CAFD L ++G IC + G+  H+DAAYAG+  +CPEF+   KG+EY +SF FNP K +  HFDC+  W  +++      S+NP+YL H   G  T+  HWQIPL RRFR++KLWFV+  FG+KNLQ  +R   ++A  F   +     FE+  +   GLV F++K  N  T  +  E+     +FL  +  + K    +RF V   F T  D+L  +  I  AA  + + H
Sbjct:    2 MEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGDIERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESCLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLTENVLKEIAKAGRLFLIPATIQDK--LIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQH 478          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 358.992 bits (920), Expect = 1.477e-118
Identity = 181/476 (38.03%), Postives = 264/476 (55.46%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD++ +Y + I   +V P VEPGYL+ L+P++AP+    F++I+  V+  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LP+ FL+  +  GGG I  SASEATL+ L+  R ++I + +  +P L+   I++K+  Y S Q                                                +V + G+T+ C+FDNL ++G IC +  +  HVDAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V   +E I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQ------------------------------------------------MVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDK--FVLRFAICSRTVESAHVQRAWEHIKELAADV 426          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Match: DDC (dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:2719])

HSP 1 Score: 348.206 bits (892), Expect = 2.459e-114
Identity = 183/476 (38.45%), Postives = 266/476 (55.88%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD++ +Y + I   +V P VEPGYL+ L+P++AP+    F++I+  V+  I+PG                                        SP CTELE +++DWL K ++LP+ FL+  +  GGG I  SASEATL+ L+  R ++I + +  +P L+   I++K+  Y S QAHSSVERA +I  +K K I +D N ++    L   +++DK   LIP  +V + G+T+ C+FDNL ++G IC +  +  HVDAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V   +E I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPG--------------------------------------AASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDK--FVLRFAICSRTVESAHVQRAWEHIKELAADV 436          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 419.083 bits (1076), Expect = 1.747e-139
Identity = 206/476 (43.28%), Postives = 297/476 (62.39%), Query Frame = 2
Query:  197 AMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
             M  ++FR   KE VD++VDY +NI +  V+P++EPGYL+ L+PS AP     F+ +M+  +  I+PG+THW HP F+A++P   SFPS +  MLSD   CVG +W   P  TELE+++LDW  K + LP  FL  +E+G  GG I SSASE   + L+  R E++K+ +Q  P + +G +L K+  Y SK+AHSSVE+AC+I ++K +I+ TD    +  D L   I++D+   LIP  V T+ G+TS C+FD L +IG IC++  +  HVDAAY+GS  ICPEF+ L  G+EY  SF  NP+K L  +FDCS +W  +R     AL ++PLYL H +   + + RHW IPL RRFR+LKLWFV+ M+G+  LQ+ IR+HV+LA      +     FE+V+ V  GLVCF+MK  +E  + L   L     I +  +    +  F +RF VC + AT+KD+   +E I  A  ++
Sbjct:   76 GMTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLGDR--FVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 419.083 bits (1076), Expect = 1.747e-139
Identity = 206/476 (43.28%), Postives = 297/476 (62.39%), Query Frame = 2
Query:  197 AMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
             M  ++FR   KE VD++VDY +NI +  V+P++EPGYL+ L+PS AP     F+ +M+  +  I+PG+THW HP F+A++P   SFPS +  MLSD   CVG +W   P  TELE+++LDW  K + LP  FL  +E+G  GG I SSASE   + L+  R E++K+ +Q  P + +G +L K+  Y SK+AHSSVE+AC+I ++K +I+ TD    +  D L   I++D+   LIP  V T+ G+TS C+FD L +IG IC++  +  HVDAAY+GS  ICPEF+ L  G+EY  SF  NP+K L  +FDCS +W  +R     AL ++PLYL H +   + + RHW IPL RRFR+LKLWFV+ M+G+  LQ+ IR+HV+LA      +     FE+V+ V  GLVCF+MK  +E  + L   L     I +  +    +  F +RF VC + AT+KD+   +E I  A  ++
Sbjct:   76 GMTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLGDR--FVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Match: tdc-1 (Tyrosine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:Q95ZS2])

HSP 1 Score: 419.468 bits (1077), Expect = 5.444e-139
Identity = 206/476 (43.28%), Postives = 297/476 (62.39%), Query Frame = 2
Query:  197 AMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
             M  ++FR   KE VD++VDY +NI +  V+P++EPGYL+ L+PS AP     F+ +M+  +  I+PG+THW HP F+A++P   SFPS +  MLSD   CVG +W   P  TELE+++LDW  K + LP  FL  +E+G  GG I SSASE   + L+  R E++K+ +Q  P + +G +L K+  Y SK+AHSSVE+AC+I ++K +I+ TD    +  D L   I++D+   LIP  V T+ G+TS C+FD L +IG IC++  +  HVDAAY+GS  ICPEF+ L  G+EY  SF  NP+K L  +FDCS +W  +R     AL ++PLYL H +   + + RHW IPL RRFR+LKLWFV+ M+G+  LQ+ IR+HV+LA      +     FE+V+ V  GLVCF+MK  +E  + L   L     I +  +    +  F +RF VC + AT+KD+   +E I  A  ++
Sbjct:   76 GMTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLGDR--FVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Match: bas-1 (Biogenic Amine Synthesis related [Source:UniProtKB/TrEMBL;Acc:O45137])

HSP 1 Score: 324.324 bits (830), Expect = 1.914e-104
Identity = 171/502 (34.06%), Postives = 273/502 (54.38%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGG-GTILSSASEATLMVLIIERNEMIKKTKQE------------------------------------NPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKII----GTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMK-SGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVL 1576
            M+ ++ R + K+++DFV DY+  I   + LP V+PGY+  L+P+ AP    ++ +I   ++N ++ G THWHHP+F+A++PTA S+ S +  +LS G A +G  W+  P  TELE+  LDW+V  M LPE F ++    G G I S+AS++T++ ++  R   +++ K E                                     P   D  + ++  +Y S QAHSSVE+  ++S ++ + +    G   N  +  + L   IK+D+    IP M + + G+T  C  D + ++G +C + G+  HVDAAYAG+  +C EF+YL +GME+V+SF FN HK    +FDCS +W  N        +++ +YL+H+++ T ++ RH Q+ LGRRFR+LK+WFVL   G+  ++E +R+   LA  F+  I E+  FE       GL CF++K S N    +L N +  D  I L  S       +FLR  VC    T  D++
Sbjct:    1 MDSQKLRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIFDDLENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLDWVVDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSETGVGKTLKNIFDRVKVNKVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSVEKGAMLSAVRMRKLKATRGFLGNYGVSRETLQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSPMWFKNGTHVSRYFNVDAVYLAHEYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDKIREYLRRTELLAAEFSKLILENGKFEHFVPQHLGLTCFRLKNSTNADNEKLCNAINDDRRIHLVPSTVHGT--YFLRMVVCSQLTTLDDII 500          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Match: bas-1 (Biogenic Amine Synthesis related [Source:UniProtKB/TrEMBL;Acc:O45137])

HSP 1 Score: 320.472 bits (820), Expect = 7.652e-103
Identity = 170/511 (33.27%), Postives = 272/511 (53.23%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGG-GTILSSASEATLMVLIIERNEMIKKTKQE---------------------------------------------NPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDE----NESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMK-SGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVL 1576
            M+ ++ R + K+++DFV DY+  I   + LP V+PGY+  L+P+ AP    ++ +I   ++N ++ G THWHHP+F+A++PTA S+ S +  +LS G A +G  W+  P  TELE+  LDW+V  M LPE F ++    G G I S+AS++T++ ++  R   +++ K E                                              P   D  + ++  +Y S QAHSSVE+  ++S ++ + +        N  +  + L   IK+D+    IP M + + G+T  C  D + ++G +C + G+  HVDAAYAG+  +C EF+YL +GME+V+SF FN HK    +FDCS +W  N        +++ +YL+H+++ T ++ RH Q+ LGRRFR+LK+WFVL   G+  ++E +R+   LA  F+  I E+  FE       GL CF++K S N    +L N +  D  I L  S       +FLR  VC    T  D++
Sbjct:    1 MDSQKLRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIFDDLENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLDWVVDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSETGVGKTLKNIFDRVKVNKTLVARASVTVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSVEKGAMLSAVRMRKLKATRGFLGNYGVSRETLQNAIKEDRARGYIPFMFLATVGTTCSCGVDQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDCSPMWFKNGTHVSRYFNVDAVYLAHEYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDKIREYLRRTELLAAEFSKLILENGKFEHFVPQHLGLTCFRLKNSTNADNEKLCNAINDDRRIHLVPSTVHGT--YFLRMVVCSQLTTLDDII 509          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Match: Tdc2 (gene:FBgn0050446 transcript:FBtr0086142)

HSP 1 Score: 415.231 bits (1066), Expect = 4.407e-138
Identity = 202/465 (43.44%), Postives = 298/465 (64.09%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSE--SGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIG-QICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSG---NEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            M+  +FR +  E+V+++ +Y + + +  V PSVEPGYL+ LLP  AP+   ++D+IM+ V++ I+PG+THW HP F+A++P   SFPS LG ML DG  C+G +W  SP CTELE +VLDWL KA+ LP+ FL+  E  +GGG I +SASE  L+ ++  R + +K+ K ++P + +G +L K+  Y SK+AHS VE+A +I  +K +I+  D++ S+    +   +++D+   L+P  V T+ G+T  CAFDNL +IG Q+ R  GV  HVDAAYAG+  ICPE + L KG+EY +SF  NP+K L T+FDCS LW  +R    SAL ++PLYL H +     + RHW +PL RRFR+LKLWFVL  +G+  LQ  IR H+KLA  F + + + + FE+ ++V  GLVCF++K     NEK   + NE    H +  S+      + + +RF      AT +D+
Sbjct:    1 MDSTEFRKRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEPEDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWGVPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEICNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPASVG-----DRYIIRFCAVAQNATAEDI 460          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0081167)

HSP 1 Score: 405.216 bits (1040), Expect = 7.353e-136
Identity = 197/475 (41.47%), Postives = 303/475 (63.79%), Query Frame = 2
Query:  188 IKIAMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTIL-SSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            + I ME  +F+  AK +VDF+ +Y +NI +  VLP V+PGYL+ L+P +APE   ++ ++M+ ++  I+PG+THWH P F+A++PTA S+P+ +  MLS   AC+G  W  SP CTELE++++DWL K ++LP  FL+ S   GG ++  +ASE+TL+ L+  + + +K+ K+ +P   +  IL K+  Y S QAHSSVERA ++  +K + + + EN  +    L + I++D  + LIP   V + G+T+ CAFD L + G +  +  +  HVDAAYAGS  ICPE+++L KG+E  +SF FNPHK +  +FDCS +W  +     +A +++PLYL HD +G+  + RHWQIPLGRRFRALKLWFVL ++G++NLQ  IR+H   A  F D       FEL   ++ GLVCF++K  NE+   L   +     I L  +    K+ +FLR  +C  F   +D+  ++++++ AA
Sbjct:   32 VSIDMEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS-ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKI--KDVYFLRMAICSRFTQSEDMEYSWKEVSAAA 503          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0290291)

HSP 1 Score: 402.905 bits (1034), Expect = 1.602e-135
Identity = 196/471 (41.61%), Postives = 302/471 (64.12%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTIL-SSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            ME  +F+  AK +VDF+ +Y +NI +  VLP V+PGYL+ L+P +APE   ++ ++M+ ++  I+PG+THWH P F+A++PTA S+P+ +  MLS   AC+G  W  SP CTELE++++DWL K ++LP  FL+ S   GG ++  +ASE+TL+ L+  + + +K+ K+ +P   +  IL K+  Y S QAHSSVERA ++  +K + + + EN  +    L + I++D  + LIP   V + G+T+ CAFD L + G +  +  +  HVDAAYAGS  ICPE+++L KG+E  +SF FNPHK +  +FDCS +W  +     +A +++PLYL HD +G+  + RHWQIPLGRRFRALKLWFVL ++G++NLQ  IR+H   A  F D       FEL   ++ GLVCF++K  NE+   L   +     I L  +  + K+ +FLR  +C  F   +D+  ++++++ AA
Sbjct:    1 MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS-ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPA--KIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAA 468          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Match: Ddc (gene:FBgn0000422 transcript:FBtr0081166)

HSP 1 Score: 402.905 bits (1034), Expect = 1.602e-135
Identity = 196/471 (41.61%), Postives = 302/471 (64.12%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTIL-SSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            ME  +F+  AK +VDF+ +Y +NI +  VLP V+PGYL+ L+P +APE   ++ ++M+ ++  I+PG+THWH P F+A++PTA S+P+ +  MLS   AC+G  W  SP CTELE++++DWL K ++LP  FL+ S   GG ++  +ASE+TL+ L+  + + +K+ K+ +P   +  IL K+  Y S QAHSSVERA ++  +K + + + EN  +    L + I++D  + LIP   V + G+T+ CAFD L + G +  +  +  HVDAAYAGS  ICPE+++L KG+E  +SF FNPHK +  +FDCS +W  +     +A +++PLYL HD +G+  + RHWQIPLGRRFRALKLWFVL ++G++NLQ  IR+H   A  F D       FEL   ++ GLVCF++K  NE+   L   +     I L  +  + K+ +FLR  +C  F   +D+  ++++++ AA
Sbjct:    1 MEAPEFKDFAKTMVDFIAEYLENIRERRVLPEVKPGYLKPLIPDAAPEKPEKWQDVMQDIERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGKGGGVIQGTASESTLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQS-ENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDPLYLKHDMQGSAPDYRHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPA--KIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAA 468          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Match: Tdc1 (gene:FBgn0259977 transcript:FBtr0086143)

HSP 1 Score: 388.267 bits (996), Expect = 2.734e-128
Identity = 193/469 (41.15%), Postives = 296/469 (63.11%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTS--ESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQV-GVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKI 1594
            M+ E+FR   KE++D++  Y  NI + +V P+++PGYL+KLLP+ AP++   F ++++  +  I+PG+ HW+HP F+A++P+  SFPS LG MLS     +G +W   P   ELE +V++W  KA+ LP+ F+S +   +GGG +  SASE  L+ LI  R   I + K +  ++ D   L  +  Y S++AHSSVE+A  ++L+K +II  DE+  +  D L + I+ D    L P  VV + G+T  CAFD++ +IG++CRQV  +  HVD AYAG+  I PE +  + G+EY +SF  NP+K+L T+FD S LW  +  +  SAL++NPLYL H+   T  + RH+ IPL RRFRALKLWFV   +G++ LQE IR H+ LA  F   + + E FE+ + V  GLVCF+M++G+E    L  +  ++HS  + ++  +    + +RF V  + ATEKD+LE + +I
Sbjct:    1 MDVEEFRKYGKEVIDYICQYGTNIEERDVAPTLDPGYLKKLLPADAPQSPEPFKDVLEDFEQKIMPGVVHWNHPKFFAYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETIVMNWYAKALGLPKAFVSDAPGSTGGGALQGSASECVLVSLITARARAISELKGQT-SVHDSVFLPSLIAYASREAHSSVEKATKMALVKLRIIDADEHGRMRVDLLRQAIQNDVNAGLTPFFVVATVGTTGGCAFDDITEIGKVCRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTNPNKLLLTNFDASALWVRDVMNLKSALNVNPLYLRHEHL-TGVDYRHYGIPLSRRFRALKLWFVFRTYGIRGLQEYIRNHMALAKKFEMLVRKDERFEVRNDVHLGLVCFRMRTGDEPNHMLLAQ--INHSGKMHMTPAKFNGRYVIRFCVTYEHATEKDILEAWTQI 465          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Match: ddc (dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-040426-2656])

HSP 1 Score: 412.149 bits (1058), Expect = 6.445e-139
Identity = 210/476 (44.12%), Postives = 294/476 (61.76%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+  +FR + +E+VD+V DY +NI + +V P VEPGYL+ L+P  APE    +++++K ++  I+PG+THWH P FYA++PTA S+P+ L  +L     C+G +W  SP CTELE ++LDWL K ++LPE FL+ T   GGG I S+ASEATL+ L+  R+++++  + ++P+ S+ +I+ K+  Y S QAHSSVERA +I  ++ K I TD   S+  D L R +K+DK   LIP     + G+T+ CAFD + ++G IC    +  H+DAAYAGS  ICPEF+ L  G+E+ +SF FNPHK L  +FDCS +W   R     A  + PLYL HD +  G  T+ RHWQIPLGRRFR+LK+WFV  M+GLK LQ  IR+HV LA  F   +   + FE+   V  GLVCF++K  NE +  L   +     I L          F LRF VC      + V E +  I   A  L
Sbjct:    1 MDAAEFRRRGREMVDYVADYIENIEKRQVYPDVEPGYLRSLIPEEAPEEPESYEDVVKDIERVIMPGVTHWHSPYFYAYFPTAHSYPAMLADILCGAIGCIGFSWAASPACTELETVMLDWLGKMLKLPEDFLAGTKGKGGGVIQSTASEATLITLLAARSKIVRLIQADHPDRSETDIISKLVAYSSDQAHSSVERAGLIGGVRMKKIPTDSKFSVRGDALERILKEDKAAGLIPFFFCATLGTTASCAFDCITELGPICNAEKMWMHIDAAYAGSAFICPEFRPLLNGIEFADSFNFNPHKWLLINFDCSAMWVKKRADIIGAFKMEPLYLKHDHQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLKALQAYIRKHVGLAKEFEAFVRADQRFEISADVVMGLVCFRLKGPNELSENLLKRINSARKIHLVPC--HLAGLFVLRFAVCARATESRHVQEAWCHIRQLASEL 474          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 395.586 bits (1015), Expect = 2.214e-132
Identity = 194/474 (40.93%), Postives = 292/474 (61.60%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNL-SDGEILD-KMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            M+ +++ ++ KE+V+++  Y   I +  V+P V+PG+++ LLPSSAP    ++  IM+ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ VLDWL KA+ LP+ +L      +GGG + S+ SE TL+ L+  R + I + K E  +  +D  +L+ ++  Y S QAHSSVE+A +ISL+K + + TD   S+  + L R +++D+   LIP+MV  + GST +C+FD L ++G +C + G+  HVDAAYAGS L+CPE +Y   G+++ +SF FNP K +  HFDC+  W  N+       +++PLYL HD     T+  HWQIPL RRFR+LKLWFV+  FGLK LQE IR  V++A +F   +     F++  +   GLV F +++GN  T+EL  +L     +FL  +     N   LRF V     TE+D+   +  I  AA
Sbjct:    1 MQPQEYMLRGKEMVEYIHQYLTGIRERRVVPDVQPGFMRPLLPSSAPYEPEDWSTIMQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVLDWLCKALGLPDHYLHHHPQSTGGGILQSTVSECTLVALLAARKDRILQMKSEATHTDTDESVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLQTDAVFSLRGETLQRAVEEDRRSGLIPVMVCATLGSTGVCSFDRLDELGPVCVREGLWLHVDAAYAGSALLCPELRYFLDGIQFADSFVFNPSKWMLVHFDCTAFWVKNKMKLQQTFTVDPLYLRHD-NSNATDFMHWQIPLSRRFRSLKLWFVIRSFGLKKLQEHIRHGVEMAKLFESLVRNDTHFQIPAQRHLGLVVFCLRAGNAATQELLRKLTRSGRMFLIPAAV--GNQLILRFSVTSQLTTEQDIRRDWSLIQQAA 471          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 370.163 bits (949), Expect = 5.802e-121
Identity = 188/474 (39.66%), Postives = 282/474 (59.49%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFL--STSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNL-SDGEILD-KMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            M+ +++ ++ KE+V+++  Y   I +  V+P V+PG+++ LLPSSAP    ++  IM+ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ VLDWL KA+ LP+ +L      +GGG + S+ SE TL+ L+  R + I + K E  +  +D  +L+ ++  Y S QAHSSVE+A +ISL+K + + TD   S+  + L R +++D+   LIP+MV  + GST +              + G+  HVDAAYAGS L+CPE +Y   G+++ +SF FNP K +  HFDC+  W  N+       +++PLYL HD     T+  HWQIPL RRFR+LKLWFV+  FGLK LQE IR  V++A +F   +     F++  +   GLV F +++GN  T+EL  +L     +FL  +     N   LRF V     TE+D+   +  I  AA
Sbjct:    1 MQPQEYMLRGKEMVEYIHQYLTGIRERRVVPDVQPGFMRPLLPSSAPYEPEDWSTIMQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVLDWLCKALGLPDHYLHHHPQSTGGGILQSTVSECTLVALLAARKDRILQMKSEATHTDTDESVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLQTDAVFSLRGETLQRAVEEDRRSGLIPVMVCATLGSTGV--------------REGLWLHVDAAYAGSALLCPELRYFLDGIQFADSFVFNPSKWMLVHFDCTAFWVKNKMKLQQTFTVDPLYLRHD-NSNATDFMHWQIPLSRRFRSLKLWFVIRSFGLKKLQEHIRHGVEMAKLFESLVRNDTHFQIPAQRHLGLVVFCLRAGNAATQELLRKLTRSGRMFLIPAAV--GNQLILRFSVTSQLTTEQDIRRDWSLIQQAA 457          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Match: csad (cysteine sulfinic acid decarboxylase [Source:ZFIN;Acc:ZDB-GENE-041114-36])

HSP 1 Score: 115.546 bits (288), Expect = 5.147e-27
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 2
Query:  416 HPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACI---ISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSV-LWTDNRHSAGSALSINPLYL--SHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCF 1423
            HP F+        + +  G ++++        ++ +PV   +E  V+  L   +   E        G G      S + +  + + R     + K +    +      +M I+ S+Q+H SV++      I      I+  DE+ S+  ++L  +I + K  + +P  V  + G+T   AFD L  I  IC + G+  HVDAA+ GS L   + ++L  G+E  NS  +NPHK+L T   CSV L+ D  +      S    YL     F  T+ +     I  GR+   LKLW +    G   L + + +   L     +++ + E F+LV +  F  VCF
Sbjct:   75 HPRFFNQLFAGVDYHALTGRLITETLNTSQYTYEVAPVFVLMEEEVISKLRSLVGWSE--------GDGIFCPGGSMSNMYAINVARYWAFPQVKTKGLWAAP-----RMAIFTSQQSHYSVKKGAAFLGIGTENVFIVQVDESGSMIPEDLEAKIVQAKSQDAVPFFVNATAGTTVQGAFDPLKRIADICERNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLTGLQCSVILFRDTTNLLMHCHSAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMWKAIGASGLSQRVDKAFALTRYLVEEMEKRENFQLVCKGPFVNVCF 403          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Match: csad (cysteine sulfinic acid decarboxylase [Source:ZFIN;Acc:ZDB-GENE-041114-36])

HSP 1 Score: 114.775 bits (286), Expect = 1.280e-26
Identity = 89/342 (26.02%), Postives = 150/342 (43.86%), Query Frame = 2
Query:  416 HPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACI---ISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSV-LWTDNRHSAGSALSINPLYL--SHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCF 1423
            HP F+        + +  G ++++        ++ +PV   +E  V+  L   +   E        G G      S + +  + + R     + K +    +      +M I+ S+Q+H SV++      I      I+  DE+ S+  ++L  +I + K  + +P  V  + G+T   AFD L  I  IC + G+  HVDAA+ GS L   + ++L  G+E  NS  +NPHK+L T   CSV L+ D  +      S    YL     F  T+ +     I  GR+   LKLW +    G   L + + +   L     +++ + E F+LV +  F  VCF
Sbjct:  137 HPRFFNQLFAGVDYHALTGRLITETLNTSQYTYEVAPVFVLMEEEVISKLRSLVGWSE--------GDGIFCPGGSMSNMYAINVARYWAFPQVKTKGLWAAP-----RMAIFTSQQSHYSVKKGAAFLGIGTENVFIVQVDESGSMIPEDLEAKIVQAKSQDAVPFFVNATAGTTVQGAFDPLKRIADICERNGMWMHVDAAWGGSVLFSKKHRHLVAGIERANSVTWNPHKMLLTGLQCSVILFRDTTNLLMHCHSAKATYLFQQDKFYDTSLDTGDKSIQCGRKVDCLKLWLMWKAIGASGLSQRVDKAFALTRYLVEEMEKRENFQLVCKGPFVNVCF 465          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 427.557 bits (1098), Expect = 1.029e-144
Identity = 206/454 (45.37%), Postives = 291/454 (64.10%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCG 1549
            M   +FR + K++VD+V DY + I   +V P VEPGYL+ L+P SAPE    ++EI+K V+  I+PG+THWH P F+A++PT  S+P+ L  ML     C+G +W  SP CTELE ++LDWL K + LPE FL+ ++  GGG I  +ASEATLM L+  R ++ ++ + ENP L++ EI+ +M  Y S QAHSSVERA +IS ++ K I +DEN       L + +++DK + LIP+    + G+T+ CAFDNL ++G +C    +  H+DAAYAGS  ICPEF+YL KG+E+ +SF FNPHK L  +FDCS  W   R     A  ++P+YL +D +  G  T+ RHWQIPLGRRFR+LKLWFV  ++G+K LQ  IR+HV LA  F + + + + FE+   V  GLVCF++K  NE  + L  ++     I +        + F LRF VC 
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCL--GDTFVLRFAVCA 452          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 427.557 bits (1098), Expect = 1.172e-144
Identity = 206/454 (45.37%), Postives = 291/454 (64.10%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCG 1549
            M   +FR + K++VD+V DY + I   +V P VEPGYL+ L+P SAPE    ++EI+K V+  I+PG+THWH P F+A++PT  S+P+ L  ML     C+G +W  SP CTELE ++LDWL K + LPE FL+ ++  GGG I  +ASEATLM L+  R ++ ++ + ENP L++ EI+ +M  Y S QAHSSVERA +IS ++ K I +DEN       L + +++DK + LIP+    + G+T+ CAFDNL ++G +C    +  H+DAAYAGS  ICPEF+YL KG+E+ +SF FNPHK L  +FDCS  W   R     A  ++P+YL +D +  G  T+ RHWQIPLGRRFR+LKLWFV  ++G+K LQ  IR+HV LA  F + + + + FE+   V  GLVCF++K  NE  + L  ++     I +        + F LRF VC 
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCL--GDTFVLRFAVCA 452          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 427.172 bits (1097), Expect = 1.427e-144
Identity = 206/454 (45.37%), Postives = 291/454 (64.10%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCG 1549
            M   +FR + K++VD+V DY + I   +V P VEPGYL+ L+P SAPE    ++EI+K V+  I+PG+THWH P F+A++PT  S+P+ L  ML     C+G +W  SP CTELE ++LDWL K + LPE FL+ ++  GGG I  +ASEATLM L+  R ++ ++ + ENP L++ EI+ +M  Y S QAHSSVERA +IS ++ K I +DEN       L + +++DK + LIP+    + G+T+ CAFDNL ++G +C    +  H+DAAYAGS  ICPEF+YL KG+E+ +SF FNPHK L  +FDCS  W   R     A  ++P+YL +D +  G  T+ RHWQIPLGRRFR+LKLWFV  ++G+K LQ  IR+HV LA  F + + + + FE+   V  GLVCF++K  NE  + L  ++     I +        + F LRF VC 
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPVYLQYDQQESGLVTDYRHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCL--GDTFVLRFAVCA 452          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:496742])

HSP 1 Score: 411.379 bits (1056), Expect = 2.571e-138
Identity = 202/457 (44.20%), Postives = 286/457 (62.58%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTT-----ELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCG 1549
            M   +FR + K++VD+V DY + I   +V P VEPGYL+ L+P SAPE    ++EI+K V+  I+PG+THWH P F+A++PT  S+P+ L  ML     C+G +W  SP CTELE ++LDWL K + LPE FL+ ++  GGG I  +ASEATLM L+  R ++ ++ + ENP L++ EI+ +M  Y S QAHSSVERA +IS ++ K I +DEN       L + +++DK + LIP+    + G+T+ CAFDNL ++G +C    +  H+DAAYAGS  ICPEF+YL KG+E+ +SF FNPHK L  +FDCS  W   R     A  ++PLY       ++        +HWQIPLGRRFR+LKLWFV  ++G+K LQ  IR+HV LA  F + + + + FE+   V  GLVCF++K  NE  + L  ++     I +        + F LRF VC 
Sbjct:    1 MNASEFRKRGKDMVDYVADYLEQIESRQVFPDVEPGYLRPLIPDSAPEEGETYEEIIKDVERVIMPGVTHWHSPYFFAYFPTGSSYPALLADMLCGAIGCIGFSWASSPACTELETVMLDWLGKMIGLPEQFLAGNKGEGGGVIQGTASEATLMALLAARTKVTRRLQAENPKLTEAEIVSRMVAYSSDQAHSSVERAGLISGVRMKKIPSDENFVARGQALKKALEEDKAEGLIPIFFCATLGTTNSCAFDNLLELGPVCNAENIWMHIDAAYAGSAFICPEFRYLMKGIEFADSFNFNPHKWLLVNFDCSTFWVKKRSDLIGAFKMDPLYYMVCTSYSSLFFIFFNCQHWQIPLGRRFRSLKLWFVFRIYGVKGLQVHIRKHVGLAHEFLECVKKDDQFEICAPVILGLVCFRLKGSNELNKALLQKINNSKKIHIVPCCL--GDTFVLRFAVCA 455          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Match: r3hdm2 (R3H domain containing 2 [Source:Xenbase;Acc:XB-GENE-993138])

HSP 1 Score: 404.831 bits (1039), Expect = 8.484e-135
Identity = 190/479 (39.67%), Postives = 289/479 (60.33%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL*NLH 1627
            ME E++R + KE+VD++  Y   + +  V P V+PGY++ LLP SAP     ++ I + +++ I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL K + LP  FL    S  GGG + S+ SE+TL+ L+  R   I + K   P+  D ++  ++  Y S QAHSSVE+A +ISL+K + +  DEN  +  D L   +++D+++ L+P+ V  + G+T +CAFD L ++G +C +  +  H+DAAYAG+  +CPEF+ L  G++Y +SF FNP K +  HFDC+  W  +++      S+NP+YL H   G  T+  HWQIPL RRFR+LKLWFV+  FG+KNLQ  IR   +LA  F   +   ++FE+  +   GLV F++K  N  T E+  EL     ++L  +    +    +RF V   F T  D+L  +  I  +A+N+ NLH
Sbjct:    1 MEPEEYRKRGKELVDYICQYLSTVRERRVNPDVQPGYMRALLPDSAPVESESWERIFRDIEDIIMPGVVHWQSPHMHAYFPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPCHFLHHYPSSKGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDSDDSQLNSRLIAYASNQAHSSVEKAGLISLVKVRFLPVDENFCLRGDTLKAAVEEDRKNGLVPVFVCATLGTTGVCAFDYLAELGPVCAREKLWLHIDAAYAGTAFLCPEFRTLMNGVDYADSFTFNPSKWMMVHFDCTAFWVKDKYKLQQTFSVNPIYLRHANTGAATDFMHWQIPLSRRFRSLKLWFVIRSFGVKNLQAHIRHGAELAKYFESLVTSDQMFEVPAKRHLGLVVFRLKGPNVLTEEVLAELTKSGKMYLVPATINDE--LIIRFTVTSQFTTRDDILRDWNLIRQSAINITNLH 477          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 422.165 bits (1084), Expect = 1.082e-142
Identity = 207/470 (44.04%), Postives = 293/470 (62.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKIN 1597
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I+K ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R ++I++ +  +P  +   I++K+  Y S QAHSSVERA +I  +K K + +D N S+    L   +++DK   LIP  VV + G+TS C+FDNL ++G IC Q GV  H+DAAYAGS  ICPEF+YL  G+E+ +SF FNPHK L  +FDCS +W   R     A +++P+YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  NE    L   +     I L       K  F LRF VC        V   +E I+
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLRDK--FVLRFAVCARTVESAHVQLAWEHIS 468          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 422.165 bits (1084), Expect = 1.082e-142
Identity = 207/470 (44.04%), Postives = 293/470 (62.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKIN 1597
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I+K ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R ++I++ +  +P  +   I++K+  Y S QAHSSVERA +I  +K K + +D N S+    L   +++DK   LIP  VV + G+TS C+FDNL ++G IC Q GV  H+DAAYAGS  ICPEF+YL  G+E+ +SF FNPHK L  +FDCS +W   R     A +++P+YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  NE    L   +     I L       K  F LRF VC        V   +E I+
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLRDK--FVLRFAVCARTVESAHVQLAWEHIS 468          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 422.165 bits (1084), Expect = 1.082e-142
Identity = 207/470 (44.04%), Postives = 293/470 (62.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKIN 1597
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I+K ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R ++I++ +  +P  +   I++K+  Y S QAHSSVERA +I  +K K + +D N S+    L   +++DK   LIP  VV + G+TS C+FDNL ++G IC Q GV  H+DAAYAGS  ICPEF+YL  G+E+ +SF FNPHK L  +FDCS +W   R     A +++P+YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  NE    L   +     I L       K  F LRF VC        V   +E I+
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLRDK--FVLRFAVCARTVESAHVQLAWEHIS 468          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Match: Hdc (histidine decarboxylase [Source:MGI Symbol;Acc:MGI:96062])

HSP 1 Score: 392.889 bits (1008), Expect = 7.017e-129
Identity = 185/465 (39.78%), Postives = 279/465 (60.00%), Query Frame = 2
Query:  221 VQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
             + KE+VD++  Y   + + +V P+V+PGYL+  LP+SAPE    +D I   ++  I+PG+ HW  P+ +A+YP   S+PS LG ML+D   C+G  W  SP CTELE+ ++DWL K + LPE+FL    S  GGG + S+ SE+TL+ L+  R   I   K   P+ ++  +  ++  Y S QAHSSVE+A +ISL+K + +  D+N S+  + L + I++DK+  L+P+ V  + G+T +CAFD L ++G IC   G+  HVDAAYAG+  +CPE +   +G+EY +SF FNP K +  HFDC+  W  +++      S+NP+YL H   G  T+  HWQIPL RRFR++KLWFV+  FG+KNLQ  +R   ++A  F   +     FE+  +   GLV F++K  N  T  +  E+     +FL  +  + K    +RF V   F T++D+L  +  I  AA
Sbjct:   16 ARGKEMVDYISQYLSTVRERQVTPNVQPGYLRAQLPASAPEEPDSWDSIFGDIERVIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNIMDWLAKMLGLPEYFLHHHPSSRGGGVLQSTVSESTLIALLAARKNKILAMKACEPDANESSLNARLVAYTSDQAHSSVEKAGLISLVKIRFLPVDDNFSLRGEALQKAIEEDKQQGLVPVFVCATLGTTGVCAFDRLSELGPICASEGLWLHVDAAYAGTAFLCPELRGFLEGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGAATDFMHWQIPLSRRFRSIKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRSDPSFEIPAKRHLGLVVFRLKGPNCLTESVLKEIAKAGQLFLIPATIQDK--LIIRFTVTSQFTTKEDILRDWHLIQEAA 478          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Match: Ddc (dopa decarboxylase [Source:MGI Symbol;Acc:MGI:94876])

HSP 1 Score: 236.498 bits (602), Expect = 9.404e-74
Identity = 110/253 (43.48%), Postives = 166/253 (65.61%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDN 955
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I+K ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R ++I++ +  +P  +   I++K+  Y S QAHSSVERA +I  +K K + +D N S+    L   +++DK   LIP  VV + G+TS C+FDN
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDN 253          
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Match: sp|P14173|DDC_RAT (Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddc PE=1 SV=1)

HSP 1 Score: 435.261 bits (1118), Expect = 5.614e-147
Identity = 209/470 (44.47%), Postives = 293/470 (62.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYL--SHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKIN 1597
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I++ ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R +MI++ +  +P L+   +++K+  Y S QAHSSVERA +I  +K K I +D N S+    L   +++DK   LIP  VV + G+TS C+FDNL ++G IC Q GV  H+DAAYAGS  ICPEF+YL  G+E+ +SF FNPHK L  +FDCS +W   R     A +++P+YL  SH   G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HVKL+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF VC        V   +E I 
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRALIPTTAPQEPETYEDIIRDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKMIRQLQAASPELTQAALMEKLVAYTSDQAHSSVERAGLIGGVKIKAIPSDGNYSMRAAALREALERDKAAGLIPFFVVVTLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTEAFNMDPVYLRHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVKLSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNQLNETLLQRINSAKKIHLVPCRLRDK--FVLRFAVCSRTVESAHVQLAWEHIR 468          
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Match: sp|O88533|DDC_MOUSE (Aromatic-L-amino-acid decarboxylase OS=Mus musculus OX=10090 GN=Ddc PE=1 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 7.570e-142
Identity = 207/470 (44.04%), Postives = 293/470 (62.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKIN 1597
            M+  +FR + KE+VD++ DY   I    V P VEPGYL+ L+P++AP+    +++I+K ++  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LPE FL+  +  GGG I  SASEATL+ L+  R ++I++ +  +P  +   I++K+  Y S QAHSSVERA +I  +K K + +D N S+    L   +++DK   LIP  VV + G+TS C+FDNL ++G IC Q GV  H+DAAYAGS  ICPEF+YL  G+E+ +SF FNPHK L  +FDCS +W   R     A +++P+YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  NE    L   +     I L       K  F LRF VC        V   +E I+
Sbjct:    1 MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPATAPQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKVIRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASALREALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDSGFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLRDK--FVLRFAVCARTVESAHVQLAWEHIS 468          
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Match: sp|P22781|DDC_CAVPO (Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus OX=10141 GN=DDC PE=2 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 1.652e-141
Identity = 203/476 (42.65%), Postives = 296/476 (62.18%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD+V +Y + I    V P VEPGYL+ L+PSSAPE    +++I+  ++  I+PG+THW+ P F+A++PTA S+PS L  ML    +C+G +W  SP CTELE ++LDWL K ++LP+ FL+ +   GGG I  SASEATL+ L+  R ++I++ +  +P L+   I++K+  Y S QAHSSVERA +I  ++ K+I +D N ++    L   +++DK   LIP  VV + G+T+ C+FD+L ++G IC Q  +  H+DAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P+YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+LA  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V + ++ I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYVANYLEGIESRLVYPDVEPGYLRPLIPSSAPEEPETYEDIIGDIERIIMPGVTHWNSPYFFAYFPTANSYPSMLADMLCGAISCIGFSWAASPACTELETVMLDWLGKMLRLPDAFLAGNAGMGGGVIQGSASEATLVALLAARTKVIRRLQAASPELTQAAIMEKLVAYASDQAHSSVERAGLIGGVRMKLIPSDSNFAMRASALREALERDKAAGLIPFFVVATLGTTNCCSFDSLLEVGPICNQEEMWLHIDAAYAGSAFICPEFRHLLDGVEFADSFNFNPHKWLLVNFDCSAMWVKQRTDLIGAFKLDPVYLKHGHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGIKGLQAHIRKHVQLAHEFESLVRQDPRFEICMEVTLGLVCFRLKGSNQLNETLLKRINSARKIHLVPCHLRDK--FVLRFRICSRQVESDHVQQAWQHIRQLASSV 474          
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Match: sp|P20711|DDC_HUMAN (Aromatic-L-amino-acid decarboxylase OS=Homo sapiens OX=9606 GN=DDC PE=1 SV=2)

HSP 1 Score: 417.542 bits (1072), Expect = 4.364e-140
Identity = 201/476 (42.23%), Postives = 292/476 (61.34%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M   +FR + KE+VD++ +Y + I   +V P VEPGYL+ L+P++AP+    F++I+  V+  I+PG+THWH P F+A++PTA S+P+ L  ML     C+G +W  SP CTELE +++DWL K ++LP+ FL+  +  GGG I  SASEATL+ L+  R ++I + +  +P L+   I++K+  Y S QAHSSVERA +I  +K K I +D N ++    L   +++DK   LIP  +V + G+T+ C+FDNL ++G IC +  +  HVDAAYAGS  ICPEF++L  G+E+ +SF FNPHK L  +FDCS +W   R     A  ++P YL H  +  G  T+ RHWQIPLGRRFR+LK+WFV  M+G+K LQ  IR+HV+L+  F   + +   FE+   V  GLVCF++K  N+    L   +     I L       K  F LRF +C        V   +E I   A ++
Sbjct:    1 MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDVEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDK--FVLRFAICSRTVESAHVQRAWEHIKELAADV 474          
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Match: sp|Q95ZS2|TDC1_CAEEL (Tyrosine decarboxylase OS=Caenorhabditis elegans OX=6239 GN=tdc-1 PE=2 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 6.925e-138
Identity = 206/476 (43.28%), Postives = 297/476 (62.39%), Query Frame = 2
Query:  197 AMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
             M  ++FR   KE VD++VDY +NI +  V+P++EPGYL+ L+PS AP     F+ +M+  +  I+PG+THW HP F+A++P   SFPS +  MLSD   CVG +W   P  TELE+++LDW  K + LP  FL  +E+G  GG I SSASE   + L+  R E++K+ +Q  P + +G +L K+  Y SK+AHSSVE+AC+I ++K +I+ TD    +  D L   I++D+   LIP  V T+ G+TS C+FD L +IG IC++  +  HVDAAY+GS  ICPEF+ L  G+EY  SF  NP+K L  +FDCS +W  +R     AL ++PLYL H +   + + RHW IPL RRFR+LKLWFV+ M+G+  LQ+ IR+HV+LA      +     FE+V+ V  GLVCF+MK  +E  + L   L     I +  +    +  F +RF VC + AT+KD+   +E I  A  ++
Sbjct:   76 GMTRDEFRQYGKETVDYIVDYLENIQKRRVVPAIEPGYLKDLIPSEAPNTPESFESVMEDFEKLIMPGITHWQHPRFHAYFPAGNSFPSIIADMLSDAIGCVGFSWAACPAMTELELIMLDWFGKMIGLPAEFLPLTENGKGGGVIQSSASECNFVTLLAARFEVMKELRQRFPFVEEGLLLSKLIAYCSKEAHSSVEKACMIGMVKLRILETDSKFRLRGDTLRNAIQEDRNLGLIPFFVSTTLGTTSCCSFDVLSEIGPICKENELWLHVDAAYSGSAFICPEFRPLMNGIEYAMSFNTNPNKWLLINFDCSTMWVRDRFKLTQALVVDPLYLQHSWMDKSIDYRHWGIPLSRRFRSLKLWFVIRMYGIDGLQKYIREHVRLAKKMETLLRADAKFEIVNEVIMGLVCFRMKGDDELNQTLLTRLNASGRIHMVPASLGDR--FVIRFCVCAENATDKDIEVAYEIIAQATQHV 549          
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Match: A6P4D4 (Aromatic amino acid decarboxylase OS=Dugesia japonica OX=6161 GN=DjAADCA PE=2 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 349/472 (73.94%), Postives = 417/472 (88.35%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFVCGDFATEKDVLETFEKINLAAMNL 1615
            M+ EQFR+Q K++VDF+ DY  NI + +VLPSV+PGYL+ LLP SAPEN I FD++MK+   AI+PGMTHWHHPNFYAFYPTAFSFPS LGSMLSDG AC+GLNWQ SP CTELE+LVLDWL K+M++PEFFLS+SE+GGGTILSSASEATLMVL++ERN MIKK ++EN  +++G  LD+M +YF+KQAHSSVERAC +SLLKF+II TD NES++ ++L + + +DKE NLIPLMV+TSFGSTSLC FDNL+DIG IC++ GVK HVDAAYAGS LICPE+QYLA+G+E+VNSFCFN HK+LKTHFDCSVLWTDNR SA  A S+NPLYL+HDFEG TTELRHWQ+PLGRRFRALKLWFVLNMFG++NLQ+ IRQHVKLA +FADK+N S+LFE+V+RVDFGLVCF++K+ NEKTR+LHN+LKLDHSIFLS SI EKK+ FF+RFVCG F+TEKDVLETF+KIN AAM L
Sbjct:    1 MDPEQFRIQGKQMVDFIADYMTNISKLDVLPSVQPGYLKNLLPDSAPENNINFDDVMKHFNQAIMPGMTHWHHPNFYAFYPTAFSFPSLLGSMLSDGIACIGLNWQASPACTELEVLVLDWLAKSMKMPEFFLSSSENGGGTILSSASEATLMVLLVERNIMIKKIQEENSEITEGNALDRMVVYFTKQAHSSVERACALSLLKFRIIETDSNESMNAEDLSKALLEDKEKNLIPLMVITSFGSTSLCVFDNLYDIGTICKEYGVKFHVDAAYAGSSLICPEYQYLARGIEFVNSFCFNAHKMLKTHFDCSVLWTDNRRSAVEAFSVNPLYLAHDFEGVTTELRHWQVPLGRRFRALKLWFVLNMFGIQNLQQGIRQHVKLAILFADKVNHSDLFEVVNRVDFGLVCFRIKNDNEKTRQLHNQLKLDHSIFLSPSILEKKDVFFIRFVCGCFSTEKDVLETFDKINAAAMKL 472          
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Match: I7H188 (Dopamine decarboxylase OS=Lymnaea stagnalis OX=6523 GN=ddc PE=2 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 4.694e-150
Identity = 221/461 (47.94%), Postives = 299/461 (64.86%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTT-TELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            M+ ++FR + +E+VD+V DY + IG    LPSV PGYL++L+P  AP N   ++E+ K +   I+PG+THWH P F+A++PT+ S+P+ LG MLSDG  C+G  W  SP CTELE+ ++DWL K + LP EF  S    GGG I  +ASEATL+ L+  R  MI K K++NP ++ G+I+DK+  Y S++AHSSV RA +I +++ K + TD+  S+   EL   I KDKE  LIP  +  + G+TS C  DNL ++G IC +  +  HVDAAYAGS  ICPEF+ L  G+E+  SF FNPHK L+  FDCS LW  +      A  +NP+YL+HD +G    + RHWQIPLGRRFR+LKLWFVL MFG+  LQE IR+ V LA  F D +   + FE+V +V FGLVCF++K  NE    L  ++  D  I L+ S  + K+ FFLRF VC       DV
Sbjct:    1 MDAQEFRARGREMVDYVADYLETIGTRTPLPSVLPGYLRELIPDEAPLNGESWEEVKKDIDRVIMPGVTHWHSPQFHAYFPTSSSYPAILGDMLSDGIGCIGFTWPASPACTELEVSMMDWLAKMLNLPQEFLFSGGGKGGGVIQGTASEATLVALLSARTTMINKLKKDNPQMTQGQIVDKLVAYCSEEAHSSVVRASLIGMVQMKSLPTDDKGSLRGSELESAIIKDKEQGLIPFFLCATVGTTSTCGTDNLLELGPICNKHDIWMHVDAAYAGSAFICPEFRPLLDGVEHSMSFNFNPHKWLQVTFDCSALWVKDSGLVSGAFELNPVYLNHDNQGQAMPDYRHWQIPLGRRFRSLKLWFVLRMFGVTGLQEQIRKDVSLAHQFEDLVKSDDRFEIVRKVTFGLVCFRLKGTNEINETLTKKINDDRRIHLTPS--KVKDTFFLRFAVCATKTQVSDV 459          
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Match: C3ZRR8 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_99569 PE=3 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 3.607e-149
Identity = 214/474 (45.15%), Postives = 310/474 (65.40%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+  +FR   KE+VD++ DY + I    V PSV+PGYL++L+P +AP++   ++++   ++  I+PG+T WH P+F+A++P A S+P+ LG MLS    C+G +W  SP CTELE +VLDWL K +QLPE FL+ TS  GGG I  +ASEATL+ L+  R++ ++K K + P +SD +I+ K+ IY S QAHSSVERA ++  ++ + + TDE+ ++    L   I++D+   L+P  VV + G+T  CAFDNL ++G +CR+  +  HVDAAYAGS  ICPE++ L  G+E+ +SF FNPHK ++ +FDCS +W  NR     A +++PLYL HD +G  T+ RHWQIPLGRRFR+LKLWFVL MFG+K LQE IR+ V LA  F   +   E FE+  +V  GLVCF++K  NE    L  ++     I L  S  + +  +FLRF VC      +DV   +E I+  A ++
Sbjct:    1 MDHAEFRRMGKEMVDYIADYMEGIETRPVFPSVKPGYLRELIPDAAPQDPESWEDVQADIERVIMPGVTFWHSPHFHAYFPCANSYPALLGDMLSGAIGCIGFSWAASPACTELETVVLDWLGKMLQLPECFLAGTSGEGGGVIQGTASEATLVALLAARSKAVQKFKTDRPEMSDHDIMGKLVIYTSDQAHSSVERAAMLGAVRCRKLQTDEDLALRGAVLQAAIQEDRAQGLLPFFVVATLGTTPSCAFDNLQELGPVCREEVMWLHVDAAYAGSAFICPEYRPLLDGVEFADSFNFNPHKWMRVNFDCSAMWIRNRSDIVDAFNLDPLYLKHDNQGLVTDYRHWQIPLGRRFRSLKLWFVLRMFGVKGLQEHIRKQVGLAKEFETLVRSDERFEVTAKVVLGLVCFRLKGSNEVNELLLKKINDGKKIHLVPS--QVRGAYFLRFAVCAATTASQDVTYAWEIISQLAGDV 472          
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Match: A0A067RL11 (Aromatic-L-amino-acid decarboxylase OS=Zootermopsis nevadensis OX=136037 GN=L798_11151 PE=3 SV=1)

HSP 1 Score: 446.432 bits (1147), Expect = 5.903e-149
Identity = 212/471 (45.01%), Postives = 310/471 (65.82%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAA 1606
            ME +QFR  AK++VD++ DY +NI    VLP+VEPGYL+ LLP  APEN  ++ ++M  ++  I+PG+THWH P F+A++PTA S+P+ +  MLS G AC+G +W  SP CTELE++++DWL K ++LP EF  ST+  GGG I  +ASEATL+ L+  + + + + KQE+P  +D  I+ K+  Y S QAHSSVERA ++  +K +++  DE   +  D L + I++D+ + LIP   V + G+T+ C+FD+L ++G +C +  V  HVDAAYAGS  ICPEF+YL  G+E+ +SF FNPHK +  +FDCS +W  +     +A +++PLYL HD +G   + RHWQIPLGRRFRALKLWFVL ++G++NLQ  IR+HV LA  F D + +   FE+   V  GLVCF++K  NE+   L   +     I L  S  +  + +FLR  +C  F   +D+  ++ +I   A
Sbjct:    1 MECKQFREFAKDMVDYIGDYLENIRDRRVLPTVEPGYLRPLLPEEAPENPDKWQDVMADIEKVIMPGVTHWHSPRFHAYFPTANSYPAIVADMLSSGIACIGFSWIASPACTELEVVMMDWLGKMLELPKEFLASTNGKGGGIIQGTASEATLVALLGAKAKAVLRAKQEHPEWNDVTIISKLVGYASNQAHSSVERAGLLGGVKLRLLPADEKLRLRGDTLQKAIQEDRHNGLIPFYAVATLGTTNACSFDSLDELGPVCNEESVWLHVDAAYAGSAFICPEFRYLMTGIEHADSFNFNPHKWMLVNFDCSAMWLKDPTYVVNAFNVDPLYLKHDQQGVLPDYRHWQIPLGRRFRALKLWFVLRLYGVRNLQAFIRKHVALAHEFEDLVRQDNRFEIFSEVVLGLVCFRLKGSNERNEILLKRINGHGVIHLVPS--KIGDTYFLRLAICSRFTESQDIQLSWNEIRTLA 469          
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Match: A0A1S3KCH4 (aromatic-L-amino-acid decarboxylase-like OS=Lingula unguis OX=7574 GN=LOC106180504 PE=3 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 7.155e-148
Identity = 211/460 (45.87%), Postives = 302/460 (65.65%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            M+  +FR + KE+VD V DY +NI +  V PSV+PGY+++L+P SAPE    +++++  ++  ++PG+THWHHP F+A++PTA S+ +    MLSD   C+G +W  SP CTELE++++DWL K + LP EF   +   GGG I  +ASEATL+ L+  RN+ I + K+ NP L++ +I+ +M  Y S QAHSSVERA ++  +K   + +D+ +S+  + L + ++KDKE  LIP  V  + G+T  CAFDN+ ++G +C    +  H+DAAYAGS  ICPEF+YL  G+++ +SF FNPHK L+  FDCS +W  +      A +++PLYL HD +G   + RHWQIPLGRRFR+LKLWFVL + G+K LQE IRQHVKLA  F   +   E FE+V  V  GLVCF++K  N+   +L   +  D  I L  S  +  N +FLRF VC  +A  KDV
Sbjct:    1 MDAAEFRQRGKEMVDTVADYLENIQKRPVFPSVQPGYIRELVPESAPETAESWEDLVGDIERVVMPGVTHWHHPQFHAYFPTANSYAALCADMLSDAIGCIGFSWASSPACTELEMVMMDWLGKMLDLPQEFLFCSGGKGGGVIQGTASEATLVALLAARNQTIHREKEANPALTEADIMARMVGYCSDQAHSSVERAGLLGAVKIVKLSSDKKQSLRGETLAQAVQKDKEKGLIPFFVCGTLGTTPSCAFDNIEELGAVCNLEKIWLHIDAAYAGSAFICPEFRYLLSGVQFADSFNFNPHKWLRVTFDCSAMWIKDSSKLVDAFNVDPLYLKHDNQGKVPDYRHWQIPLGRRFRSLKLWFVLRLHGIKGLQEYIRQHVKLAHEFEALVLADERFEIVAEVVLGLVCFRLKGANDINEQLLQRINQDGRIHLVPS--KIGNTYFLRFAVCAPYAESKDV 458          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Match: ddc (dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-040426-2656])

HSP 1 Score: 387.882 bits (995), Expect = 6.430e-130
Identity = 182/402 (45.27%), Postives = 260/402 (64.68%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES-GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHV-KLAGIFADKINESELFELV 1393
            M+  +FR + KE+VD+V DY +NI   +V P V+PGYL+ L+P  AP+    +++++K ++  I+PG+THWH P F+A++PTA SFP+ L  MLS    C+G +W  SP CTELE ++LDWL K ++LPE FL+ +E  GGG I  +ASEATL+ L+  R+ ++K+   ++P   +  I+ ++  Y S QAHSSVERA +I  +K K I TD   ++  +   + +++DK   LIP     + G+T  CAFD + +IG IC    +  H+DAAYAGS  ICPEF+ L  G+E+ +SF FNPHK +  +FDCS +W  NR     A  ++PLYL HD +  G  T+ RHWQIPLGRRFR+LK+WFV  M+GL+ LQE IR+   +L      KIN +    LV
Sbjct:    1 MDTAEFRRRGKEMVDYVADYLENIESRQVYPDVQPGYLRTLIPEDAPQEPETYEDVVKDIERVIMPGVTHWHSPYFFAYFPTANSFPALLADMLSGAIGCIGFSWAASPACTELETVMLDWLGKMLKLPEEFLAGTEGKGGGVIQGTASEATLVALLAARSRILKRILNDDPEKQEANIISRLVAYSSDQAHSSVERAALIGGVKMKKIPTDCKFAVRGEAFQKILEEDKAAGLIPFYFCATLGTTPSCAFDRITEIGPICNAEQLWLHIDAAYAGSAFICPEFRPLLDGVEFADSFNFNPHKWMLVNFDCSTMWVKNRSDIIGAFKMDPLYLKHDHQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLRGLQEHIRKGSNELNEALLKKINSARTIHLV 402          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 392.504 bits (1007), Expect = 1.330e-129
Identity = 195/475 (41.05%), Postives = 285/475 (60.00%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+ E++  + KE+VD++ +Y   I    V+P V+PG+L+ LLPS AP     ++ I++ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL KA+ LP+ FL       GGG + S+ SE TL+ L+  R + I + K    N+ +  +  ++  Y S QAHSSVE+A +ISL+K + + TDE  S+  + L R I++D+   L+P+M+  + GST +C+FD L ++G IC + G+  HVDAAYAGS L+CPE +Y   GME+ +SF FNP K +  HFDC+  W  ++       S++PLYL HD  G  T+  HWQIPL RRFR+LKLWFV+  FGLKNLQ  IR  V++A +F   +     F++    + GLV F +  GN  T+EL   L    ++FL  +    K    +RF V   F   +D+   +  I   A  L
Sbjct:    2 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMK----NMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSG-ATDFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVGTK--LIIRFTVTSQFTQPQDIQRDWSIIQRTAAEL 469          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 390.193 bits (1001), Expect = 2.939e-128
Identity = 199/490 (40.61%), Postives = 286/490 (58.37%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLS--------------DGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+ E++  + KE+VD++ +Y   I    V+P V+PG+L+ LLPS AP     ++ I++ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL KA+ LP+ FL       GGG + S+ SE TL+ L+  R + I + K  +P                 D  IL+   I Y S QAHSSVE+A +ISL+K + + TDE  S+  + L R I++D+   L+P+M+  + GST +C+FD L ++G IC + G+  HVDAAYAGS L+CPE +Y   GME+ +SF FNP K +  HFDC+  W  ++       S++PLYL HD  G  T+  HWQIPL RRFR+LKLWFV+  FGLKNLQ  IR  V++A +F   +     F++    + GLV F +  GN  T+EL   L    ++FL  +    K    +RF V   F   +D+   +  I   A  L
Sbjct:    1 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMKSTDPAAETHTDAFINDTHSDMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSG-ATDFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVGTK--LIIRFTVTSQFTQPQDIQRDWSIIQRTAAEL 487          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 390.193 bits (1001), Expect = 2.939e-128
Identity = 199/490 (40.61%), Postives = 286/490 (58.37%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLS--------------DGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+ E++  + KE+VD++ +Y   I    V+P V+PG+L+ LLPS AP     ++ I++ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL KA+ LP+ FL       GGG + S+ SE TL+ L+  R + I + K  +P                 D  IL+   I Y S QAHSSVE+A +ISL+K + + TDE  S+  + L R I++D+   L+P+M+  + GST +C+FD L ++G IC + G+  HVDAAYAGS L+CPE +Y   GME+ +SF FNP K +  HFDC+  W  ++       S++PLYL HD  G  T+  HWQIPL RRFR+LKLWFV+  FGLKNLQ  IR  V++A +F   +     F++    + GLV F +  GN  T+EL   L    ++FL  +    K    +RF V   F   +D+   +  I   A  L
Sbjct:    1 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMKSTDPAAETHTDAFINDTHSDMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSG-ATDFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVGTK--LIIRFTVTSQFTQPQDIQRDWSIIQRTAAEL 487          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:103025570])

HSP 1 Score: 390.193 bits (1001), Expect = 2.939e-128
Identity = 199/490 (40.61%), Postives = 286/490 (58.37%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLS--------------DGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+ E++  + KE+VD++ +Y   I    V+P V+PG+L+ LLPS AP     ++ I++ V+N I+PG+ HW  P+ +A++P   S+PS LG ML+D   C+G  W  SP CTELE+ V+DWL KA+ LP+ FL       GGG + S+ SE TL+ L+  R + I + K  +P                 D  IL+   I Y S QAHSSVE+A +ISL+K + + TDE  S+  + L R I++D+   L+P+M+  + GST +C+FD L ++G IC + G+  HVDAAYAGS L+CPE +Y   GME+ +SF FNP K +  HFDC+  W  ++       S++PLYL HD  G  T+  HWQIPL RRFR+LKLWFV+  FGLKNLQ  IR  V++A +F   +     F++    + GLV F +  GN  T+EL   L    ++FL  +    K    +RF V   F   +D+   +  I   A  L
Sbjct:    1 MQAEEYTRRGKEMVDYISNYLTEIRTRRVVPDVQPGFLRPLLPSDAPCEPEPWENILQDVENIIMPGVVHWQSPHMHAYFPALNSWPSLLGDMLADAINCLGFTWASSPACTELEMCVMDWLCKALGLPDHFLHHHPESRGGGILQSTVSECTLVALLAARKDKILQMKSTDPAAETHTDAFINDTHSDMDESILNSRLIAYASDQAHSSVEKAGLISLVKIRFLETDERFSLRGETLQRAIQEDRRRGLLPIMLCATLGSTGVCSFDCLDELGPICAREGLWLHVDAAYAGSALLCPELRYFMSGMEFADSFVFNPSKWMMVHFDCTAFWVKDKFKLQQTFSVDPLYLRHDNSG-ATDFMHWQIPLSRRFRSLKLWFVMRSFGLKNLQAHIRHGVEMAKLFESLVRSDSNFQIPAERNLGLVVFCLVGGNALTQELLRRLTQSGTMFLIPAAVGTK--LIIRFTVTSQFTQPQDIQRDWSIIQRTAAEL 487          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 339.732 bits (870), Expect = 1.803e-111
Identity = 174/468 (37.18%), Postives = 268/468 (57.26%), Query Frame = 2
Query:  227 AKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQE-NPNLSDGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFV-CGDFATEKDVLETFEKINLAAMNL 1615
             K +VD++  Y   +    V PSV PGYL+ LLP   P+    ++ I + ++  I+PG+ HW  P+ + ++P   S+PS LG ML+ G  CVG  W  +P  TEL+I++ DWLV  + LP  F      G  GG I SS SE T++ L+  R   + + + + + ++ +  +L+   + Y S QAHSSV +  ++SL++ + + TD   S+  + L R +++D+   L+P  V  + G+T +C FDN+ ++G ICRQ G+  HVDAAYAG+  +CPE +   +G+E+ +SF  NP K +  + DC+V W  ++ S  S   + P YL H+  G+ T+  HWQIPL  RFR+LKLWFV+  FGL  LQE +R+  KLA  F   + E   FE+  + + GLV F+++  NE T  L   L     +F+  ++   K  F +RFV    F TE DVL  +  +  AA +L
Sbjct:    1 GKAMVDYIAAYLTGLRDRPVNPSVRPGYLRPLLPPGPPQQGEAWERIFEDMEQLIMPGIAHWQSPHMHGYFPALNSYPSLLGDMLATGINCVGFTWASNPASTELQIVMTDWLVDMLSLPATFRHDHPDGCGGGVIQSSVSECTMLALLAARTRALTQLRGDVSQDVGNDALLNSRLVGYTSDQAHSSVLKVSLMSLVRLRSLPTDLEFSLRGETLRRAVEEDRAQGLVPFFVCATLGTTGVCTFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQSTFCVEPHYLQHEHSGSVTDFMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVRRTNKLARYFESLVREDPHFEIPAKSNLGLVVFRLQGPNELTETLLRRLNQSQQLFVVPAMAGDK--FIIRFVITSQFTTEADVLRDWRLVLQAATDL 466          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 325.479 bits (833), Expect = 2.787e-107
Identity = 151/381 (39.63%), Postives = 233/381 (61.15%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQE-NPNLSDGEILD-KMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQ 1330
            M+ +++R + KE+VD++  Y + + +  V PSV PGYL+ LLP+  P+    ++ I K V+  I+PG+ HW  P+ + +YP   S+PS LG ML+ G   VG  W  +P  TELE++V DWL   + LP+ F     SG  GG + ++ SE+ L+ L+  R   + + + +   ++    +L+ ++  Y S QAHSSV +A ++SL++ + + TD   S+  + L R +++D+   L+P  V  + GST +CAFDNL ++G ICRQ G+  HVDAAYAG+  +CPE +    G+E  +SF  NP K +  + DC+V W  ++ S  S   + P YL H+  G+ T+L HWQIPL  RFR+LKLWFV+  FGL  LQE +R+
Sbjct:    1 MDNDEYRNRGKEMVDYIAMYLRGLRERSVNPSVLPGYLRPLLPAGPPQQGESWERIFKDVERLIMPGVVHWQSPHMHGYYPGLNSYPSLLGDMLATGMNSVGFTWASNPASTELEMVVTDWLATMLSLPDTFRHDHPSGRGGGVMQTTVSESNLLALLAARTRALARLRGDARVDVGQDALLNARLVAYTSDQAHSSVLKASLVSLVRLRSLSTDLEFSLRGETLRRAVEEDRAQGLVPFFVCATLGSTGVCAFDNLSELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLHGIEIADSFVVNPGKWMMVNLDCTVFWVADKRSLQSTFCVEPHYLKHEHSGSVTDLMHWQIPLTVRFRSLKLWFVIRSFGLDGLQEHVRR 381          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 278.485 bits (711), Expect = 1.528e-88
Identity = 143/416 (34.38%), Postives = 237/416 (56.97%), Query Frame = 2
Query:  197 AMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESG--GGTILSSASEATLMVLIIERNEMIKKTKQE-NPNLSDGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMK 1432
            AM+ E+++V+ K +VD++  Y   +    V PSV PGYL+ LLP   P+    ++ I + V+  I+PG+ HW  P+ + ++P   S+PS LG ML+ G  CV   W  +P  TEL+I++ DWLV  + LP+ F      G  GG I SS SE+T++ L+  R   + + + + + +  +  +L+   + Y S QAHSSV +A ++SL++ + + TD   S+  + L R + +D+   L+P  V  + G+T +CAFDN+ ++G ICRQ G+  HVDAAYAG+  +CPE +   +G+E+ +SF  NP K +  + DC+V W  ++ S  S   + P YL H+  G+ T+    +      F  +K   ++ + G+  L   I+ + KLA  F   + E   FE+  + + GLV F+++
Sbjct:    1 AMDAEEYKVRGKAMVDYIAAYLTGLRDRPVKPSVRPGYLRPLLPPGPPQQGEPWERIFEDVEQLIMPGIVHWQSPHMHGYFPALNSYPSLLGDMLATGMNCVSFTWASNPASTELQIVMTDWLVDMLSLPDTFRHDHPDGCGGGVIQSSVSESTMLALLAARTRALTQLRGDVSQDFGNDALLNSRLVGYTSDQAHSSVLKASLMSLVRVRSLPTDLEFSLRGETLRRAVDEDRAQGLVPFFVCATLGTTGVCAFDNMAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPGKWMMVNLDCAVFWVADKRSLQSTFCVEPHYLQHEHSGSVTDFMVGEFAALHMFYNIKKHHLVKIRGISMLYVFIQTN-KLARYFESLVREDPHFEIPAKSNLGLVVFRLQ 415          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Match: hdc (histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-080102-5])

HSP 1 Score: 248.825 bits (634), Expect = 2.050e-78
Identity = 113/309 (36.57%), Postives = 185/309 (59.87%), Query Frame = 2
Query:  227 AKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQEN-PNLSDGEILD-KMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLW 1141
             KE+VD++  Y + + +  V PSV PGYL+ LLP+  P+    ++ I + V+  I+PG+ HW  P+ + +YP   S+PS LG ML++    +G  W  SP  TELE+++ DWL   + LP+ F        GGG + ++ SE+ L+ L+  R   + + + +   ++    +L+ ++  Y S QAHSSV +A ++SL++ + + TD   S+  + L R +++D+   L+P  V  + G+T LCAFDNL ++G ICRQ G+  HVDAAYAG+  +CPE +   +G+E+ +SF  NP K +  + D +V W
Sbjct:    5 GKELVDYITTYLRGVRERPVNPSVRPGYLRPLLPAGPPQQGEPWERIFEDVERLIMPGIVHWQSPHMHGYYPGLNSYPSLLGDMLANAINSIGFTWASSPASTELELVMTDWLATMLSLPDTFRHDHPEGRGGGVMQTTVSESNLLALLAARTRALARLRGDACVDVGQDALLNARLVAYTSDQAHSSVLKASLVSLVRLRSLSTDLEFSLRGETLRRAVEEDRAQGLVPFFVSVTLGTTGLCAFDNLAELGPICRQEGLWLHVDAAYAGTAFLCPELRDPLRGVEFADSFVVNPSKWMMVNLDSAVFW 313          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005196.1 (pep scaffold:Pmarinus_7.0:GL479731:26751:28782:1 gene:ENSPMAG00000004726.1 transcript:ENSPMAT00000005196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 4.423e-24
Identity = 53/156 (33.97%), Postives = 89/156 (57.05%), Query Frame = 2
Query:  431 AFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES--GGGTILSSASEATLMVLIIERNEMIKKTKQE-NPNLSDGEILDKMRI-YFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDK 886
             ++P   S+PS LG ML+    CVG  W  +P  TEL+I++ DWLV  + LP  F        GGG I SS SE+T++ L+  R   + + + + + ++ +  +L+   + Y S QAHSSV +  ++SL++ + + TDE  S+  + L R + +D+
Sbjct:    1 GYFPALNSYPSLLGDMLATRINCVGFTWASNPASTELQIVMTDWLVDMLSLPATFRHDHPDGCGGGVIQSSVSESTMLALLAARTRALTQLRGDVSQDVGNDALLNSRLVGYTSDQAHSSVLKVSLMSLVRLRSLPTDEF-SLRGETLRRAVDEDR 155          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Nematostella
Match: EDO43411 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYR9])

HSP 1 Score: 375.555 bits (963), Expect = 1.710e-125
Identity = 176/447 (39.37%), Postives = 278/447 (62.19%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSES------GGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKN 1522
            M  E+FR   K ++DF+ D+ + I +  V+P V+PG+L   LP+ AP     FD I +  +  +LPG+T W  P+F+AF+P++ S+P  LG ++S   A VG NW  +P  TELEI+VLDWL K + LP+ FL+ + +      GGG I  +ASEATL+ ++  R   + + + E+P +++G ++ KM  Y SK AHSSVE+A  I+ +K + + TD+  S+  ++    +K DKE  LIP  +  + G+T+LC++DNL ++G +  +  +  HVDAAYAG    CPE +   +G+E  +SF  N HK++ T+FDC+ +W  +R +   A ++  +Y   D  G  TE R+WQIPLGRRFR+LKLWFV+  +G++ +Q+ IR+HV+LA +F + + + + FELV   +FGLVCF+ K   E  + L + L  +  I ++  I + + 
Sbjct:    1 MNSEEFRKHGKAMIDFIADFLETIEKRRVVPDVKPGFLLHQLPNEAPSQSENFDAIFEDFEKKVLPGVTLWGSPHFHAFFPSSISYPGILGELMSASLAGVGFNWLCNPSSTELEIMVLDWLGKMLDLPKEFLAMTPAREDGRRGGGVIQGTASEATLVAVLAARTATLTQLQNEHPGVAEGVLMSKMVAYTSKHAHSSVEKAARIAGVKLRSVETDDAGSLRGEQFLECLKADKEAGLIPFFLCATLGTTTLCSYDNLKELGPLAVKEKMWLHVDAAYAGPAFTCPEMRAPMQGIELADSFNCNAHKMMMTNFDCAPMWVKDRDALMRAFTLERIYYPDDDTGVVTEFRNWQIPLGRRFRSLKLWFVIRSYGIEGIQKEIREHVRLAKVFEEMVKQDDDFELVVDTNFGLVCFRYKGSEEDNKNLVDILNAEGKILVTPGIHKGRR 447          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Nematostella
Match: EDO43392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYV7])

HSP 1 Score: 360.147 bits (923), Expect = 6.366e-119
Identity = 184/466 (39.48%), Postives = 285/466 (61.16%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFL-----STSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGT-DENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYL-SHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            M+ +QFR Q K+IVDF+ DY++NI    V+P V PG+LQK LP+ AP    EF  + +  +  I+PG+ HW  PNF+A+YP   SFP+ LG +LS G   +  +W  +P  TELE++V+DWL K ++LPE FL          GGG I ++ASE+ L+ ++  R   + + +   P+  D  I+ ++ +Y S Q HS +++A +++ +K + I T DE++S++   L + +K D+   L P  +  S G+TS CAFD+L  IG IC++  +  H+DAAY+G   +CPEF+ L  G+E+  SF FNPHK++ T+FDCS LW  +R     A+ ++P+YL    F G   E + W+IPLGR  RALKLWFVL  +GL+ +Q+ +R HVK+A +F   + +   FE V +V  GLVCFK+K    K++ L     +++   + +   E    + +RF VC ++  E+D+
Sbjct:    1 MDSKQFREQGKQIVDFIADYFENIRSQRVIPDVRPGFLQKHLPTEAPSKGEEFVNVKEDFEKFIMPGIVHWQSPNFHAYYPCGHSFPAVLGDLLSGGLGSIMFSWASNPAGTELEVVVMDWLGKMVKLPEDFLFEFTKDKPHVGGGCIQNTASESILVTMLAARRAALDRLRNRYPDDDDDVIMSRLIVYSSDQVHSCLDKAAMLAAVKLRKIPTNDEDQSMNVVALEKAVKVDEAMGLHPFYLCASLGTTSTCAFDDLKKIGPICQRESIWMHIDAAYSGPAFMCPEFRPLLDGVEFAESFNFNPHKLMLTNFDCSALWVKHRDMLKKAMHVDPIYLRKRSFMG---ESKDWEIPLGRSMRALKLWFVLRTYGLEGIQKHVRNHVKMAKLFESLLAQDSRFEQVAKVVLGLVCFKLKGTANKSKALLK--AINNEGLIHMVPGELNGAYMIRFVVCSEWVKEEDI 461          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:100301599])

HSP 1 Score: 414.461 bits (1064), Expect = 8.697e-140
Identity = 206/480 (42.92%), Postives = 291/480 (60.62%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFE--GTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL*NLH 1627
            M+  +FR + KE+VD V DY + I +  V P VEPGYL+ L+P+ AP     +++IMK V+  I+PG+THWH PNF+A++P A S+P+ L  ML     C+G +W  SP CTELE ++LDWL K +QLPE FL+ T   GGG I  +ASEATL+ L+  R + I++ +  +P  S+ EIL K+  Y S+QAHSSVERA +I  +  K + TD   ++  + L + +++DK   LIP     + G+T  CAFD++ D+G +C Q  +  H+DAAYAGS  ICPEF+ L  G+EY +SF FNPHK +  +FDCS +W   R     A  + PLYL H+ +  G  T+ RHWQIPLGRRFR+LK+WFV  M+GL+ LQ  IR+ V LA  F   +   + FE+   V  GLVCF++K  NE  + L    K+  S  + L   +    F LR  +C      + + + ++ I   A  L   H
Sbjct:    1 MDAAEFRRRGKEMVDHVADYLEKIEERPVYPDVEPGYLRSLIPTEAPVEPDSYEDIMKDVERVIMPGITHWHSPNFFAYFPAASSYPAMLADMLCAAIGCIGFSWAASPACTELETVMLDWLGKMLQLPECFLAGTHGHGGGVIQGTASEATLVSLLAARCKAIRRVQSLDPKKSEAEILSKLVAYTSEQAHSSVERAALIGAVMMKKVPTDNLYAVRGEMLKKILEEDKAAGLIPFYFCATLGTTPSCAFDHIADLGPLCNQENMWMHIDAAYAGSAFICPEFRPLLNGVEYADSFNFNPHKWMLINFDCSAMWVKKRTDIIGAFKMEPLYLKHENQESGLVTDYRHWQIPLGRRFRSLKMWFVFRMYGLQGLQAHIRKQVGLAKEFESLVRADKRFEICAPVVMGLVCFRLKGTNELNQSLLK--KITKSREIHLVPCQLSGSFVLRLAICSRSTESRHIQQAWQHITQLAFELLQEH 478          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Match: ddc (dopa decarboxylase [Source:NCBI gene;Acc:100301599])

HSP 1 Score: 405.986 bits (1042), Expect = 1.500e-136
Identity = 206/484 (42.56%), Postives = 291/484 (60.12%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS-TSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHD-FEGTTTE-----LRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL*NLH 1627
            M+  +FR + KE+VD V DY + I +  V P VEPGYL+ L+P+ AP     +++IMK V+  I+PG+THWH PNF+A++P A S+P+ L  ML     C+G +W  SP CTELE ++LDWL K +QLPE FL+ T   GGG I  +ASEATL+ L+  R + I++ +  +P  S+ EIL K+  Y S+QAHSSVERA +I  +  K + TD   ++  + L + +++DK   LIP     + G+T  CAFD++ D+G +C Q  +  H+DAAYAGS  ICPEF+ L  G+EY +SF FNPHK +  +FDCS +W   R     A  + PLYL H+  E   T+     L+HWQIPLGRRFR+LK+WFV  M+GL+ LQ  IR+ V LA  F   +   + FE+   V  GLVCF++K  NE  + L    K+  S  + L   +    F LR  +C      + + + ++ I   A  L   H
Sbjct:    1 MDAAEFRRRGKEMVDHVADYLEKIEERPVYPDVEPGYLRSLIPTEAPVEPDSYEDIMKDVERVIMPGITHWHSPNFFAYFPAASSYPAMLADMLCAAIGCIGFSWAASPACTELETVMLDWLGKMLQLPECFLAGTHGHGGGVIQGTASEATLVSLLAARCKAIRRVQSLDPKKSEAEILSKLVAYTSEQAHSSVERAALIGAVMMKKVPTDNLYAVRGEMLKKILEEDKAAGLIPFYFCATLGTTPSCAFDHIADLGPLCNQENMWMHIDAAYAGSAFICPEFRPLLNGVEYADSFNFNPHKWMLINFDCSAMWVKKRTDIIGAFKMEPLYLKHENQEKNKTKPLSVILQHWQIPLGRRFRSLKMWFVFRMYGLQGLQAHIRKQVGLAKEFESLVRADKRFEICAPVVMGLVCFRLKGTNELNQSLLK--KITKSREIHLVPCQLSGSFVLRLAICSRSTESRHIQQAWQHITQLAFELLQEH 482          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Match: hdc (histidine decarboxylase [Source:NCBI gene;Acc:101172886])

HSP 1 Score: 389.037 bits (998), Expect = 1.392e-127
Identity = 189/476 (39.71%), Postives = 287/476 (60.29%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLS--TSESGGGTILSSASEATLMVLIIERNEMIKKTKQE-NPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKINLAAMNL 1615
            M+ E++  + KE+VD++ +Y  +I    V+P V+PG  QKLLP SAP    +++ I   ++  I+PG+ HW  P+ +A+YP+  S+PS LG ML+D   CVG  W  SP CTELE+ ++DWL KA+ LP FFL       GGG + S+ SE+TL+ L+  R + I + + E + ++ D  +  ++  Y S QAHSSVE+A +ISL+K + +  D+  S+  D L + I++D+   L+P M+  + G+T +CAFD L ++G +C +  +  HVDAAYAGS  +CPE ++  +G+E+ +SF FNP K +  HFDC+  W  +++      S++P+YL H+     T+  HWQIPL RRFR+LKLWFVL  FGLK LQ  IR  V++A +    I     FE+  +   GLV F +K GN  T+EL   L    +++L  +    K    +RF V   F T +D+L+ +  I+  A  L
Sbjct:    2 MQAEEYNRRGKEMVDYITEYLSSIRDRRVIPDVKPGDTQKLLPDSAPTEPEDWESIFNDIERVIMPGVVHWQSPHMHAYYPSLTSWPSMLGDMLADAINCVGFTWASSPACTELEMKMMDWLCKALGLPYFFLHHHPDSRGGGVLQSTVSESTLVALLAARKDKILQLRAELDQDVDDSVLNSRLVAYASDQAHSSVEKAGLISLVKIRFLPADDQLSLRGDALKQAIQEDRRRGLVPFMLCATLGTTGVCAFDKLSELGPVCEEEALWLHVDAAYAGSAYLCPELRWSLEGIEFAHSFVFNPSKWMMVHFDCTAFWVRDKYKLQQTFSVDPVYLRHENSQAATDFMHWQIPLSRRFRSLKLWFVLRSFGLKKLQAHIRHGVEMAKLLESLIKSDPNFEVPAQRHLGLVVFCLKDGNALTQELLRRLTGYGTMYLIPAEIHTKR--IIRFTVTSQFTTAEDILKDWAIISKTASTL 475          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Match: GADL1 (glutamate decarboxylase like 1 [Source:NCBI gene;Acc:101172521])

HSP 1 Score: 102.449 bits (254), Expect = 1.152e-22
Identity = 99/441 (22.45%), Postives = 186/441 (42.18%), Query Frame = 2
Query:  206 GEQFRVQAKE-IVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRI--YFSKQAHSSVERACIISLLKFK---IIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNR-------HSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCF--------KMKSGNEKTRELHN 1465
             E+F  +A E I+D  V    ++ Q +V     P  L++LL     +      +I+++ KNAI   +    HP F+          S + S +++        ++ +PV T +E  VL    K M+L    +   E G G      S + +  + + R           P++ +  + +  R+  + S++ H S+ +A  +  L  K    + +D+   +    L  +I+  + +  +P  V  + G+T   AFD + +I  IC +  +  HVDA + G+ L+  + ++L KG+   +S  +NPHK+L     CS     ++       HSA ++     L+    F   + +     +   R+  A K W +    G   L+  + + + +A   A    + E F L+   ++  VCF         +  G E  R+LH 
Sbjct:   40 AERFIHEAMEVIIDEAVKKATDV-QEKVCEWQSPEKLRELLDLELKDGGESDSKILQHCKNAIRYSVKT-SHPRFFNQLFAGLEPYSMVASFITEAVKTSLYTYEVAPVFTLMEDAVLK---KMMEL----IGWDEGGDGIFNPGGSMSNMYAVNLARYRFC-------PDIKEVGLYNAPRLVMFTSQEGHYSISKAAALLGLGTKNVYAVPSDDRGKMIPSALEEKIELARSEGAVPFFVNATAGTTVFGAFDPVDEIADICERHSLWLHVDACWGGAALVSNQHKHLLKGIHRADSVAWNPHKMLMACLQCSAFLIKDKTSLLQRCHSAKASY----LFQQDKFYDVSYDTGDKSVQCSRKPDAFKFWLMWKALGSSELERRVDRALAMARYLAQTFKKREGFHLLMEPEYSNVCFWYVPPALRGLPDGPELWRKLHT 460          
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Match: GADL1 (glutamate decarboxylase like 1 [Source:NCBI gene;Acc:101172521])

HSP 1 Score: 102.064 bits (253), Expect = 1.339e-22
Identity = 99/441 (22.45%), Postives = 186/441 (42.18%), Query Frame = 2
Query:  206 GEQFRVQAKE-IVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRI--YFSKQAHSSVERACIISLLKFK---IIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNR-------HSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCF--------KMKSGNEKTRELHN 1465
             E+F  +A E I+D  V    ++ Q +V     P  L++LL     +      +I+++ KNAI   +    HP F+          S + S +++        ++ +PV T +E  VL    K M+L    +   E G G      S + +  + + R           P++ +  + +  R+  + S++ H S+ +A  +  L  K    + +D+   +    L  +I+  + +  +P  V  + G+T   AFD + +I  IC +  +  HVDA + G+ L+  + ++L KG+   +S  +NPHK+L     CS     ++       HSA ++     L+    F   + +     +   R+  A K W +    G   L+  + + + +A   A    + E F L+   ++  VCF         +  G E  R+LH 
Sbjct:   41 AERFIHEAMEVIIDEAVKKATDV-QEKVCEWQSPEKLRELLDLELKDGGESDSKILQHCKNAIRYSVKT-SHPRFFNQLFAGLEPYSMVASFITEAVKTSLYTYEVAPVFTLMEDAVLK---KMMEL----IGWDEGGDGIFNPGGSMSNMYAVNLARYRFC-------PDIKEVGLYNAPRLVMFTSQEGHYSISKAAALLGLGTKNVYAVPSDDRGKMIPSALEEKIELARSEGAVPFFVNATAGTTVFGAFDPVDEIADICERHSLWLHVDACWGGAALVSNQHKHLLKGIHRADSVAWNPHKMLMACLQCSAFLIKDKTSLLQRCHSAKASY----LFQQDKFYDVSYDTGDKSVQCSRKPDAFKFWLMWKALGSSELERRVDRALAMARYLAQTFKKREGFHLLMEPEYSNVCFWYVPPALRGLPDGPELWRKLHT 461          
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Match: SMESG000058665.1 (SMESG000058665.1)

HSP 1 Score: 440.654 bits (1132), Expect = 5.017e-154
Identity = 211/212 (99.53%), Postives = 211/212 (99.53%), Query Frame = 2
Query:  980 RQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFVCGDFATEKDVLETFEKINLAAMNL 1615
            RQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSA SALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFVCGDFATEKDVLETFEKINLAAMNL
Sbjct:   15 RQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAVSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFVCGDFATEKDVLETFEKINLAAMNL 226          
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Match: SMESG000066844.1 (SMESG000066844.1)

HSP 1 Score: 426.787 bits (1096), Expect = 1.995e-144
Identity = 203/466 (43.56%), Postives = 298/466 (63.95%), Query Frame = 2
Query:  200 MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDVLETFEKI 1594
            M+ E+FR + KE++DFV +Y +NI + +V P VEPGYL K++ +  P    E+D IM  V + I+PG+THWHHP+F+A++P A S+ +  G +LS G  C+G  W  SP CTELE++++DWL K +QLP+ FLS S +GGG I ++ SEAT + L+  RN+ I+  ++EN N     I+ K+  Y+S QAHSSVERA ++S++K + + + + + +    L   IK+D E+   P   V + G+T  CAFD+L +IG IC    +  HVDAAYAGS LIC E+++L  G+EY  SF FNPHK +  +FDCS +W  +        +++P+YL H  EG   + RHW I LGRRFR+LK+WFVL ++G+  +Q+ IR H+KLA +F   +   + FE+V  V  GLVCF++K  NE  +EL++ ++ D  I +  S F   +  +LRF VC  FATE  V   +  I
Sbjct:   26 MDAEEFRKRGKEMIDFVANYLENIDELKVFPQVEPGYLHKMISADPPIKPEEWDNIMNDVNSVIMPGITHWHHPHFHAYFPAANSYAAMCGDILSGGIGCIGFTWASSPACTELEVVMMDWLAKMLQLPKDFLSESGTGGGVIYNTCSEATFVALLAARNKAIEFRRKENLNEDQYTIMSKLVGYYSDQAHSSVERAGLLSMIKMREVKSIKRK-MRGSVLQEMIKEDLENGFYPFYCVATLGTTGSCAFDSLDEIGPICEAHQIWLHVDAAYAGSALICQEYRHLLDGIEYAMSFVFNPHKWMLVNFDCSAVWFKDSRFVVETFTVDPVYLKHKKEGKCPDFRHWHIQLGRRFRSLKIWFVLRLYGVDGIQKYIRNHIKLAHLFEKLMLGDDRFEIVEEVTMGLVCFRLKGNNEINKELYSRIEGDGRIHIVTSEFSDTDTLYLRFAVCYQFATEDHVKYAYGTI 490          
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 375.941 bits (964), Expect = 3.928e-122
Identity = 195/480 (40.62%), Postives = 285/480 (59.38%), Query Frame = 2
Query:  194 IAMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQ---------ENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELK---------LDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            + M+ E FR+  KE+VD++  Y   I Q  V+P+V PGYL KL+P+  P++  ++  I+  V   I+PG+THW HP F+A++P+   FPS +G M+SD   C+G +W  SP CTELE+++LDWL K M LP EF  S    GGG I  SAS+  L+ ++  R+  IK+ K          E     +G IL ++  Y S  AH+ VE+A +IS +K   +  D+  S+    L   I++DKE  LIP MVV + G+T  C+FDNL +I  +C++  +  HVDAAYAGS  ICPEFQ+  KG+E V+S  FN +K L  +FDCS+LW         ++ ++P+YL H       + RHW IPL RRFR+LKLWF +  +G++ LQ+ IR HV+LA  F   + +++ FE+V  V  GLVCF++KS   +     NEL          ++ S  L ++    K+ + LRF VC + A+ +DV
Sbjct:    5 LLMDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVKDKYILRFCVCSEHASSEDV 484          
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 376.711 bits (966), Expect = 5.022e-122
Identity = 195/480 (40.62%), Postives = 285/480 (59.38%), Query Frame = 2
Query:  194 IAMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQ---------ENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELK---------LDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            + M+ E FR+  KE+VD++  Y   I Q  V+P+V PGYL KL+P+  P++  ++  I+  V   I+PG+THW HP F+A++P+   FPS +G M+SD   C+G +W  SP CTELE+++LDWL K M LP EF  S    GGG I  SAS+  L+ ++  R+  IK+ K          E     +G IL ++  Y S  AH+ VE+A +IS +K   +  D+  S+    L   I++DKE  LIP MVV + G+T  C+FDNL +I  +C++  +  HVDAAYAGS  ICPEFQ+  KG+E V+S  FN +K L  +FDCS+LW         ++ ++P+YL H       + RHW IPL RRFR+LKLWF +  +G++ LQ+ IR HV+LA  F   + +++ FE+V  V  GLVCF++KS   +     NEL          ++ S  L ++    K+ + LRF VC + A+ +DV
Sbjct:   34 LLMDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVKDKYILRFCVCSEHASSEDV 513          
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Match: SMESG000019737.1 (SMESG000019737.1)

HSP 1 Score: 376.711 bits (966), Expect = 5.917e-122
Identity = 195/480 (40.62%), Postives = 285/480 (59.38%), Query Frame = 2
Query:  194 IAMEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQIEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFACVGLNWQGSPVCTELEILVLDWLVKAMQLP-EFFLSTSESGGGTILSSASEATLMVLIIERNEMIKKTKQ---------ENPNLSDGEILDKMRIYFSKQAHSSVERACIISLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAFDNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNPHKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPLGRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHRVDFGLVCFKMKSGNEKTRELHNELK---------LDHSIFLSLSIFEKKNWFFLRF-VCGDFATEKDV 1573
            + M+ E FR+  KE+VD++  Y   I Q  V+P+V PGYL KL+P+  P++  ++  I+  V   I+PG+THW HP F+A++P+   FPS +G M+SD   C+G +W  SP CTELE+++LDWL K M LP EF  S    GGG I  SAS+  L+ ++  R+  IK+ K          E     +G IL ++  Y S  AH+ VE+A +IS +K   +  D+  S+    L   I++DKE  LIP MVV + G+T  C+FDNL +I  +C++  +  HVDAAYAGS  ICPEFQ+  KG+E V+S  FN +K L  +FDCS+LW         ++ ++P+YL H       + RHW IPL RRFR+LKLWF +  +G++ LQ+ IR HV+LA  F   + +++ FE+V  V  GLVCF++KS   +     NEL          ++ S  L ++    K+ + LRF VC + A+ +DV
Sbjct:   37 LLMDLEDFRINGKELVDYICTYLATIEQRRVIPNVSPGYLSKLMPNEPPKSPEQWANILHDVDKLIMPGITHWQHPRFHAYFPSGNCFPSIMGDMVSDAIGCIGFSWAASPACTELEMIMLDWLAKMMNLPKEFMHSEGLGGGGVIQGSASDCILVCMLSARHYAIKEAKTKLFHKSESIEKTRSFEGAILTRLVGYCSSLAHACVEKAGMISFVKIHQLDVDDEYSLRGATLEEAIERDKELGLIPFMVVATLGTTGCCSFDNLEEISLVCKKYNIWLHVDAAYAGSSFICPEFQHYLKGIENVDSISFNTNKFLLVNFDCSILWIRKCSQITDSMIVDPVYLQHKHSSKAVDFRHWGIPLSRRFRSLKLWFTIRAYGVEGLQKYIRNHVRLASEFEALVRKNDRFEIVGTVVLGLVCFRLKSNASEYFFSKNELNSINQCLIRTINESGKLHMTPSVVKDKYILRFCVCSEHASSEDV 516          
The following BLAST results are available for this feature:
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDC9.086e-14142.23dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
DDC9.086e-14142.23dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
HDC2.325e-13140.08histidine decarboxylase [Source:HGNC Symbol;Acc:HG... [more]
DDC1.477e-11838.03dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
DDC2.459e-11438.45dopa decarboxylase [Source:HGNC Symbol;Acc:HGNC:27... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdc-11.747e-13943.28Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
tdc-11.747e-13943.28Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
tdc-15.444e-13943.28Tyrosine decarboxylase [Source:UniProtKB/Swiss-Pr... [more]
bas-11.914e-10434.06Biogenic Amine Synthesis related [Source:UniProtK... [more]
bas-17.652e-10333.27Biogenic Amine Synthesis related [Source:UniProtK... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tdc24.407e-13843.44gene:FBgn0050446 transcript:FBtr0086142[more]
Ddc7.353e-13641.47gene:FBgn0000422 transcript:FBtr0081167[more]
Ddc1.602e-13541.61gene:FBgn0000422 transcript:FBtr0290291[more]
Ddc1.602e-13541.61gene:FBgn0000422 transcript:FBtr0081166[more]
Tdc12.734e-12841.15gene:FBgn0259977 transcript:FBtr0086143[more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc6.445e-13944.12dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
hdc2.214e-13240.93histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc5.802e-12139.66histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
csad5.147e-2726.02cysteine sulfinic acid decarboxylase [Source:ZFIN;... [more]
csad1.280e-2626.02cysteine sulfinic acid decarboxylase [Source:ZFIN;... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc1.029e-14445.37dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc1.172e-14445.37dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc1.427e-14445.37dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
ddc2.571e-13844.20dopa decarboxylase [Source:NCBI gene;Acc:496742][more]
r3hdm28.484e-13539.67R3H domain containing 2 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddc1.082e-14244.04dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Ddc1.082e-14244.04dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Ddc1.082e-14244.04dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
Hdc7.017e-12939.78histidine decarboxylase [Source:MGI Symbol;Acc:MGI... [more]
Ddc9.404e-7443.48dopa decarboxylase [Source:MGI Symbol;Acc:MGI:9487... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P14173|DDC_RAT5.614e-14744.47Aromatic-L-amino-acid decarboxylase OS=Rattus norv... [more]
sp|O88533|DDC_MOUSE7.570e-14244.04Aromatic-L-amino-acid decarboxylase OS=Mus musculu... [more]
sp|P22781|DDC_CAVPO1.652e-14142.65Aromatic-L-amino-acid decarboxylase OS=Cavia porce... [more]
sp|P20711|DDC_HUMAN4.364e-14042.23Aromatic-L-amino-acid decarboxylase OS=Homo sapien... [more]
sp|Q95ZS2|TDC1_CAEEL6.925e-13843.28Tyrosine decarboxylase OS=Caenorhabditis elegans O... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A6P4D40.000e+073.94Aromatic amino acid decarboxylase OS=Dugesia japon... [more]
I7H1884.694e-15047.94Dopamine decarboxylase OS=Lymnaea stagnalis OX=652... [more]
C3ZRR83.607e-14945.15Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A067RL115.903e-14945.01Aromatic-L-amino-acid decarboxylase OS=Zootermopsi... [more]
A0A1S3KCH47.155e-14845.87aromatic-L-amino-acid decarboxylase-like OS=Lingul... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc6.430e-13045.27dopa decarboxylase [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
hdc1.330e-12941.05histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
hdc2.939e-12840.61histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
hdc2.939e-12840.61histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
hdc2.939e-12840.61histidine decarboxylase [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdc1.803e-11137.18histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc2.787e-10739.63histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc1.528e-8834.38histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
hdc2.050e-7836.57histidine decarboxylase [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000005196.14.423e-2433.97pep scaffold:Pmarinus_7.0:GL479731:26751:28782:1 g... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434111.710e-12539.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433926.366e-11939.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddc8.697e-14042.92dopa decarboxylase [Source:NCBI gene;Acc:100301599... [more]
ddc1.500e-13642.56dopa decarboxylase [Source:NCBI gene;Acc:100301599... [more]
hdc1.392e-12739.71histidine decarboxylase [Source:NCBI gene;Acc:1011... [more]
GADL11.152e-2222.45glutamate decarboxylase like 1 [Source:NCBI gene;A... [more]
GADL11.339e-2222.45glutamate decarboxylase like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Aromatic amino acid decarboxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058665.15.017e-15499.53SMESG000058665.1[more]
SMESG000066844.11.995e-14443.56SMESG000066844.1[more]
SMESG000019737.13.928e-12240.63SMESG000019737.1[more]
SMESG000019737.15.022e-12240.63SMESG000019737.1[more]
SMESG000019737.15.917e-12240.63SMESG000019737.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013807 ID=SMED30013807|Name=Aromatic amino acid decarboxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=1690bp
GTTGAGAGCACGAATAAAATTTTCTAAAAACCGGAAATGTAGTCCCTTGA
AACAAGTTAGTAATTCGATATCGCAGCGGAAACACAATTCTTGAATACGT
CATATAAAGTTCAATTGGCTTTTGCTGTGATCAATTTAGTATTTAATTGT
ATTACTGATAAATAAAGTTCAATTATATTTTTATTGAATCAAAATTGCAA
TGGAGGGAGAACAATTTCGAGTACAGGCTAAAGAAATCGTGGATTTTGTC
GTGGATTATTATAAAAATATCGGACAATTTGAAGTGTTACCTTCGGTCGA
GCCGGGATATTTACAAAAATTGTTACCGAGTTCAGCTCCAGAAAACCAAA
TCGAATTCGATGAAATCATGAAATATGTCAAAAATGCCATTTTGCCAGGG
ATGACTCATTGGCATCATCCGAATTTCTACGCGTTTTATCCAACGGCGTT
TTCTTTCCCATCTTTTCTTGGATCAATGCTATCTGACGGATTTGCATGCG
TTGGACTAAACTGGCAAGGATCTCCCGTATGCACTGAATTGGAGATTTTA
GTACTAGATTGGTTAGTAAAGGCAATGCAATTGCCGGAGTTCTTTTTATC
AACCAGCGAATCTGGTGGAGGGACGATTCTCAGTTCAGCAAGTGAAGCAA
CTCTTATGGTCTTAATAATCGAAAGAAATGAAATGATTAAAAAGACGAAA
CAAGAAAATCCAAATTTGTCAGATGGGGAAATTTTAGATAAAATGCGAAT
ATATTTCTCCAAACAAGCTCACAGCTCAGTCGAAAGGGCCTGCATAATAA
GTTTGTTAAAATTCAAAATAATAGGCACAGATGAAAATGAAAGCATAGAC
ACAGATGAATTATGCAGGGAGATAAAGAAGGATAAAGAAGACAATCTGAT
TCCTTTAATGGTGGTTACTTCATTTGGATCAACGTCGTTATGCGCTTTTG
ATAATTTATTTGACATAGGACAGATATGTAGACAAGTCGGGGTTAAATGC
CATGTCGACGCAGCATATGCTGGTTCGTGCTTGATATGCCCGGAATTTCA
ATATCTCGCCAAAGGAATGGAATATGTTAATTCATTTTGTTTCAATCCAC
ACAAAATTCTAAAGACTCACTTCGATTGTTCAGTTTTGTGGACAGATAAT
AGGCACTCGGCCGGATCTGCGCTAAGTATCAATCCGTTGTATTTGTCTCA
TGATTTTGAAGGAACTACCACAGAACTTCGACACTGGCAAATTCCTCTGG
GGCGTCGTTTTAGAGCTCTAAAACTTTGGTTTGTCTTGAATATGTTTGGA
TTAAAGAATCTTCAGGAATCAATCAGACAACATGTTAAGCTCGCCGGAAT
ATTTGCTGATAAAATAAACGAAAGTGAATTATTTGAATTAGTCCATCGAG
TGGATTTCGGACTGGTTTGCTTTAAAATGAAGAGCGGTAATGAGAAAACC
CGAGAATTGCACAATGAACTAAAGCTGGATCATTCCATTTTTTTGAGTTT
GAGCATTTTTGAAAAAAAAAATTGGTTTTTTCTGCGATTTGTTTGCGGAG
ATTTTGCAACAGAAAAGGATGTTTTAGAAACATTTGAAAAAATAAATCTG
GCAGCAATGAATTTGTGAAATTTACATTTTTTAAAATATGCAAAAGGATT
TTTAAGATGTTAAGTTAAAAGTATTTGTGTTTGAGTAATC
back to top

protein sequence of SMED30013807-orf-1

>SMED30013807-orf-1 ID=SMED30013807-orf-1|Name=SMED30013807-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=473bp
MEGEQFRVQAKEIVDFVVDYYKNIGQFEVLPSVEPGYLQKLLPSSAPENQ
IEFDEIMKYVKNAILPGMTHWHHPNFYAFYPTAFSFPSFLGSMLSDGFAC
VGLNWQGSPVCTELEILVLDWLVKAMQLPEFFLSTSESGGGTILSSASEA
TLMVLIIERNEMIKKTKQENPNLSDGEILDKMRIYFSKQAHSSVERACII
SLLKFKIIGTDENESIDTDELCREIKKDKEDNLIPLMVVTSFGSTSLCAF
DNLFDIGQICRQVGVKCHVDAAYAGSCLICPEFQYLAKGMEYVNSFCFNP
HKILKTHFDCSVLWTDNRHSAGSALSINPLYLSHDFEGTTTELRHWQIPL
GRRFRALKLWFVLNMFGLKNLQESIRQHVKLAGIFADKINESELFELVHR
VDFGLVCFKMKSGNEKTRELHNELKLDHSIFLSLSIFEKKNWFFLRFVCG
DFATEKDVLETFEKINLAAMNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR010977Aromatic_deC
IPR015421PyrdxlP-dep_Trfase_major
IPR015422PyrdxlP-dep_Trfase_dom1
IPR002129PyrdxlP-dep_de-COase
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0006520cellular amino acid metabolic process
GO:0019752carboxylic acid metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016831carboxy-lyase activity
GO:0003824catalytic activity
GO:0030170pyridoxal phosphate binding
GO:0016829lyase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010977Aromatic-L-amino-acid decarboxylasePRINTSPR00800YHDCRBOXLASEcoord: 94..112
score: 48.72
coord: 392..411
score: 40.71
coord: 29..46
score: 59.84
coord: 6..25
score: 47.57
coord: 139..159
score: 46.67
coord: 73..92
score: 43.29
coord: 113..132
score: 53.14
coord: 349..364
score: 74.46
coord: 47..66
score: 26.57
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 83..376
e-value: 1.3E-96
score: 325.1
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 377..472
e-value: 4.3E-17
score: 63.8
IPR002129Pyridoxal phosphate-dependent decarboxylasePFAMPF00282Pyridoxal_deCcoord: 35..411
e-value: 2.5E-117
score: 391.7
NoneNo IPR availableGENE3DG3DSA:1.20.1340.10coord: 1..81
e-value: 5.2E-32
score: 112.3
NoneNo IPR availablePANTHERPTHR11999:SF144MIP05841Pcoord: 1..469
NoneNo IPR availablePANTHERPTHR11999GROUP II PYRIDOXAL-5-PHOSPHATE DECARBOXYLASEcoord: 1..469
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 1..462