slc15a-3

Overview
Nameslc15a-3 (AKN21489.1)
Smed IDSMED30013800
Length (bp)2145
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc15a-3 (SMED30013800) t-SNE clustered cells

Violin plots show distribution of expression levels for slc15a-3 (SMED30013800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc15a-3 (SMED30013800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc15a-3 (SMED30013800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30013800SMESG000042203.1 dd_Smed_v4_4941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013800SMESG000042203.1 dd_Smed_v4_4941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013800SMESG000042203.1 dd_Smed_v4_4941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013800SMESG000042203.1 dd_Smed_v6_4941_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
proximal tubuleSMED30013800SMESG000042203.1 Smed-slc15a-3smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc15a-3 vs. Ensembl Human
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 341.658 bits (875), Expect = 1.504e-106
Identity = 206/671 (30.70%), Postives = 367/671 (54.69%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLA----SNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCS----------------SPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ IL +Y   ++ ++DN +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  + ++++I                 +++  LIG++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TP+LR     +  +  CYPL FGVPA +  V  I+F+ G   Y       +++ K + CI  +I+N  + +  +  K       A+ +Y  + I   K   R+M ++ P+P+FWAL+DQQGSRWTLQA  M+GKI  +  ++P+Q+Q++NA+LI+ ++P+FD ++YP   K         ++    ++A+++F++A  +Q+ + +   + F       + + +I +  +N+++    + L     +N  +  D+N  L ++++   G  +        Q +     ++  N+ ++       K    +N IRF+N  N+ + I M        +  + +N SS +   Y+ + S                 PN+N +          +V      S  ++  +++   N ++M  Q+PQY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCIGFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQGSRWTLQATTMSGKI-GALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKKMAVGMVLASMAFVVAAIVQVEIDKTLPV-FPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNK-LTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITM--------SGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIV-QRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMAR 668          
BLAST of slc15a-3 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 315.849 bits (808), Expect = 1.213e-96
Identity = 225/655 (34.35%), Postives = 366/655 (55.88%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILG--------PLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXX--XXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTI---DNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQY-----KMTGGY---IYKDNNARIDIKSYFVKSPDSQ-----NHIRFLNP-NDPVNIEM-----LRLAKDHKNFTIDSNYSSLDVGVY-EIYCSSPNYN-EYKCGNVDVTPGLVGSLMMTSERKLHFWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F T+I + LVY+LGHV+ +L A+   ILG         LIG+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C    CY L FGVP  + ++  ++F  G + Y   P   +++++   CI+ +I N  K +   I K +  L++A  +Y  + I D K   R++ ++ P+P+FWAL DQQGSRWTLQA  MN + +  + ++P+Q+Q +N LL++  IP+FDF+IY    K  I      ++    I+A L+F +A  ++I +      +       L ++N  +D ++ +T+   +N  +++ S  S     +   + +  K   +   +K   LS Y     +    Y   I +D N+   I S  VK  +S+       +RF+N  +  VNI +     L + +D+      S Y ++  G Y  ++C + + N     G +D     +  +   + + L  WK  +   N + + WQ+PQY L+T  E++ S+T L F+YS++P SMKS++QA +L+TI  GNIIV+ VA   S L Q  EF LF+ L+L+
Sbjct:   42 YPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALP--ILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMN-RNLGFFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADD-EVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLVIREDGNS---ISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYG----VSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQF-SGLVQWAEFILFSCLLLV 684          
BLAST of slc15a-3 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 310.457 bits (794), Expect = 7.486e-95
Identity = 211/647 (32.61%), Postives = 347/647 (53.63%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXX--XXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTI---DNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQY-----KMTGGY---IYKDNNARIDIKSYFVKSPDSQ-----NHIRFLNP-NDPVNIEM-----LRLAKDHKNFTIDSNYSSLDVGVY-EIYCSSPNYN-EYKCGNVDVTPGLVGSLMMTSERKLHFWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F  +                          LIG+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C    CY L FGVP  + ++  ++F  G + Y   P   +++++   CI+ +I N  K +   I K +  L++A  +Y  + I D K   R++ ++ P+P+FWAL DQQGSRWTLQA  MN + +  + ++P+Q+Q +N LL++  IP+FDF+IY    K  I      ++    I+A L+F +A  ++I +      +       L ++N  +D ++ +T+   +N  +++ S  S     +   + +  K   +   +K   LS Y     +    Y   I +D N+   I S  VK  +S+       +RF+N  +  VNI +     L + +D+      S Y ++  G Y  ++C + + N     G +D     +  +   + + L  WK  +   N + + WQ+PQY L+T  E++ S+T L F+YS++P SMKS++QA +L+TI  GNIIV+ VA   S L Q  EF LF+ L+L+
Sbjct:   42 YPLSIAFIVVNEFCERFSYYGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKVLS-------------------------LIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSKIYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALTRVLFLYIPLPMFWALLDQQGSRWTLQAIRMN-RNLGFFVLQPDQMQVLNPLLVLIFIPLFDFVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLNLADD-EVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLVIREDGNS---ISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYG----VSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIVLVVAQF-SGLVQWAEFILFSCLLLV 653          
BLAST of slc15a-3 vs. Ensembl Human
Match: SLC15A2 (solute carrier family 15 member 2 [Source:HGNC Symbol;Acc:HGNC:10921])

HSP 1 Score: 111.694 bits (278), Expect = 5.161e-28
Identity = 69/151 (45.70%), Postives = 101/151 (66.89%), Query Frame = 2
Query:  173 MKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILG--------PLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC 601
            MK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F T+I + LVY+LGHV+ +L A+   ILG         LIG+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C
Sbjct:    1 MKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVIKSLGALP--ILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEERTRYFSVFYLSINAGSLISTFITPMLRGDVQC 149          
BLAST of slc15a-3 vs. Ensembl Human
Match: SLC15A4 (solute carrier family 15 member 4 [Source:HGNC Symbol;Acc:HGNC:23090])

HSP 1 Score: 87.8113 bits (216), Expect = 2.422e-17
Identity = 88/393 (22.39%), Postives = 163/393 (41.48%), Query Frame = 2
Query:  122 CWIILIHEVLERFSFYGMKGILAIYLN-LYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK------------NILGP-------------LIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCK---------------KAL-RIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQS-----INALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQ 1159
            C  +L+ E+LER +FYG+   L ++LN     +     +    LF+GL+YL   FG  +AD  LGR   +++   +YLLG +   L A               N   P               G+ ++ +G   +K+++  FG DQV         ++F+ FY +INLGA  +      +++++S V       G+ +P     + +++F+ G+  +   P   S  +     +  S  +  +  +       +   Q        D CK               KAL +I+ VF  +  +W +Y Q  + + LQ+ ++    +++    P  + +      +A+LI+ LIP+ D ++ P   +  +L     R+         S   AG L+
Sbjct:   37 CGAVLLTELLERAAFYGITSNLVLFLNGAPFCWEGAQASEALLLFMGLTYLGSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRAALCGSARLLNCTAPGPDAAARCCSPATFAGLVLVGLGVATVKANITPFGADQVKDRGPEATRRFFNWFYWSINLGAILSLGGIAYIQQNVSFVT------GYAIPTVCVGLAFVVFLCGQSVFITKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVKALVKIVPVFLALIPYWTVYFQMQTTYVLQSLHLRIPEISNITTTPHTLPAAWLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILE 423          
BLAST of slc15a-3 vs. Ensembl Celegans
Match: pept-3 (Peptide transporter 3 [Source:UniProtKB/Swiss-Prot;Acc:O01840])

HSP 1 Score: 273.092 bits (697), Expect = 2.827e-81
Identity = 211/676 (31.21%), Postives = 336/676 (49.70%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQ------KNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCV-DGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKS-VLSKFSHCIYVSIRNXXXXXXXXXXXXX-XXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDC---KLNLTIDNRRIM--LASNGSVNLD-----LNPGL------VQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEY-----KCGNVDVTPGLVGSLMMTSERKLHFWKE---------FEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDN 2020
            +P   + +L +E  ERFSFYGMK IL IYL     F+ +  T +YHLF  ++YL+P+ G+I+AD+  GRF  ++    +Y++GHVL++L A+       ++ L    G+ ++A  +G IK  V+AF  DQ       +  ++FS FY AIN G+  A  +TPILR  + C  +  C+PL FGVP  + L+  I+F+ G   Y   P SK  V SK    IY S+R  +      K  +  L++A PE+S K ID  +  L + ++F P+  FWAL+DQQGS W LQA+ ++G+ V  +++ PEQI +IN + ++ L+P+F+  +YP   K    V P  ++    ++ A SF IAG LQ+ +   + +EF  +  ++ +    N+          D R I   +   G   LD      N GL      + +S    GY + V  L             KD    +       K+ +    +  +   +  +  +  + K  K  +     S   V V     S PN   Y      C  VD    +  +  M +   LH               PN + +LW +PQYI+IT  E+L S+T L FAYS++  +MKS++ A++L+T+F GN+I + ++G         EFF ++TL++I   +  +L   +   +DN
Sbjct:   13 YPPAVFFMLGNEFCERFSFYGMKTILFIYLITEHEFSPSKATFIYHLFTCIAYLTPLIGSIMADSVFGRFKVILYGSSIYVVGHVLLSLGAVPFLSYPIRSSLD-FSGLFVIAFATGCIKPCVSAFAADQFTEDQKDLRSQFFSFFYFAINGGSLFAIIITPILRGRVQCFGNAHCFPLAFGVPGVLMLLALILFLMGWSMYKKHPPSKENVGSKVVAVIYTSLRKMVGGASRDKPVTHWLDHAAPEHSQKMIDSTRGLLNVAVIFCPLIFFWALFDQQGSTWVLQARRLDGR-VGHFSILPEQIHAINPVCVLILVPIFEGWVYPALRKIT-RVTPLRKMAVGGLLTAFSFAIAGVLQLKV--NETMEFPPSLGRIYLQRVGNESLISDFRYKSDGRLIGDGMLPKGRTELDAGIYTFNTGLKNESQEIDISTPNKGYVMAVFRL-------------KDAVEVVKFDYKVEKTDNGATRVFVVTAREDADTLVYAINKKGKILSSCELKSGSYVDVIPGIISDPNVRLYWGPKNSCSGVDCPNTVTLNAQMGAVHVLHIHPSTTEGDFNLLVRPNSVSILWSLPQYIIITLGEVLLSVTGLEFAYSQAAPNMKSVLTAMWLLTVFAGNLIDMMISGTRLIPHPALEFFFYSTLMVIVMGVFILLAMQYTYVEDN 670          
BLAST of slc15a-3 vs. Ensembl Celegans
Match: pept-1 (Peptide transporter family 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21219])

HSP 1 Score: 231.491 bits (589), Expect = 4.060e-65
Identity = 130/377 (34.48%), Postives = 219/377 (58.09%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQ--KNILGP---LIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXX--------------XXXXXXXXXXXXXAQPE-------YSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQI 1162
            +P     I+ +E  ERFS+YGM+ +L  YL   L F D+ +T+ ++ F  L Y +P+ G+I+AD Y+G+F+T+  V ++Y +G V++ L + +  ++ + P   L G+ I+A G+GGIK  V+AFGGDQ   G + M+  +FS+FY +IN G+  + F++PI R         CYP+ FG+PA + +V  ++F+ G   Y   P   +V  + S  ++ ++ N +K                      +     Q E          KFIDD +  LR++++F P+P+FWALYDQQGS W +QA  M+ ++ ++  + P+Q+Q++NA+LI+  IP+F  IIYP   K  + + P  ++V   ++A+L+F+I GF+Q+
Sbjct:   44 WPKTTLCIVSNEFCERFSYYGMRTVLTFYLLNVLKFTDSQSTIFFNGFTVLCYTTPLLGSIVADGYIGKFWTIFSVSILYAIGQVVLALASTKNFQSSVHPWMDLSGLLIIAFGTGGIKPCVSAFGGDQFELGQERMLSLFFSMFYFSINAGSMISTFISPIFRSQPCLGQDSCYPMAFGIPAILMIVATLVFMGGSFWYKKNPPKDNVFGEVSRLMFRAVGNKMKSGSTPKEHWLLHYLTTHDCALDAKCLELQAEKRNKNLCQKKKFIDDVRSLLRVLVMFLPVPMFWALYDQQGSVWLIQAIQMDCRLSDTLLLLPDQMQTLNAVLILLFIPLFQVIIYPVAAKC-VRLTPLRKMVTGGLLASLAFLITGFVQL 419          

HSP 2 Score: 73.9442 bits (180), Expect = 2.740e-13
Identity = 37/92 (40.22%), Postives = 59/92 (64.13%), Query Frame = 2
Query: 1691 KLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            K+H  +  + N + +LWQ+PQ ++IT AEIL SIT   FAYS+S  SMK+L+QA++L+T   G+ I+V +  +        EFF++A  + +
Sbjct:  683 KIHELQIVQSNSVSILWQIPQIVVITAAEILFSITGYEFAYSQSAPSMKALVQALWLLTTAAGDSIIVVITILNLFENMAVEFFVYAAAMFV 774          
BLAST of slc15a-3 vs. Ensembl Celegans
Match: pept-2 (Peptide transporter family 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17758])

HSP 1 Score: 215.698 bits (548), Expect = 8.758e-60
Identity = 139/415 (33.49%), Postives = 230/415 (55.42%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI-----QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCV-DGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSM---------------------KFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR 1270
            K+P   ++I+ +E+ ERFSFYGM+ +L +Y    L F+ + +TVL+H F  + Y SP+ G+I+AD Y+G+F+T+  + + Y  G +L+  ++I       + L  L+G+ I+ +G+GGIK  V+AFGGDQ P     MI  +FS+FY +IN G+  + ++TP  R  +SC     CYPL FG+PA + +V  ++F++G   Y  VP  ++++ K    I  ++R         +    L     EYS+                     ++I+D K+  R++++  P+P+FWALYDQQGS W LQA  M+ K+   + + P+Q+  +NA LI+  IP+F  I+YP   K    +    ++    I+ A+SF + G +Q+++            + L IIN+I  C  N+ ID+R 
Sbjct:   29 KWPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLGSILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSHHPLLDLLGLLIVGLGTGGIKPCVSAFGGDQFPAHYTRMISLFFSMFYFSINAGSLISMWLTPYFRS-MSCFGHDSCYPLAFGIPAILMIVATLVFMAGSFWYKKVPPKENIIFKVIGTITTALRKKASSSSTHQRSHWL-----EYSLDGHDCALSTECKNLHGNCAQRRYIEDIKRLFRVIVMMIPVPMFWALYDQQGSTWVLQAVGMDAKVFG-FEILPDQMGVLNAFLILFFIPIFQSIVYPTIEKLGFQMTMLRKMAGGGILTAVSFFVCGIVQLFVNPTLPYIPMANEAHLTIINTIPSCDFNVLIDSRE 436          

HSP 2 Score: 64.6994 bits (156), Expect = 1.842e-10
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = 2
Query: 1721 NLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVL 1963
            N + +LWQ+PQY+++T  E+L SIT L FAY+E+   +KS++QA++L T   G++IVV +  +        + F+F  ++L
Sbjct:  666 NRVSILWQIPQYVILTAGEVLFSITGLEFAYTEASPQLKSVVQALWLFTTAIGDLIVVVIFMLNIFSDVAVQMFVFGGIML 746          
BLAST of slc15a-3 vs. Ensembl Celegans
Match: pept-2 (Peptide transporter family 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17758])

HSP 1 Score: 215.698 bits (548), Expect = 8.758e-60
Identity = 139/415 (33.49%), Postives = 230/415 (55.42%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI-----QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCV-DGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSM---------------------KFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR 1270
            K+P   ++I+ +E+ ERFSFYGM+ +L +Y    L F+ + +TVL+H F  + Y SP+ G+I+AD Y+G+F+T+  + + Y  G +L+  ++I       + L  L+G+ I+ +G+GGIK  V+AFGGDQ P     MI  +FS+FY +IN G+  + ++TP  R  +SC     CYPL FG+PA + +V  ++F++G   Y  VP  ++++ K    I  ++R         +    L     EYS+                     ++I+D K+  R++++  P+P+FWALYDQQGS W LQA  M+ K+   + + P+Q+  +NA LI+  IP+F  I+YP   K    +    ++    I+ A+SF + G +Q+++            + L IIN+I  C  N+ ID+R 
Sbjct:   29 KWPKQTFLIVGNELCERFSFYGMRAVLTLYFFNILNFSQSFSTVLFHAFTVICYSSPLLGSILADGYIGKFWTIFFISIFYACGQILLAFSSIAPSGSSHHPLLDLLGLLIVGLGTGGIKPCVSAFGGDQFPAHYTRMISLFFSMFYFSINAGSLISMWLTPYFRS-MSCFGHDSCYPLAFGIPAILMIVATLVFMAGSFWYKKVPPKENIIFKVIGTITTALRKKASSSSTHQRSHWL-----EYSLDGHDCALSTECKNLHGNCAQRRYIEDIKRLFRVIVMMIPVPMFWALYDQQGSTWVLQAVGMDAKVFG-FEILPDQMGVLNAFLILFFIPIFQSIVYPTIEKLGFQMTMLRKMAGGGILTAVSFFVCGIVQLFVNPTLPYIPMANEAHLTIINTIPSCDFNVLIDSRE 436          

HSP 2 Score: 64.6994 bits (156), Expect = 1.842e-10
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = 2
Query: 1721 NLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVL 1963
            N + +LWQ+PQY+++T  E+L SIT L FAY+E+   +KS++QA++L T   G++IVV +  +        + F+F  ++L
Sbjct:  666 NRVSILWQIPQYVILTAGEVLFSITGLEFAYTEASPQLKSVVQALWLFTTAIGDLIVVVIFMLNIFSDVAVQMFVFGGIML 746          
BLAST of slc15a-3 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070608)

HSP 1 Score: 337.421 bits (864), Expect = 2.478e-104
Identity = 229/681 (33.63%), Postives = 381/681 (55.95%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLP--CWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPL---------IGMSILAIGSGGIKSSVAAFGGDQVPTGNDM-MIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDG-QCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTID--------NRRIMLASNGSVNLDLNPGLVQVSMKCVG---------------YQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKS-PDSQNHIRFLNPNDPVNIEMLRL-AKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            +++ E   F  +S    +  K P P   + I+ +E  ERF++YGM+ +L +YL+  LG++D+  TV++H+F    Y   +FGAII+D++LG+F T++ + LVY+ G VL+TL AI     GPL         +G++++A+GSGGIK  V+AFGGDQ      +  I  +FSLFY +IN G+  +  VTPILR+D+SC D   CYPL FGVPA + +V+ IIF+ G+  Y + P + +++   S  I+ ++    KEKK +  +  L+YA  +Y  + IDD K  +R++ ++ P+PVFWAL+DQQGSRWT QA  M+G +  S+++KP+Q+Q +N LLI+  IP++D  +YP   K   + +P  +L    I+A ++FII+G +++ L     +  ++  ++L + + I DC    + +         R +    +GSV  + + G+ Q++                    Y+    +L L        + Y+D   + +    FV++  +     R +   D  +   L L A++H  +        L  G Y +  +  N       ++++  G V +L++         +  E   PN +HMLW +PQY+++T  E++ S+T L F+YS+SP SMKS++QA +L+T+  GN+IVV VA +    +Q +EFFLFA L+ +
Sbjct:  101 KELAETNDFKNVSETEGQQKKLPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAI-----GPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDM-GSWDIKPDQLQVLNPLLILIFIPLYDVALYPAL-KLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEHTYPLIPSSGNTQLRVFSGIPDCDYRFSTNLGARESFTLRGLDFYYSGSVATNTD-GIFQLTYTVESLTEGCAILEGGTQQLYEATAHSLFLRPSHAITKFWYEDEVQKSNRSWAFVRNLANLLATTRVVWREDSGDTVALDLPARNHDLY-------ELSTGGYNVQVADHNLT-----SIELRAGGVYALLIGQSHGTFVSRIIEVTSPNSMHMLWLVPQYVVMTLGEVMFSVTGLEFSYSQSPPSMKSVLQACWLLTVAFGNVIVVVVAELKFFDSQASEFFLFAGLMFV 761          
BLAST of slc15a-3 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070609)

HSP 1 Score: 330.872 bits (847), Expect = 7.656e-102
Identity = 235/695 (33.81%), Postives = 386/695 (55.54%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLP--CWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPL---------IGMSILAIGSGGIKSSVAAFGGDQVPTGNDM-MIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDG-QCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIR-------GQNIE---FNTAGSKLLIINSINDCKLNLTIDNRRIMLASN--GSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNY----NEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD-NFVEN 2032
            +++ E   F  +S    +  K P P   + I+ +E  ERF++YGM+ +L +YL+  LG++D+  TV++H+F    Y   +FGAII+D++LG+F T++ + LVY+ G VL+TL AI     GPL         +G++++A+GSGGIK  V+AFGGDQ      +  I  +FSLFY +IN G+  +  VTPILR+D+SC D   CYPL FGVPA + +V+ IIF+ G+  Y + P + +++   S  I+ ++    KEKK +  +  L+YA  +Y  + IDD K  +R++ ++ P+PVFWAL+DQQGSRWT QA  M+G +  S+++KP+Q+Q +N LLI+  IP++D  +YP   K   + +P  +L    I+A ++FII+G +++ L +        QNI+   FN         ++I   + N+T+ +       +     +LD+   L   S  C     ++  + L+       ++   N +    +  FV  P SQ+H    N     N+      +  K  T +  Y  L         +S  Y     E   G  DV  G V +L++     ++     E   PN + +LW +PQY+++T  E++ S+T L F+Y+++P SMKS++QA +L+T+  GN+IVV +A      +Q +EFFLFA L + A  + ++++  +++  D N VE 
Sbjct:  101 KELAETNDFKNVSETEGQQKKLPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAI-----GPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDM-GSWDIKPDQLQVLNPLLILIFIPLYDVALYPAL-KLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAE-NVTVTSLNAYTNKDIYAPGSLDVEFSLSSASEACTISADKIPKV-LTDNTAWSLFLNPLNGSGYYWEEDFVDKP-SQSHPLIRN---VANVPQELSIRWEKASTGEVVYDDLASKTLLTRVNSAEYVVMVGERNVGTFDVHTGGVYTLLIKDNNNIYEANLEEVTSPNSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGL-MFADMLIFMVMAYYYVPNDPNKVEE 781          
BLAST of slc15a-3 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0070610)

HSP 1 Score: 330.872 bits (847), Expect = 7.656e-102
Identity = 235/695 (33.81%), Postives = 386/695 (55.54%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLP--CWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPL---------IGMSILAIGSGGIKSSVAAFGGDQVPTGNDM-MIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDG-QCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIR-------GQNIE---FNTAGSKLLIINSINDCKLNLTIDNRRIMLASN--GSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNY----NEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD-NFVEN 2032
            +++ E   F  +S    +  K P P   + I+ +E  ERF++YGM+ +L +YL+  LG++D+  TV++H+F    Y   +FGAII+D++LG+F T++ + LVY+ G VL+TL AI     GPL         +G++++A+GSGGIK  V+AFGGDQ      +  I  +FSLFY +IN G+  +  VTPILR+D+SC D   CYPL FGVPA + +V+ IIF+ G+  Y + P + +++   S  I+ ++    KEKK +  +  L+YA  +Y  + IDD K  +R++ ++ P+PVFWAL+DQQGSRWT QA  M+G +  S+++KP+Q+Q +N LLI+  IP++D  +YP   K   + +P  +L    I+A ++FII+G +++ L +        QNI+   FN         ++I   + N+T+ +       +     +LD+   L   S  C     ++  + L+       ++   N +    +  FV  P SQ+H    N     N+      +  K  T +  Y  L         +S  Y     E   G  DV  G V +L++     ++     E   PN + +LW +PQY+++T  E++ S+T L F+Y+++P SMKS++QA +L+T+  GN+IVV +A      +Q +EFFLFA L + A  + ++++  +++  D N VE 
Sbjct:  101 KELAETNDFKNVSETEGQQKKLPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAI-----GPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDM-GSWDIKPDQLQVLNPLLILIFIPLYDVALYPAL-KLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAE-NVTVTSLNAYTNKDIYAPGSLDVEFSLSSASEACTISADKIPKV-LTDNTAWSLFLNPLNGSGYYWEEDFVDKP-SQSHPLIRN---VANVPQELSIRWEKASTGEVVYDDLASKTLLTRVNSAEYVVMVGERNVGTFDVHTGGVYTLLIKDNNNIYEANLEEVTSPNSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGL-MFADMLIFMVMAYYYVPNDPNKVEE 781          
BLAST of slc15a-3 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0340202)

HSP 1 Score: 330.872 bits (847), Expect = 7.656e-102
Identity = 235/695 (33.81%), Postives = 386/695 (55.54%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLP--CWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPL---------IGMSILAIGSGGIKSSVAAFGGDQVPTGNDM-MIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDG-QCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIR-------GQNIE---FNTAGSKLLIINSINDCKLNLTIDNRRIMLASN--GSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNY----NEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD-NFVEN 2032
            +++ E   F  +S    +  K P P   + I+ +E  ERF++YGM+ +L +YL+  LG++D+  TV++H+F    Y   +FGAII+D++LG+F T++ + LVY+ G VL+TL AI     GPL         +G++++A+GSGGIK  V+AFGGDQ      +  I  +FSLFY +IN G+  +  VTPILR+D+SC D   CYPL FGVPA + +V+ IIF+ G+  Y + P + +++   S  I+ ++    KEKK +  +  L+YA  +Y  + IDD K  +R++ ++ P+PVFWAL+DQQGSRWT QA  M+G +  S+++KP+Q+Q +N LLI+  IP++D  +YP   K   + +P  +L    I+A ++FII+G +++ L +        QNI+   FN         ++I   + N+T+ +       +     +LD+   L   S  C     ++  + L+       ++   N +    +  FV  P SQ+H    N     N+      +  K  T +  Y  L         +S  Y     E   G  DV  G V +L++     ++     E   PN + +LW +PQY+++T  E++ S+T L F+Y+++P SMKS++QA +L+T+  GN+IVV +A      +Q +EFFLFA L + A  + ++++  +++  D N VE 
Sbjct:  101 KELAETNDFKNVSETEGQQKKLPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAI-----GPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDM-GSWDIKPDQLQVLNPLLILIFIPLYDVALYPAL-KLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAE-NVTVTSLNAYTNKDIYAPGSLDVEFSLSSASEACTISADKIPKV-LTDNTAWSLFLNPLNGSGYYWEEDFVDKP-SQSHPLIRN---VANVPQELSIRWEKASTGEVVYDDLASKTLLTRVNSAEYVVMVGERNVGTFDVHTGGVYTLLIKDNNNIYEANLEEVTSPNSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGL-MFADMLIFMVMAYYYVPNDPNKVEE 781          
BLAST of slc15a-3 vs. Ensembl Fly
Match: CG2930 (gene:FBgn0028491 transcript:FBtr0340201)

HSP 1 Score: 331.257 bits (848), Expect = 8.107e-102
Identity = 235/695 (33.81%), Postives = 386/695 (55.54%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLP--CWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPL---------IGMSILAIGSGGIKSSVAAFGGDQVPTGNDM-MIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDG-QCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIR-------GQNIE---FNTAGSKLLIINSINDCKLNLTIDNRRIMLASN--GSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNY----NEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD-NFVEN 2032
            +++ E   F  +S    +  K P P   + I+ +E  ERF++YGM+ +L +YL+  LG++D+  TV++H+F    Y   +FGAII+D++LG+F T++ + LVY+ G VL+TL AI     GPL         +G++++A+GSGGIK  V+AFGGDQ      +  I  +FSLFY +IN G+  +  VTPILR+D+SC D   CYPL FGVPA + +V+ IIF+ G+  Y + P + +++   S  I+ ++    KEKK +  +  L+YA  +Y  + IDD K  +R++ ++ P+PVFWAL+DQQGSRWT QA  M+G +  S+++KP+Q+Q +N LLI+  IP++D  +YP   K   + +P  +L    I+A ++FII+G +++ L +        QNI+   FN         ++I   + N+T+ +       +     +LD+   L   S  C     ++  + L+       ++   N +    +  FV  P SQ+H    N     N+      +  K  T +  Y  L         +S  Y     E   G  DV  G V +L++     ++     E   PN + +LW +PQY+++T  E++ S+T L F+Y+++P SMKS++QA +L+T+  GN+IVV +A      +Q +EFFLFA L + A  + ++++  +++  D N VE 
Sbjct:  106 KELAETNDFKNVSETEGQQKKLPYPKSVFFIISNEFCERFNYYGMRTVLVLYLSRVLGYSDDTATVVFHIFTMFVYFLCVFGAIISDSWLGKFKTILYLSLVYICGSVLLTLGAI-----GPLNLPMETFTMLGLALIALGSGGIKPCVSAFGGDQFKVPEQVKQITSFFSLFYFSINAGSLISTTVTPILREDVSCFDDINCYPLAFGVPAVLMIVSVIIFVLGRSLYKMKPPAGNMVVLVSSTIWTALTTKCKEKKTNPREHWLDYADKKYDRQLIDDVKVLMRVLFLYLPLPVFWALFDQQGSRWTFQATRMDGDM-GSWDIKPDQLQVLNPLLILIFIPLYDVALYPAL-KLVGIRRPLQKLTMGGILAGIAFIISGVVELSLEKTYPDLPYSQNIQLRIFNADNCDYFFTSNIPGAE-NVTVTSLNAYTNKDIYAPGSLDVEFSLSSASEACTISADKIPKV-LTDNTAWSLFLNPLNGSGYYWEEDFVDKP-SQSHPLIRN---VANVPQELSIRWEKASTGEVVYDDLASKTLLTRVNSAEYVVMVGERNVGTFDVHTGGVYTLLIKDNNNIYEANLEEVTSPNSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVIAEAALFESQASEFFLFAGL-MFADMLIFMVMAYYYVPNDPNKVEE 786          
BLAST of slc15a-3 vs. Ensembl Zebrafish
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:556684])

HSP 1 Score: 332.798 bits (852), Expect = 2.403e-103
Identity = 221/647 (34.16%), Postives = 360/647 (55.64%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX-AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIM-------LASNGSVNLDLNPGL----VQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARID-IKSYFVKSPDSQNHIRFLNPN-DPVNIEM-LRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERK---LHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +P+    I+++E  ERFS+YGMK +L +Y   YL ++ N +T +YH F GL Y +P+ GA+IAD++LG+F T+I + +VY++GHV+ ++ AI        +I   ++G+ ++A+G+GGIK  VAAFGGDQ    N     K+FS+FY +IN G+  +  +TPILR D+ C  G CY L FGVPA + ++  ++FISG   Y   P   +VL +   CI  +I N     K S  +S     A+ +YS + I + K   R+++++ P+P+FWAL+DQQGSRWTLQA  MN      + +KP+Q+Q +NALLI+  IP+FD  IYP  G   I + P  ++    I+AAL+F  A  +++Y+I+   +E   A   L+ + ++ D  + +      +           +G  +L L        V VS   + YQ ++       Y +      + N +  + +K +  KS     +IRF+N + + +N+ +         N+ I  N  S+  G Y       +  EY+     +  G   +++++       +   ++ + N IH+ WQ+PQY+ +T  E++ SIT L F+YS++P SMKS++QA +L+T+  GN+IV+ VA  G+ + Q  EF LFA L++    I
Sbjct:   28 YPVSIAFIVVNEFCERFSYYGMKAVLTLYFMNYLHWDKNLSTAIYHAFSGLCYFTPLLGALIADSWLGKFKTIIYLSIVYVIGHVVKSVGAIPDVGDSTVHIALSMVGLGLIALGTGGIKPCVAAFGGDQFDEDNIDERRKFFSIFYMSINAGSVLSTIITPILRGDVQCFGGDCYALAFGVPAALMVIALVVFISGSGLYKKSPPEGNVLVRVCKCIGFAISNRWTNSKKSPKRSHWLDWAEEKYSKRLIQEIKMVCRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMDFGGGFIIKPDQMQMLNALLILVFIPIFDMGIYPLVGLCRIKLTPLKKMATGMILAALAFCAATAVEVYVIK-TVVEPPPAKESLVQVYNLMDSDVTVQFPAHNVFSEPLKPYEEPSGYSSLPLTGESQLQNVVVSHNGMNYQCRLTFTERMAYSLLLHPTAQHNGSVCNLVKDHITKSETGAAYIRFINTHTENINVTVGTEEVHASANYGISRNI-SVPRGEYNKAVCVTDTKEYEINLGLLDFGAFYTVILSEAGNNLAVKKMEDIQANNIHIGWQIPQYVFLTAGEVMFSITGLEFSYSQAPASMKSVLQAGWLMTVAFGNVIVLIVAE-GAGMEQWVEFLLFAALLVAVSII 671          
BLAST of slc15a-3 vs. Ensembl Zebrafish
Match: slc15a1b (solute carrier family 15 member 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4661])

HSP 1 Score: 303.138 bits (775), Expect = 4.118e-92
Identity = 199/672 (29.61%), Postives = 341/672 (50.74%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC---VDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYI------------VAALSFIIAGF-------LQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLD-LNPGLVQ-VSMKCVGYQLQVKNLT------LSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            F +P+  + I+++E  ERFS+YGMK +L +Y   ++G++D+ +T +YH FV L YL+PI GAIIAD++LG+F T++ + +VY +G V+M ++AI                 +I   ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY +IN G+  +  +TPILR    C       CYPL FGVPA + +V  I+F+ G + Y +     ++L +  +CI  ++ N  + +     K +  +++A+ +Y    I   K  ++++ ++ P+P+FWAL+DQQGSRWT+QA  M+G     + ++P+Q+Q +N +LI+ ++P+ D  IYP      I   P  ++    +               +   +  F       L+   +   ++     G    ++   N     LT+D   + +++ G  +   L  G    V M   G +  + +LT      L+  +   G+   +N   + +KS  V +      +  L P+  VN  +        ++ +   + S     Y +   S                   +   T        ++ EPN IHM WQ+ QY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VA  GS   Q  E+ LFA+L++    I
Sbjct:   17 FGYPVSIFFIVVNEFCERFSYYGMKAVLVLYFKYFIGWDDDLSTTIYHTFVALCYLTPIMGAIIADSWLGKFKTIVYLSIVYTIGQVIMAISAIHDITDANRDGKPDNKTLHISLSMLGLILIALGTGGIKPCVAAFGGDQFEDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRSQ-ECGIYAKQSCYPLAFGVPAALMVVALIVFVIGHKMYIMESPKGNILLQVINCIGFALNNRFRHRGKQYPKREHWMDWAEEKYDKLLIAQVKMVVKVLFLYIPLPMFWALFDQQGSRWTIQATTMDGNF-GGFVIQPDQMQIVNPILIVIMVPIMDSAIYPLIKLCRINFTPLRKMTVGMVLAALAFVAAALLQLQIDETMPKFPSTSQTQLKFLNVESTSLPVVVEGQDQFMVPGFNASSEYLTLDKENVTISAGGVNDTAFLKTGTRHTVLMNAAGMRNTLDDLTKKPEQGLNAIRFVNGW---ENRLNVSVKSNNVHADPLDASVYLLVPHGKVNFTIFDGGDGKCHYIMQLGFGS----TYTVLIPS-----------------TFAFGQTCSESFEAVQDMEPNRIHMAWQVIQYFLLTCGEVVYSVTGLDFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGSLPDQWAEYLLFASLLVAVSII 662          
BLAST of slc15a-3 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 282.722 bits (722), Expect = 3.732e-84
Identity = 203/694 (29.25%), Postives = 342/694 (49.28%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTV-------------------------LYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC---VDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYL-------------------IRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDP----VNIEMLRLAKDHKNFTIDSN---YSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L                                  +YH FV L YL+PI GAIIAD++LG+F T+I + +VY +G V+M ++ I                 +I   ++G+ ++A+G+GGIK  VAAFGGDQ        +  +FS+FY  IN G+  +  +TP+LR    C      QCYPL FGVPA + +V+ ++FI+G   YT      +++     CI+ ++ N  + +     K +  +++A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M G     + ++P+Q+Q++N +LI+ L+P+ D II+P   K  +   P  R+    + AA +FI A  +Q+ +                   +  +++       + L+I S       +T D + I LA N +  ++ +  L++ S + +    +   + L +                DIKS   K  + +N +RF+N         N+E      +  N+T+ S      +L  G+    C       +      + P     L  T    +   ++ +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MKS++QA +L T   GNIIV+ VA +G    Q  E+ LFA+L++    I
Sbjct:   22 YPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQ-ECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDF-GGFVLQPDQMQTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVQMEIDKTLPNFPSSSESQLKVVNMHSESLIVTVPSQEPLLIGSFESSPDYITFDQQDIRLAFNTTPEINKDLSLIKGSRQTLIIPSEPAEMYLKE----------------DIKS---KPKEGKNAVRFVNGWTAYLNITNLESSLQPSETSNYTLVSQGMRKFTLTDGIQS--CEFSRKFGFGSSYTFLIPS---DLFSTDCESIKEIEDMQPNSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSII 689          
BLAST of slc15a-3 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 272.322 bits (695), Expect = 4.044e-80
Identity = 209/706 (29.60%), Postives = 349/706 (49.43%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTV-------------------------LYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC---VDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKC-------VGYQLQVKNLTLSQYKM-----TGGYIYKDNN-------------------ARIDIKSYFVKSPDSQNHIRFLNPNDP----VNIEMLRLAKDHKNFTIDSN---YSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L                                  +YH FV L YL+PI GAIIAD++LG+F T+I + +VY +G V+M ++ I                 +I   ++G+ ++A+G+GGIK  VAAFGGDQ        +  +FS+FY  IN G+  +  +TP+LR    C      QCYPL FGVPA + +V+ ++FI+G   YT      +++     CI+ ++ N  + +     K +  +++A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M G     + ++P+Q+Q++N +LI+ L+P+ D II+P   K  +   P  R+    + AA +FI A  +Q+ + +      +++ S+L ++N ++   L +T+ ++  +L  +  V    +     VS  C       V  Q     +T  Q  +     T   I KD +                    + DIKS   K  + +N +RF+N         N+E      +  N+T+ S      +L  G+    C       +      + P     L  T    +   ++ +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MKS++QA +L T   GNIIV+ VA +G    Q  E+ LFA+L++    I
Sbjct:   22 YPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQ-ECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDF-GGFVLQPDQMQTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVQMEIDKTLPNFPSSSESQLKVVN-MHSESLIVTVPSQEPLLIGSFEVQ-HTSKHTTAVSHWCFTISSHVVFPQSSPDYITFDQQDIRLAFNTTPEINKDLSLIKGSRQTLIIPSEPAEMYLKEDIKS---KPKEGKNAVRFVNGWTAYLNITNLESSLQPSETSNYTLVSQGMRKFTLTDGIQS--CEFSRKFGFGSSYTFLIP---SDLFSTDCESIKEIEDMQPNSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSII 715          
BLAST of slc15a-3 vs. Ensembl Zebrafish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 267.7 bits (683), Expect = 1.096e-78
Identity = 203/703 (28.88%), Postives = 336/703 (47.80%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTV-------------------------LYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC---VDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGF----------------------------LQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDP----VNIEMLRLAKDHKNFTIDSN---YSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L                                  +YH FV L YL+PI GAIIAD++LG+F T+I + +VY +G V+M ++ I                 +I   ++G+ ++A+G+GGIK  VAAFGGDQ        +  +FS+FY  IN G+  +  +TP+LR    C      QCYPL FGVPA + +V+ ++FI+G   YT      +++     CI+ ++ N  + +     K       A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M G  V    ++    Q++N +LI+ L+P+ D II+P   K  +   P  R+    + AA +FI A                              L++  +  +++       + L+I S       +T D + I LA N +  ++ +  L++ S + +    +   + L +                DIKS   K  + +N +RF+N         N+E      +  N+T+ S      +L  G+     S       K G       L+ S + +++      ++ +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MKS++QA +L T   GNIIV+ VA +G    Q  E+ LFA+L++    I
Sbjct:   20 YPISIFFIVVNEFCERFSYYGMRAVLVLYFRYFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYHAFVALCYLTPILGAIIADSWLGKFKTIIYLSIVYAVGQVVMAVSTIHDITDANRDGTPDNFTLHIALSMLGLVLIALGTGGIKPCVAAFGGDQFQEHQSRQLNTFFSVFYLCINAGSLLSTLITPVLRAQ-ECGIHTQQQCYPLAFGVPAALMVVSLVVFIAGSGMYTKTAPEGNIMGSVCKCIWFALNNRFRHRSDIYPKREHWMDWAEEKYDKLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMTGDFVLRLFLR----QTVNPILILTLVPIMDRIIFPLIKKCGLNFSPLKRMTVGMLFAATAFIAAALVVKREIHEKMYSCFPKTLPNFPSSSESQLKVVNMHSESLIVTVPSQEPLLIGSFESSPDYITFDQQDIRLAFNTTPEINKDLSLIKGSRQTLIIPSEPAEMYLKE----------------DIKS---KPKEGKNAVRFVNGWTAYLNITNLESSLQPSETSNYTLVSQGMRKFTLTDGIQSCEFSR------KFGFGSSYTFLIPSDLFSTDE----IEDMQPNSVHMALQIPQYFLITTGEVMFSVTGLQFSYSQAPKNMKSVLQAGWLCTNAVGNIIVLIVAELGKLPKQWAEYVLFASLLVAVSII 688          
BLAST of slc15a-3 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 306.22 bits (783), Expect = 4.733e-93
Identity = 223/669 (33.33%), Postives = 358/669 (53.51%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI------QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIA-------------------GFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVG-VYEIYCSSPNYNEYKCGNVDVTPG----LVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            +PL    I+++E  ERFS+YGMK +L +Y   YL +++N +T +YH F GL Y +P+ GA IAD +LG+F T+  + ++Y++GHV+ ++ AI      + ++   +IG+  +A G+GGIK  VAAFGGDQ    +     K+FS+FY +IN G+  + FVTP+LR D+ C  G CY L FGVPA +  V  I+F++G   Y   P   ++L+    CI  +++N  + +     K       A+ ++  + I + K   +++ ++ P+P+FWAL+DQQGSRWTLQA  MN      + ++P+QIQ +N LLI+ LIP+FD  IYP      I  K   ++    I+AAL+F +A                    +LQ+  + G +++ +  G +++   S+      L  D  ++ L +  + N D    +  V+  C    +Q K    S Y +    +Y DN     I+    K  +    +RF+N  N  +N+ +       K     S Y ++  G +   Y +     E   G ++        LV  L  T E K    ++   N  H+ WQ+PQY+L++  E++ S+T L F+YS++P SMKS++QA +L TI  GN+IV+ VA  GS L Q  EF LFA L L+A CI + ++  F++  +
Sbjct:   43 YPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFGGDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEIKINETLPPVPKAQVSYLQVLNLAGGDVDVDIPGFEIIKQPSLYGAN-ALDPDYVKLELTTAHN-NFDAKLTVGAVTADC-PIHIQEK----SSYSL---LVYGDNLNCDLIEESQTKPANGLAAVRFINMLNRDINVTIGESTVSAKGNNGVSPYITVKRGKITATYPAGAEQQELDLGLLNFGAAYSVILVRDLGDTIEFKKT--EDVSANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGS-LAQWAEFILFAAL-LVAVCIIFSIMGYFYVPAN 696          
BLAST of slc15a-3 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 247.669 bits (631), Expect = 5.588e-72
Identity = 193/633 (30.49%), Postives = 318/633 (50.24%), Query Frame = 2
Query:  131 ILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI------QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQ-------FVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCV-GYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            I+++E  ERFS+YGMK +L +Y   YL +++N +T +YH F GL Y +P+ GA IAD +LG+F T+  + ++Y++GHV+ ++ AI      + ++   +IG+  +A G+GGIK  VAAFGGDQ            F   +   + G+  A        F++P    D+ C  G CY L FGVPA +  V  I+F++G   Y   P   ++L+    CI  +++N  + +     K +  L++A+ ++  + I + K   +++ ++ P+P+FWAL+DQQGSRWTLQA  MN   V+        +  +  +       +FD  IYP      I  K   ++    I+AAL+F +A  ++I                   IN          +   +++  + G V++D+ PG   +    + G    V    +  +      ++    AR+  ++++    DS    RF+N  N  +N+ +       K     S Y ++  G Y      P        N  + P     L+ T+  +L   ++   N  H+ WQ+PQY+L++  E++ S+T L F+YS++P SMKS++QA +L TI  GN+IV+ VA  GS L Q  EF LFA L L+A CI
Sbjct:   21 IVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQ------------FEEEHAHCDAGSPLADGPTLTPTFLSP--AGDVKCFGGDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDFVSIGGWILNPLLILILIP------IFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEIK------------------INETLPPVPKAQVSYLQVLNLAGGDVDVDI-PGFEIIKQPSLYGANALVSTAVIEFWVQ----VWAWGAARL-CRNHWGAHYDSI--YRFINMLNRDINVTIGESTVSAKGNNGVSPYITVKRGKYVSPLRYPQ-------NSSLQPAGNPPLLCTNAPRLWKTEDVSANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGS-LAQWAEFILFAAL-LVAVCI 598          
BLAST of slc15a-3 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 239.965 bits (611), Expect = 1.389e-69
Identity = 150/418 (35.89%), Postives = 243/418 (58.13%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI------QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFG----KFNILVKPTSRLVASYIVAALSFIIAGFLQI------YLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDL 1309
            +PL    I+++E  ERFS+YGMK +L +Y   YL +++N +T +YH F GL Y +P+ GA IAD +LG+F T+  + ++Y++GHV+ ++ AI      + ++   +IG+  +A G+GGIK  VAAFGGDQ    +     K+FS+FY +IN G+  + FVTP+LR D+ C  G CY L FGVPA +  V  I+F++G   Y   P   ++L+    CI  +++N  + +     K +  L++A+ ++  + I + K   +++ ++ P+P+FWAL+DQQGSRWTLQA  MN      + ++P+QIQ +N LLI+ LIP+FD  IYP        FN +    + +    I+AAL+F +A  ++I      Y+        N   +KL +     DC +++   +   +L    ++N DL
Sbjct:   11 YPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFGGDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFNPMGGTNTTMAIGMILAALAFAVATVVEIKINDPDYVKLELTTAHNNFDAKLTVGAVTADCPIHIQEKSSYSLLVYGDNLNCDL 427          

HSP 2 Score: 86.6557 bits (213), Expect = 4.264e-17
Identity = 45/91 (49.45%), Postives = 64/91 (70.33%), Query Frame = 2
Query: 1706 KEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            ++   N  H+ WQ+PQY+L++  E++ S+T L F+YS++P SMKS++QA +L TI  GN+IV+ VA  GS L Q  EF LFA L L+A CI
Sbjct:  464 EDVSANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGS-LAQWAEFILFAAL-LVAVCI 552          
BLAST of slc15a-3 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 237.269 bits (604), Expect = 3.853e-68
Identity = 140/359 (39.00%), Postives = 222/359 (61.84%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI------QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQI 1162
            +PL    I+++E  ERFS+YGMK +L +Y   YL +++N +T +YH F GL Y +P+ GA IAD +LG+F T+  + ++Y++GHV+ ++ AI      + ++   +IG+  +A G+GGIK  VAAFGGDQ    +     K+FS+FY +IN G+  + FVTP+LR D+ C  G CY L FGVPA +  V  I+F++G   Y   P   ++L+    CI  +++N  + +     K +  L++A+ ++  + I + K   +++ ++ P+P+FWAL+DQQGSRWTLQA  MN      + ++P+QIQ +N LLI+ LIP+FD  IYP      I  K   ++    I+AAL+F +A  ++I
Sbjct:   47 YPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFNTIFYLSILYVIGHVIKSVGAIPTVGSTEVHVALSIIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFGGDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEI 404          

HSP 2 Score: 88.5817 bits (218), Expect = 1.420e-17
Identity = 52/118 (44.07%), Postives = 74/118 (62.71%), Query Frame = 2
Query: 1637 NVDVTPGLVGSLMMTSERKLH--FWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            N  + P     L+ T+  +L    WK  +   N  H+ WQ+PQY+L++  E++ S+T L F+YS++P SMKS++QA +L TI  GN+IV+ VA  GS L Q  EF LFA L L+A CI
Sbjct:  484 NSSLQPAGNPPLLCTNAPRLWVCHWKTEDVSANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGS-LAQWAEFILFAAL-LVAVCI 599          
BLAST of slc15a-3 vs. Ensembl Xenopus
Match: SLC15A2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:100493689])

HSP 1 Score: 232.261 bits (591), Expect = 1.738e-66
Identity = 133/353 (37.68%), Postives = 204/353 (57.79%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQI 1162
            +PL    I+++E  ERFS+YGMK +L +Y   YL +++N +T +YH F GL Y +P+ GA IAD +LG+F  +                          +IG+  +A G+GGIK  VAAFGGDQ    +     K+FS+FY +IN G+  + FVTP+LR D+ C  G CY L FGVPA +  V  I+F++G   Y   P   ++L+    CI  +++N  + +     K +  L++A+ ++  + I + K   +++ ++ P+P+FWAL+DQQGSRWTLQA  MN      + ++P+QIQ +N LLI+ LIP+FD  IYP      I  K   ++    I+AAL+F +A  ++I
Sbjct:   47 YPLSIMFIVVNEFCERFSYYGMKAVLTLYFLNYLHWDENLSTTVYHAFSGLCYFTPLIGAPIADAWLGKFKALS-------------------------IIGLIAIAFGTGGIKPCVAAFGGDQFEEEHAQERSKFFSIFYLSINAGSLISTFVTPVLRGDVKCFGGDCYALAFGVPAALMFVALIVFVAGSGMYKKYPPQGNILASVFRCIGFALKNRWRHRSKQYPKREHWLDWAEEKFQKRLITEVKMVTKVLFLYIPLPMFWALFDQQGSRWTLQATRMNSDF-GGFVLQPDQIQILNPLLILILIPIFDLCIYPLVRCCKIDFKAIPKMAIGMILAALAFAVATVVEI 373          

HSP 2 Score: 88.5817 bits (218), Expect = 1.283e-17
Identity = 52/118 (44.07%), Postives = 74/118 (62.71%), Query Frame = 2
Query: 1637 NVDVTPGLVGSLMMTSERKLH--FWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            N  + P     L+ T+  +L    WK  +   N  H+ WQ+PQY+L++  E++ S+T L F+YS++P SMKS++QA +L TI  GN+IV+ VA  GS L Q  EF LFA L L+A CI
Sbjct:  453 NSSLQPAGNPPLLCTNAPRLWVCHWKTEDVSANSFHVAWQVPQYVLLSAGEVMFSVTGLEFSYSQAPISMKSVLQAGWLFTIAIGNVIVLIVAQAGS-LAQWAEFILFAAL-LVAVCI 568          
BLAST of slc15a-3 vs. Ensembl Mouse
Match: Slc15a1 (solute carrier family 15 (oligopeptide transporter), member 1 [Source:MGI Symbol;Acc:MGI:1861376])

HSP 1 Score: 342.043 bits (876), Expect = 7.242e-107
Identity = 224/684 (32.75%), Postives = 374/684 (54.68%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYL-------------------IRGQNIEFNTAGSKLLIIN-SINDCKLNLTIDN-RRIMLASNGSVNLDLNPGLVQVSMKCV-GYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDS-QNHIRFLNP-NDPVNIEMLRLAKDHKNFTID--SNYSSLDVGV--YEIYCSS--PN-YNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ +L +Y   +LG++DN +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  ++++++I                 ++   ++G++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TPILR     +  Q  CYPL FGVPA +  V  I+F+ G   Y       +++ K + CI  +I+N  + +  +  K       A+ +Y  + I   K   ++M ++ P+P+FWAL+DQQGSRWTLQA  MNGKI  +  ++P+Q+Q++NA+LI+ ++P+ D ++YP   K         ++     +A+++F++A  +Q+ +                   I   N+  +  G+ + +   S  D  +   ID    I ++S+GS      PG+  V+     G++  +     SQY++              +K    + P+  +N IRF+N  N+ V I+M    K ++N T    S Y     G   Y I  ++  P    ++K  N+D        +   S+  L   KEFE   PN ++M  Q+PQY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA+L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHNGSPDSLPVHVALSMVGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINGGSLLSTIITPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCIGFAIKNRFRHRSKAYPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQGSRWTLQATTMNGKI-GAIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKKMTVGMFLASMAFVVAAIVQVEIDKTLPVFPGGNQVQIKVLNIGNNNMTVHFPGNSVTLAQMSQTDTFMTFDIDKLTSINISSSGS------PGVTTVAHDFEQGHRHTLLVWNPSQYRV--------------VKDGLNQKPEKGENGIRFVNTLNEMVTIKMS--GKVYENVTSHNASGYQFFPSGEKQYTINTTAVAPTCLTDFKSSNLDFGSAYTYVIRRASDGCLEV-KEFEDIPPNTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGHFPKQWAEYILFASLLLVVCVIFAIMAR 669          
BLAST of slc15a-3 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 332.413 bits (851), Expect = 6.216e-103
Identity = 218/656 (33.23%), Postives = 362/656 (55.18%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILG--------PLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR---IMLASNGSVNLDLNPGLVQVSMKC--VGYQLQVKNLTL-SQYKMTGGYIYK----DNNARID---IKSYFVKSPDSQNHIRFLNP-NDPVNIEM-----LRLAKDHKNFTIDSNYSSLDVGVY-EIYCSSP-NYNEYKCGNVDVTPGLVGSLMMTSERKLHFWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F T+I + LVY+LGHV  +L AI   ILG         L+G+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C    CY L FG+P  + ++  ++F  G + Y   P   +++++ + CI+ +I N  + +     K       A  +Y    I D K   RI+ ++ P+P+FWAL DQQGSRWTLQA  M+G +   + ++P+Q+Q +N  L++  IP+FD +IY    K  +      ++    I+A L+F +A  ++I  I G       +    L + ++ D ++ +T+   R   +++ S  S     +   +++  K   + + L+  NL++ ++Y +     Y+    +N   +    +K   +K  +    IRF+N  +  +NI +     L + KD+      S Y ++  G Y  ++C +  N      G +D     +  +   + R L  WK  +   N + + WQ+PQY+L+T AE++ S+T L F+YS++P SMKS++QA +L+T+  GNIIV+ VA   S L Q  EF LF+ L+L+   I
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIP--ILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFGEDCYALAFGIPGLLMVLALVVFAMGSKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKALTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDL-GFFVLQPDQMQVLNPFLVLVFIPLFDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIK-INGMIHPQPASQEIFLQVLNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNEYSVEEKNCYQLVVHENGESLSSMLVKDTGIKPANGMTAIRFINTLHKDMNISLDANAPLSVGKDYG----VSEYRTVQRGKYPAVHCETEDNVFSLNLGQLDFGTTYLFVITNITNRGLQAWKAEDIPANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIVLIVAQF-SGLVQWAEFVLFSCLLLVVCLI 699          
BLAST of slc15a-3 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 326.25 bits (835), Expect = 7.346e-101
Identity = 205/648 (31.64%), Postives = 345/648 (53.24%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR---IMLASNGSVNLDLNPGLVQVSMKC--VGYQLQVKNLTL-SQYKMTGGYIYK----DNNARID---IKSYFVKSPDSQNHIRFLNP-NDPVNIEM-----LRLAKDHKNFTIDSNYSSLDVGVY-EIYCSSP-NYNEYKCGNVDVTPGLVGSLMMTSERKLHFWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F                         IL  L+G+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C    CY L FG+P  + ++  ++F  G + Y   P   +++++ + CI+ +I N  + +     K       A  +Y    I D K   RI+ ++ P+P+FWAL DQQGSRWTLQA  M+G +   + ++P+Q+Q +N  L++  IP+FD +IY    K  +      ++    I+A L+F +A  ++I  I G       +    L + ++ D ++ +T+   R   +++ S  S     +   +++  K   + + L+  NL++ ++Y +     Y+    +N   +    +K   +K  +    IRF+N  +  +NI +     L + KD+      S Y ++  G Y  ++C +  N      G +D     +  +   + R L  WK  +   N + + WQ+PQY+L+T AE++ S+T L F+YS++P SMKS++QA +L+T+  GNIIV+ VA   S L Q  EF LF+ L+L+   I
Sbjct:   53 YPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKF------------------------KILS-LVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFGEDCYALAFGIPGLLMVLALVVFAMGSKMYRKPPPEGNIVAQVTKCIWFAICNRFRNRSEDIPKRQHWLDWAAEKYPKHLIMDVKALTRILFLYIPLPMFWALLDQQGSRWTLQANKMDGDL-GFFVLQPDQMQVLNPFLVLVFIPLFDLVIYRLISKCGVNFSSLRKMAVGMILACLAFAVAALVEIK-INGMIHPQPASQEIFLQVLNLADGEIEVTVQGNRNNPLLVESISSFQNTTHYSKLRLETKSQDLHFHLKYNNLSVHNEYSVEEKNCYQLVVHENGESLSSMLVKDTGIKPANGMTAIRFINTLHKDMNISLDANAPLSVGKDYG----VSEYRTVQRGKYPAVHCETEDNVFSLNLGQLDFGTTYLFVITNITNRGLQAWKAEDIPANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTVAVGNIIVLIVAQF-SGLVQWAEFVLFSCLLLVVCLI 668          
BLAST of slc15a-3 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 149.443 bits (376), Expect = 3.106e-40
Identity = 85/193 (44.04%), Postives = 125/193 (64.77%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILG--------PLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVT 661
             +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F T+I + LVY+LGHV  +L AI   ILG         L+G+S++A+G+GGIK  VAAFGGDQ    +     +YFS+FY +IN G+  + F+TP+LR D+ C    CY L FG+P  + ++ 
Sbjct:   52 SYPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIP--ILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHAEARTRYFSVFYLSINAGSLISMFITPMLRGDVKCFGEDCYALAFGIPGLLMVLA 242          
BLAST of slc15a-3 vs. Ensembl Mouse
Match: Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2 [Source:MGI Symbol;Acc:MGI:1890457])

HSP 1 Score: 102.449 bits (254), Expect = 1.720e-24
Identity = 65/140 (46.43%), Postives = 93/140 (66.43%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILG--------PLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDM 502
             +PL    I+++E  ERFS+YGMK +L +Y   +L +N++ +T +YH F  L Y +PI GA IAD++LG+F T+I + LVY+LGHV  +L AI   ILG         L+G+S++A+G+GGIK  VAAFGGDQ    + M
Sbjct:   52 SYPLSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLVYVLGHVFKSLGAIP--ILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGGDQFEEEHGM 189          
BLAST of slc15a-3 vs. UniProt/SwissProt
Match: sp|Q8WMX5|S15A1_CANLF (Solute carrier family 15 member 1 OS=Canis lupus familiaris OX=9615 GN=SLC15A1 PE=2 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 3.937e-110
Identity = 221/682 (32.40%), Postives = 372/682 (54.55%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRI----MLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTID--SNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGL--------VGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 2047
            F +PL  + I+++E  ERFS+YGM+ +L +Y   ++G++DN +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  +  +++I                 ++   +IG++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  VTP+LR     +  Q  CYPL FGVPA +  V+ I+F+ G   Y       +V+ K   CI  +++N  + +     K +  L++A+ +Y  + I   K   ++M ++ P+P+FWAL+DQQGSRWTLQA  M+GKI     ++P+Q+Q++NA+LI+ ++P+ D ++YP   K         R+     +A+++F++A  +Q+ + +   +       ++ ++N I +  +N++     +    M  S+G +  D++  L  +++   G  +        Q       ++  NN R+       K    +N IRF+N  N+ +NI M    K + N T    S Y    +G   I  SS       C  V  +  L        V     T   +LH +++  PN ++M  Q+PQY LITC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA L+L+   I  I+ R +       +E Q  D+
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRALLILYFRRFIGWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTAVSSINDLTDYNKDGTPDNLSVHVALSMIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLISTIVTPMLRVHECGIYSQKACYPLAFGVPAALMAVSLIVFVIGSGMYKKFQPQGNVMGKVVKCIGFALKNRFRHRSKQFPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQGSRWTLQATAMSGKI-GLLEVQPDQMQTVNAILIVVMVPIMDAVVYPLIAKCGFNFTSLKRMTVGMFLASMAFVMAAIVQLEIDKTLPVFPKQNEVQIKVLN-IGNGAMNVSFPGAVVTVSQMSQSDGFMTFDVDK-LTSINISSTGSPVIPVTYNFEQGHRHTLLVWAPNNYRVVKDGLNQKPEKGENGIRFINSLNESLNITMGD--KVYVNVTSHNASEYQFFSLGTKNITISSTQQISQNCTKVLQSSNLEFGSAYTYVIGTQSTGCPELHMFEDISPNTVNMALQIPQYFLITCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSEQWAEYILFAALLLVVCVIFAIMARFYTYVNPAEIEAQFDDD 686          
BLAST of slc15a-3 vs. UniProt/SwissProt
Match: sp|P36836|S15A1_RABIT (Solute carrier family 15 member 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC15A1 PE=2 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 8.158e-109
Identity = 216/662 (32.63%), Postives = 367/662 (55.44%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC---VDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVN--LDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTP----GLVGSLMMTSER----KLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ +L +Y   ++G++DN +TV+YH FV L YL+PI GA+IAD +LG+F T++ + +VY +G  + +L+++ +               ++   +IG+ ++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TP++R    C   V   CYPL FG+PA +  V+ I+FI G   Y       ++LSK   CI  +I+N  + +     K    L++A+ +Y  + I   K   R++ ++ P+P+FWAL+DQQGSRWTLQA  M+G+I     ++P+Q+Q++N +LII L+P+ D ++YP   K  +      ++     +A+++F+ A  LQ+ + +   + F  A    + + ++    + +++  + + L      N  +  N   +       G Q+ +   +L   +     ++  NN R+       KS   +N IRF+N  + P+N+ M     +H      S Y     GV     SS   +E +C     +P    G   + ++TS+     ++  +++  PN ++M WQ+PQY LIT  E++ SIT L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRALLILYFRNFIGWDDNLSTVIYHTFVALCYLTPILGALIADAWLGKFKTIVWLSIVYTIGQAVTSLSSVNELTDNNHDGTPDSLPVHVAVCMIGLLLIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMVRVQ-QCGIHVKQACYPLAFGIPAILMAVSLIVFIIGSGMYKKFKPQGNILSKVVKCICFAIKNRFRHRSKQFPKRAHWLDWAKEKYDERLIAQIKMVTRVLFLYIPLPMFWALFDQQGSRWTLQATTMSGRI-GILEIQPDQMQTVNTILIIILVPIMDAVVYPLIAKCGLNFTSLKKMTIGMFLASMAFVAAAILQVEIDKTLPV-FPKANEVQIKVLNVGSENMIISLPGQTVTLNQMSQTNEFMTFNEDTLTSINITSGSQVTMITPSLEAGQRHTLLVWAPNNYRVVNDGLTQKSDKGENGIRFVNTYSQPINVTMSGKVYEHIASYNASEYQFFTSGVKGFTVSSAGISE-QCRRDFESPYLEFGSAYTYLITSQATGCPQVTEFEDIPPNTMNMAWQIPQYFLITSGEVVFSITGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQINKQWAEYILFAALLLVVCVIFAIMAR 667          
BLAST of slc15a-3 vs. UniProt/SwissProt
Match: sp|Q9JIP7|S15A1_MOUSE (Solute carrier family 15 member 1 OS=Mus musculus OX=10090 GN=Slc15a1 PE=1 SV=2)

HSP 1 Score: 342.043 bits (876), Expect = 5.066e-106
Identity = 224/684 (32.75%), Postives = 374/684 (54.68%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYL-------------------IRGQNIEFNTAGSKLLIIN-SINDCKLNLTIDN-RRIMLASNGSVNLDLNPGLVQVSMKCV-GYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDS-QNHIRFLNP-NDPVNIEMLRLAKDHKNFTID--SNYSSLDVGV--YEIYCSS--PN-YNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ +L +Y   +LG++DN +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  ++++++I                 ++   ++G++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TPILR     +  Q  CYPL FGVPA +  V  I+F+ G   Y       +++ K + CI  +I+N  + +  +  K       A+ +Y  + I   K   ++M ++ P+P+FWAL+DQQGSRWTLQA  MNGKI  +  ++P+Q+Q++NA+LI+ ++P+ D ++YP   K         ++     +A+++F++A  +Q+ +                   I   N+  +  G+ + +   S  D  +   ID    I ++S+GS      PG+  V+     G++  +     SQY++              +K    + P+  +N IRF+N  N+ V I+M    K ++N T    S Y     G   Y I  ++  P    ++K  N+D        +   S+  L   KEFE   PN ++M  Q+PQY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA+L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHNGSPDSLPVHVALSMVGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINGGSLLSTIITPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCIGFAIKNRFRHRSKAYPKREHWLDWAKEKYDERLISQIKMVTKVMFLYIPLPMFWALFDQQGSRWTLQATTMNGKI-GAIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKKMTVGMFLASMAFVVAAIVQVEIDKTLPVFPGGNQVQIKVLNIGNNNMTVHFPGNSVTLAQMSQTDTFMTFDIDKLTSINISSSGS------PGVTTVAHDFEQGHRHTLLVWNPSQYRV--------------VKDGLNQKPEKGENGIRFVNTLNEMVTIKMS--GKVYENVTSHNASGYQFFPSGEKQYTINTTAVAPTCLTDFKSSNLDFGSAYTYVIRRASDGCLEV-KEFEDIPPNTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGHFPKQWAEYILFASLLLVVCVIFAIMAR 669          
BLAST of slc15a-3 vs. UniProt/SwissProt
Match: sp|P46059|S15A1_HUMAN (Solute carrier family 15 member 1 OS=Homo sapiens OX=9606 GN=SLC15A1 PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 7.223e-106
Identity = 206/671 (30.70%), Postives = 367/671 (54.69%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLA----SNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCS----------------SPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ IL +Y   ++ ++DN +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  + ++++I                 +++  LIG++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TP+LR     +  +  CYPL FGVPA +  V  I+F+ G   Y       +++ K + CI  +I+N  + +  +  K       A+ +Y  + I   K   R+M ++ P+P+FWAL+DQQGSRWTLQA  M+GKI  +  ++P+Q+Q++NA+LI+ ++P+FD ++YP   K         ++    ++A+++F++A  +Q+ + +   + F       + + +I +  +N+++    + L     +N  +  D+N  L ++++   G  +        Q +     ++  N+ ++       K    +N IRF+N  N+ + I M        +  + +N SS +   Y+ + S                 PN+N +          +V      S  ++  +++   N ++M  Q+PQY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VAG G    Q  E+ LFA L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMLRVQQCGIHSKQACYPLAFGVPAALMAVALIVFVLGSGMYKKFKPQGNIMGKVAKCIGFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMVTRVMFLYIPLPMFWALFDQQGSRWTLQATTMSGKI-GALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAKCGFNFTSLKKMAVGMVLASMAFVVAAIVQVEIDKTLPV-FPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNK-LTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITM--------SGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIV-QRKNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMAR 668          
BLAST of slc15a-3 vs. UniProt/SwissProt
Match: sp|P51574|S15A1_RAT (Solute carrier family 15 member 1 OS=Rattus norvegicus OX=10116 GN=Slc15a1 PE=2 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.107e-102
Identity = 214/668 (32.04%), Postives = 371/668 (55.54%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNI--EFNTAGSKLLIINSINDCKLNLTIDNRRI--MLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGY-----IYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYSSLDVGV--YEIYCS--SPN-YNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFE---PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIR 1996
            F +PL  + I+++E  ERFS+YGM+ +L +Y   +LG++D+ +T +YH FV L YL+PI GA+IAD++LG+F T++ + +VY +G  ++++++I                 ++   +IG++++A+G+GGIK  V+AFGGDQ   G +    ++FS+FY AIN G+  +  +TPILR     +  Q  CYPL FGVPA +  V  I+F+ G   Y       +++ K + CI  +I+N  + +  +  K    L++A+ +Y  + I   K   ++M ++ P+P+FWAL+DQQGSRWTLQA  M GKI  +  ++P+Q+Q++NA+LI+ ++P+ D ++YP   K         ++     +A+++F++A  +Q+ + +   +    N    K+L I + ND  +     N  +  M  ++  +  D++  L  +++   G       +T   ++   G+     ++  N  R+       K    +N IRF++  N+ + I+M     ++      SNY     G   Y I  +  +PN  +++K  N+D        +   +       KEFE   PN ++M  Q+PQY L+TC E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VA  G    Q  E+ LFA+L+L+   I  I+ R
Sbjct:   10 FGYPLSIFFIVVNEFCERFSYYGMRALLVLYFRNFLGWDDDLSTAIYHTFVALCYLTPILGALIADSWLGKFKTIVSLSIVYTIGQAVISVSSINDLTDHDHDGSPNNLPLHVALSMIGLALIALGTGGIKPCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPILRVQQCGIHSQQACYPLAFGVPAALMAVALIVFVLGSGMYKKFQPQGNIMGKVAKCIRFAIKNRFRHRSKAFPKRNHWLDWAKEKYDERLISQIKIMTKVMFLYIPLPMFWALFDQQGSRWTLQATTMTGKI-GTIEIQPDQMQTVNAILIVIMVPIVDAVVYPLIAKCGFNFTSLKKMTVGMFLASMAFVVAAIVQVEIDKTLPVFPSGNQVQIKVLNIGN-NDMAVYFPGKNVTVAQMSQTDTFMTFDVDQ-LTSINVSSPGS----PGVTTVAHEFEPGHRHTLLVWGPNLYRVVKDGLNQKPEKGENGIRFVSTLNEMITIKMSGKVYENVTSHSASNYQFFPSGQKDYTINTTEIAPNCSSDFKSSNLDFGSAYTYVIRSRASDGCLEVKEFEDIPPNTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAIGNIIVLIVAEAGHFDKQWAEYVLFASLLLVVCIIFAIMAR 670          
BLAST of slc15a-3 vs. TrEMBL
Match: A0A0H3YJ33 (Slc15a-3 OS=Schmidtea mediterranea OX=79327 GN=slc15a-3 PE=2 SV=1)

HSP 1 Score: 1281.16 bits (3314), Expect = 0.000e+0
Identity = 661/661 (100.00%), Postives = 661/661 (100.00%), Query Frame = 2
Query:   65 MKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 2047
            MKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHVLMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN
Sbjct:    1 MKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHVLMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 661          
BLAST of slc15a-3 vs. TrEMBL
Match: A0A267FN24 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029362g1 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 1.966e-130
Identity = 248/678 (36.58%), Postives = 391/678 (57.67%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIY---------KDN-----NARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEI-----YCS------SPNY--NEYKCG-NVDVTPGLVGSLMM-------TSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQN 2038
            F    WIIL+HE+LERFSFYGMKGIL  YLN Y+GF+D+ TT+LYHLF GLSYL+PI G  +ADN+ G++ T+ ++G+VYL+GH+LM LTA+ KN+ GPLI M ILAIG+GGIK  VAAFGGDQV   N+ +++ +F++FY  IN+GAFA+Q +TPILR+ + CVD  CYPLGFGVPA  F + Y++F++G RTY I P+  S +   +  + V     +  +K   +       + +    FI+D + A++++++F P P++WAL+DQQGSRW LQ K M+G I  S+++  +Q+QS+N LLI+ ++P+F+ I+YP F K N+L   TSR+   Y++ A +F + G +++ +     +   +  ++L I N+ N C +++   +    + +      +  P +V +     G    V N+T        G +           DN     +A     +  + +  SQ  +R ++ +  ++   ++   +       SN +S   G         YC        P Y  +E+K    +   P  +    +       +S    H   + E N +H+  Q+PQY+L+  +E+L S+T+L++AYSE+P ++KSL+Q  YL++IF GN+IV+ VA       Q  EFFLFA LV + G +   +I  F+ +K     ++N
Sbjct:   40 FSAAAWIILVHELLERFSFYGMKGILTYYLNDYIGFDDDTTTILYHLFTGLSYLTPILGTFLADNFWGQYKTIAILGIVYLIGHLLMPLTALTKNVPGPLISMLILAIGTGGIKPCVAAFGGDQVGKENEEVLDGFFAMFYMCINIGAFASQLITPILREQVKCVDDSCYPLGFGVPAIAFGLCYVLFLAGTRTYKIYPKPTSPM--LNKAMKVIFSGKLWRRKEEAFDESKATEEEKADRAFIEDVRVAVQVLLLFLPFPIYWALFDQQGSRWVLQGKRMDGYISESFSLTADQMQSVNPLLIVMVVPIFNNIVYPLFAKCNLLKSATSRIFWGYLICASAFGLTGIIELLVDNTVPVGLPSGQAQLRIFNA-NPCPIDVAHPDEARRIPARSLDRFNNAPWIVHLRNHSGGDYRPVLNVTRHCGSSPPGSVQTVWLHLRPGSDNLVIVADAGRVSAALPIPASVSQTRLRLVHADHRLSGSPVQFGTEPGRCLPHSNLTSSGEGTVNPLFATDYCEIASRLDVPMYIGDEHKYSVPLSSLPSAIKYATIYAEFNASSSAVTYHTIVDRELNPLHITLQLPQYLLMCISEVLFSVTALAYAYSEAPANLKSLLQTFYLVSIFFGNMIVIAVAAAPKLPKQAHEFFLFAGLVFLGGFVQLFVI--FYYNKIKVKSSRN 712          
BLAST of slc15a-3 vs. TrEMBL
Match: A0A1I8IBP3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 7.899e-130
Identity = 246/674 (36.50%), Postives = 387/674 (57.42%), Query Frame = 2
Query:   86 GNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIY---------KDN-----NARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVG---------SLMMTSERKLHFWKEF---------------EPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILI 1993
            G  F    F    WIIL+HE+LERFSFYGMKGIL  YLN Y+GF+D+ TT+LYHLF GLSYL+PI G  +ADN+ G++ T+ ++G+VYL+GH+LM LTA+ KN+ GPLI M ILAIG+GGIK  VAAFGGDQV   N+ +++ +F++FY  IN+GAFA+Q +TPILR+ + CVD  CYPLGFGVPA  F + Y++F++G RTY I P+  S +   +  + V     +  ++   +         +    FI+D + A++++++F P P++WAL+DQQGSRW LQ K M+G I  S+++  +Q+QS+N LLI+ ++P+F+ I+YP F K N+L   TSR+   Y++ A +F + G +++ +     +   +  ++L I N+ N C +++   +    + +      +  P +V +     G    V N+T        G +           DN     +A     +  + +  SQ  +R ++ +   +   ++   +       SN +S   G      ++ +Y E     +DV P  +G         S + ++ +    + EF               E N +H+  Q+PQY+L+  +E+L S+T+L++AYSE+P ++KSL+Q  YL++IF GN+IV+ VA       Q  EFFLFA LV + G +   +I
Sbjct:   20 GPRFIYAAFSAAAWIILVHELLERFSFYGMKGILTYYLNDYIGFDDDTTTILYHLFTGLSYLTPILGTFLADNFWGQYKTIAILGIVYLIGHLLMPLTALTKNVPGPLISMLILAIGTGGIKPCVAAFGGDQVGKENEEVLDGFFAMFYMCINIGAFASQLITPILREQVKCVDDSCYPLGFGVPAIAFGLCYVLFLAGTRTYNIYPKPTSPM--LNKAMKVIFSGKLWRRQEETFDESKATEAEKADRAFIEDVRVAVQVLLLFLPFPIYWALFDQQGSRWVLQGKRMDGYISESFSLTADQMQSVNPLLIVLVVPIFNNIVYPLFAKCNLLKSATSRIFWGYLICAAAFGLTGIIELLVDNTVPVGLPSGQAQLRIYNA-NPCPIDVAHPDEARRIPARSLDRFNNAPWIVHLRNHTGGDYRPVLNVTRHCGSSPPGSVQTVWLHLRPGSDNLVIVADAGRVSAALPIPASVSQTRLRLVHADPRTSGSPVQFGTEPGRCLPHSNLTSSGEGTVNPLLAT-DYCEI-ASRLDV-PMYIGDEHKYSVPLSSLPSAIKYATVYAEFNASSSAVTYRTIVDRELNPLHITLQLPQYLLMCISEVLFSVTALAYAYSEAPANLKSLLQTFYLVSIFFGNMIVIAVAAAPKLPKQAHEFFLFAGLVFLGGFVQLFVI 687          
BLAST of slc15a-3 vs. TrEMBL
Match: A0A267G7E9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030926g1 PE=3 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 2.510e-129
Identity = 246/674 (36.50%), Postives = 387/674 (57.42%), Query Frame = 2
Query:   86 GNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIY---------KDN-----NARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVG---------SLMMTSERKLHFWKEF---------------EPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILI 1993
            G  F    F    WIIL+HE+LERFSFYGMKGIL  YLN Y+GF+D+ TT+LYHLF GLSYL+PI G  +ADN+ G++ T+ ++G+VYL+GH+LM LTA+ KN+ GPLI M ILAIG+GGIK  VAAFGGDQV   N+ +++ +F++FY  IN+GAFA+Q +TPILR+ + CVD  CYPLGFGVPA  F + Y++F++G RTY I P+  S +   +  + V     +  ++   +         +    FI+D + A++++++F P P++WAL+DQQGSRW LQ K M+G I  S+++  +Q+QS+N LLI+ ++P+F+ I+YP F K N+L   TSR+   Y++ A +F + G +++ +     +   +  ++L I N+ N C +++   +    + +      +  P +V +     G    V N+T        G +           DN     +A     +  + +  SQ  +R ++ +   +   ++   +       SN +S   G      ++ +Y E     +DV P  +G         S + ++ +    + EF               E N +H+  Q+PQY+L+  +E+L S+T+L++AYSE+P ++KSL+Q  YL++IF GN+IV+ VA       Q  EFFLFA LV + G +   +I
Sbjct:   45 GPRFIYAAFSAAAWIILVHELLERFSFYGMKGILTYYLNDYIGFDDDTTTILYHLFTGLSYLTPILGTFLADNFWGQYKTIAILGIVYLIGHLLMPLTALTKNVPGPLISMLILAIGTGGIKPCVAAFGGDQVGKENEEVLDGFFAMFYMCINIGAFASQLITPILREQVKCVDDSCYPLGFGVPAIAFGLCYVLFLAGTRTYNIYPKPTSPM--LNKAMKVIFSGKLWRRQEETFDESKATEAEKADRAFIEDVRVAVQVLLLFLPFPIYWALFDQQGSRWVLQGKRMDGYISESFSLTADQMQSVNPLLIVLVVPIFNNIVYPLFAKCNLLKSATSRIFWGYLICAAAFGLTGIIELLVDNTVPVGLPSGQAQLRIYNA-NPCPIDVAHPDEARRIPARSLDRFNNAPWIVHLRNHTGGDYRPVLNVTRHCGSSPPGSVQIVWLHLRPGSDNLVIVADAGRVSAALPIPASVSQTRLRLVHADPRTSGSPVQFGTEPGRCLPHSNLTSSGEGTVNPLLAT-DYCEI-ASRLDV-PMYIGDEHKYSVPLSSLPSAIKYATVYAEFNASSSAVTYRTIVDRELNPLHITLQLPQYLLMCISEVLFSVTALAYAYSEAPANLKSLLQTFYLVSIFFGNMIVIAVAAAPKLPKQAHEFFLFAGLVFLGGFVQLFVI 712          
BLAST of slc15a-3 vs. TrEMBL
Match: A0A1I8IGK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 5.036e-126
Identity = 249/690 (36.09%), Postives = 394/690 (57.10%), Query Frame = 2
Query:   86 GNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIY---------KDN-----NARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVG---------SLMMTSERKLHFWKEF---------------EPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNM 2041
            G  F    F    WIIL+HE+LERFSFYGMKGIL  YLN Y+GF+D+ TT+LYHLF GLSYL+PI G  +ADN+ G++ T+ ++G+VYL+GH+LM LTA+ KN+ GPLI M ILAIG+GGIK  VAAFGGDQV   N+ +++ +F++FY  IN+GAFA+Q +TPILR+ + CVD  CYPLGFGVPA  F + Y++F++G RTY I P+  S +   +  + V     +  ++   +         +    FI+D + A++++++F P P++WAL+DQQGSRW LQ K M+G I  S+++  +Q+QS+N LLI+ ++P+F+ I+YP F K N+L   TSR+   Y++ A +F + G +++ +     +   +  ++L I N+ N C +++   +    + +      +  P +V +     G    V N+T        G +           DN     +A     +  + +  SQ  +R ++ +   +   ++   +       SN +S   G      ++ +Y E     +DV P  +G         S + ++ +    + EF               E N +H+  Q+PQY+L+  +E+L S+T+L++AYSE+P ++KSL+Q  YL++IF GN+IV+ VA       Q  EFFLFA LV + G +   +I  F+ +K     ++N 
Sbjct:  336 GPRFIYAAFSAAAWIILVHELLERFSFYGMKGILTYYLNDYIGFDDDTTTILYHLFTGLSYLTPILGTFLADNFWGQYKTIAILGIVYLIGHLLMPLTALTKNVPGPLISMLILAIGTGGIKPCVAAFGGDQVGKENEEVLDGFFAMFYMCINIGAFASQLITPILREQVKCVDDSCYPLGFGVPAIAFGLCYVLFLAGTRTYNIYPKPTSPM--LNKAMKVIFSGKLWRRQEETFDESKATEAEKADRAFIEDVRVAVQVLLLFLPFPIYWALFDQQGSRWVLQGKRMDGYISESFSLTADQMQSVNPLLIVLVVPIFNNIVYPLFAKCNLLKSATSRIFWGYLICAAAFGLTGIIELLVDNTVPVGLPSGQAQLRIYNA-NPCPIDVAHPDEARRIPARSLDRFNNAPWIVHLRNHTGGDYRPVLNVTRHCGSSPPGSVQTVWLHLRPGSDNLVIVADAGRVSAALPIPASVSQTRLRLVHADPRTSGSPVQFGTEPGRCLPHSNLTSSGEGTVNPLLAT-DYCEIA-SRLDV-PMYIGDEHKYSVPLSSLPSAIKYATVYAEFNASSSAVTYRTIVDRELNPLHITLQLPQYLLMCISEVLFSVTALAYAYSEAPANLKSLLQTFYLVSIFFGNMIVIAVAAAPKLPKQAHEFFLFAGLVFLGGFVQLFVI--FYYNKIKVKNSRNQ 1017          
BLAST of slc15a-3 vs. Ensembl Cavefish
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:103032564])

HSP 1 Score: 352.443 bits (903), Expect = 8.300e-111
Identity = 229/646 (35.45%), Postives = 364/646 (56.35%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI------QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX-AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLA-------SNGSVNLDLNPGL----VQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPN-DPVNIEMLRLAKDHKNFTIDSNYS---SLDV--GVY-EIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWK---EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVL 1963
            +P+    I+++E  ERFS+YGMK +L +Y   YL +N+N +T +YH F GL Y +PI GAIIAD++LG+F T+I + +VY++GHV+ ++ AI        ++   ++G+ ++A G+GGIK  VAAFGGDQ    +     K+FS+FY +IN G+  +  +TPILR D+ C  G CY L FGVPA + +V  ++FI+G   Y   P   +VL     CI  +I N  K  + S  +      A+ +YS + I + K  LR+++++ P+P+FWAL+DQQGSRWTLQA  MN      + +KP+Q+Q +NALLI+  +P+FD  +YP  G   I + P  ++    I+AAL+F  A  +    +    +E   A   LL + ++ D  +++T     +                L LN  +    V V+ + + +Q Q   L  S+  +    ++ D    + +K  + KS      +RF+N   D +NI +       ++F + S Y    SLDV  G Y ++ C S     Y+     +  G   + ++  + +   W+   + +PN +H+ WQ+PQY+LIT  E++ SIT L F+YS++P SMKS++QA +L+T+  GN+IV+ VA  G+ L Q TEF LFA L++
Sbjct:   28 YPVSIAFIVVNEFCERFSYYGMKAVLTLYFIRYLHWNENLSTAVYHAFSGLCYFTPILGAIIADSWLGKFKTIIYLSIVYVIGHVIKSVGAIPDVGDSTTHVALSVLGLVLIAFGTGGIKPCVAAFGGDQFEEEHIDERRKFFSIFYMSINAGSVLSTIITPILRGDVQCFGGDCYALAFGVPAALMVVALVVFIAGSGLYEKTPPQGNVLLNVCKCIGFAISNRWKRPRNSPKRQHWLDWAEEKYSKRLIQEIKMVLRVLLLYIPLPMFWALFDQQGSRWTLQATRMNMDFGGGFVVKPDQMQMLNALLILVFVPIFDMGVYPLVGLCRIKLTPLRKMATGMILAALAF-CAATVVEVNVVKTVVETPPAKECLLQVLNLADGDVSVTFPGHSVFPQPIKPFEDPAEYTKLPLNDAMETFAVSVTHRDIVHQCQ---LNFSETTVYSLILHSDITCEL-VKDNYTKSDTGAAFLRFINTRTDNINISV-----GSQDFEVSSGYGISRSLDVERGQYNDVKCLSSTSKTYQIDLGLLDFGAFYTFILEGDSEQLTWRKTVDVQPNNVHIAWQVPQYVLITAGEVMFSITGLEFSYSQAPASMKSVLQAGWLLTVAFGNVIVLIVAE-GAGLEQWTEFVLFAALLV 662          
BLAST of slc15a-3 vs. Ensembl Cavefish
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 258.07 bits (658), Expect = 7.419e-76
Identity = 139/422 (32.94%), Postives = 245/422 (58.06%), Query Frame = 2
Query:   77 RLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLAS 1285
            + S +  E   +PL  + I+++E  ERFS+YGM+ +L +Y   +L ++D+  T +YH FV L YL+PI GAI+AD++LG+F T++ + +VY +G  +M ++AI                 ++   ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY +IN G+  +  +TPILR     ++ Q  CYPL FGVPA +  V  ++FI+G   YT      +++ +   CI  +I+N    +     K +  +++A  +Y+   I   K  L+++ ++ P+P+FWAL+DQQGSRWTLQA  M+G    ++ ++P+Q+Q++N +LI+ ++P+ D ++YP   K  +   P  R+     +A L+F+ A  +Q+ +      +F ++    +   ++ +  L+LT+D     LA+
Sbjct:   22 KKSKSQVECCGYPLSIFFIVVNEFCERFSYYGMRAVLVLYFRYFLRWDDDLATTIYHTFVALCYLTPILGAIVADSWLGKFKTIVYLSIVYTIGQAVMAVSAIHDITDSNQDGTPDNMTLHVALSMLGLFLIAVGTGGIKPCVAAFGGDQFQDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGINSQQKCYPLAFGVPAALMAVALVVFIAGSSMYTKAAPKGNIMLEVCKCIGFAIKNRFNHRSKVYPKREHWMDWANEKYNKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNF-GAFIVQPDQMQTVNPILILVMVPIVDSVVYPLIKKCGLNFTPLKRMTVGMFMAGLAFVAAALVQVQIDVRNPSKFPSSSQAQVKFLNLENSSLSLTVDGNPFDLAA 442          

HSP 2 Score: 91.6633 bits (226), Expect = 9.349e-19
Identity = 69/231 (29.87%), Postives = 114/231 (49.35%), Query Frame = 2
Query: 1421 NARIDIKSYFVKSPDSQNHIRFLN----------PNDPVNIEMLRL-AKDHKNFTIDSN---YSSLDVGV-----YEIYCSSPNYN---------EYKCGNVDVTPGLVGSLMMTSERKLHFW----KEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
              +ID+++       SQ  ++FLN            +P ++   ++  + H + TI+     Y+  D+G      +  Y S P            E  C N  ++ G   S  +       F     ++ +PN IHM WQ+PQY L+T  E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VA  G    Q  E+ LFA+L L+  CI + ++  F+   D
Sbjct:  400 QVQIDVRNPSKFPSSSQAQVKFLNLENSSLSLTVDGNPFDLAAFQVYTQKHTHPTINCTHCIYAPSDLGAIAPNEFSNYTSVPEGKATFTILGEMEQTC-NYTMSLGFGSSFTLLIPSTFSFGPDAIEDIKPNTIHMAWQIPQYFLMTSGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGQLPEQWAEYVLFASL-LMCVCIIFSIMAYFYTYID 628          
BLAST of slc15a-3 vs. Ensembl Cavefish
Match: SLC15A1 (solute carrier family 15 member 1 [Source:HGNC Symbol;Acc:HGNC:10920])

HSP 1 Score: 257.299 bits (656), Expect = 1.704e-75
Identity = 137/411 (33.33%), Postives = 241/411 (58.64%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLAS 1285
            +PL  + I+++E  ERFS+YGM+ +L +Y   +L ++D+  T +YH FV L YL+PI GAI+AD++LG+F T++ + +VY +G  +M ++AI                 ++   ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY +IN G+  +  +TPILR     ++ Q  CYPL FGVPA +  V  ++FI+G   YT      +++ +   CI  +I+N    +     K +  +++A  +Y+   I   K  L+++ ++ P+P+FWAL+DQQGSRWTLQA  M+G    ++ ++P+Q+Q++N +LI+ ++P+ D ++YP   K  +   P  R+     +A L+F+ A  +Q+ +      +F ++    +   ++ +  L+LT+D     LA+
Sbjct:   31 YPLSIFFIVVNEFCERFSYYGMRAVLVLYFRYFLRWDDDLATTIYHTFVALCYLTPILGAIVADSWLGKFKTIVYLSIVYTIGQAVMAVSAIHDITDSNQDGTPDNMTLHVALSMLGLFLIAVGTGGIKPCVAAFGGDQFQDHQEKQRSTFFSIFYLSINAGSLLSTLITPILRAQECGINSQQKCYPLAFGVPAALMAVALVVFIAGSSMYTKAAPKGNIMLEVCKCIGFAIKNRFNHRSKVYPKREHWMDWANEKYNKLLIAQVKMVLKVLFLYIPLPMFWALFDQQGSRWTLQATTMDGNF-GAFIVQPDQMQTVNPILILVMVPIVDSVVYPLIKKCGLNFTPLKRMTVGMFMAGLAFVAAALVQVQIDVRNPSKFPSSSQAQVKFLNLENSSLSLTVDGNPFDLAA 440          

HSP 2 Score: 90.5077 bits (223), Expect = 1.854e-18
Identity = 46/104 (44.23%), Postives = 71/104 (68.27%), Query Frame = 2
Query: 1706 KEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            ++ +PN IHM WQ+PQY L+T  E++ S+T L F+YS++P +MKS++QA +L+T+  GNIIV+ VA  G    Q  E+ LFA+L L+  CI + ++  F+   D
Sbjct:  534 EDIKPNTIHMAWQIPQYFLMTSGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGNIIVLIVAEAGQLPEQWAEYVLFASL-LMCVCIIFSIMAYFYTYID 636          
BLAST of slc15a-3 vs. Ensembl Cavefish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 255.758 bits (652), Expect = 1.154e-74
Identity = 194/672 (28.87%), Postives = 323/672 (48.07%), Query Frame = 2
Query:   98 ENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGL------SYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR--IMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVN------------IEMLRLAKDHKNFTIDSNYSSLDV-------GVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            E   +P+  + I+++E  ERFS+YGM+G   + LN Y   N     + Y+L + +       YLS ++        +G+    +             T   +  ++   ++G+ ++A+G+GGIK  V+AFGGDQ           +FS+FY  IN G+  +  +TPILR     +  Q  CYPL FGVPA + +V+ I+FI+G   Y       +++    +CI  +I N  + +     K       A  +Y    I   K   R++ ++ P+P+FW L+DQ+GSRWTLQA  M+G    S  ++P+Q+Q++N +LI+ L+P+ D ++YP   K      P  R+     +AA++F+ A  +QI +     +  + + S+L I+N +   ++N+TI  ++   + +   S  L  +   + VS+         KN +L+  K     I  D N     +    K     N +RF+N  +  VN            +E + L +  + FTI +   S          G Y     S       CGN  V                   ++ +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MK+++QA +L T+  GN IV+ VA +     Q  E+ LFA+L L+A CI + ++  F+   D
Sbjct:   17 ECCNYPVSIFFIVVNEFCERFSYYGMRG-KCVCLNHY---NKWCYCICYNLALNIFPSRTIIYLSIVYA-------IGQIVMAVSAINDLTDADRDGTPDNMSVHVGLAMLGLFLIALGTGGIKPCVSAFGGDQFDDHQTRQRSTFFSVFYLCINGGSLLSTLITPILRGQECGIHTQQKCYPLAFGVPAALMVVSLIVFIAGSGMYIKAKPKGNIMMDVCNCIGFAINNRFRHRSSKYPKREHWLDWADEKYDKLLIAQIKMVCRVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGTF-GSLVLQPDQMQTVNPILILTLVPIMDRVVYPLIKKCGFNFTPLKRMTVGMFLAAMAFVSAALVQIQIDETLPVFPSASESQLKIVN-MASGQMNITIPPQQPFALGSEQASDYLTFSNMNIMVSLNNPPIS---KNFSLTVKKRNTLIIPADPNTMYMTQDITSKPEQGSNAVRFVNGLSSEVNMSYAGNDKQFPALEYVYLPQGERIFTITNGIQSCSFSRKFGFGGAYTFLIPSTLLWTENCGNAIVE-----------------VEDIKPNTVHMALQIPQYFLITAGEVVFSVTGLEFSYSQAPSNMKAVLQAGWLFTVAVGNFIVLIVAELAKLPQQWAEYVLFASL-LVAVCIIFSIMAYFYTYVD 654          
BLAST of slc15a-3 vs. Ensembl Cavefish
Match: slc15a1a (solute carrier family 15 member 1a [Source:ZFIN;Acc:ZDB-GENE-091204-9])

HSP 1 Score: 253.832 bits (647), Expect = 5.724e-74
Identity = 193/654 (29.51%), Postives = 323/654 (49.39%), Query Frame = 2
Query:  131 ILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGL------SYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRR--IMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNP-NDPVN------------IEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            I+++E  ERFS+YGM+G   + LN Y   N     + Y+L + +       YLS ++        +G+    +             T   +  ++   ++G+ ++A+G+GGIK  V+AFGGDQ           +FS+FY  IN G+  +  +TPILR     +  Q  CYPL FGVPA + +V+ I+FI+G   Y       +++    +CI  +I N  + +     K       A  +Y    I   K   R++ ++ P+P+FW L+DQ+GSRWTLQA  M+G    S  ++P+Q+Q++N +LI+ L+P+ D ++YP   K      P  R+     +AA++F+ A  +QI +     +  + + S+L I+N +   ++N+TI  ++   + +   S  L  +   + VS+         KN +L+  K     I  D N     +    K     N +RF+N  +  VN            +E + L +  + FTI +   S         CS       K G       L+ S ++ +E  L   ++ +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MK+++QA +L T+  GN IV+ VA +     Q  E+ LFA+L L+A CI + ++  F+   D
Sbjct:   25 IVVNEFCERFSYYGMRG-KCVCLNHY---NKWCYCICYNLALNIFPSRTIIYLSIVYA-------IGQIVMAVSAINDLTDADRDGTPDNMSVHVGLAMLGLFLIALGTGGIKPCVSAFGGDQFDDHQTRQRSTFFSVFYLCINGGSLLSTLITPILRGQECGIHTQQKCYPLAFGVPAALMVVSLIVFIAGSGMYIKAKPKGNIMMDVCNCIGFAINNRFRHRSSKYPKREHWLDWADEKYDKLLIAQIKMVCRVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGTF-GSLVLQPDQMQTVNPILILTLVPIMDRVVYPLIKKCGFNFTPLKRMTVGMFLAAMAFVSAALVQIQIDETLPVFPSASESQLKIVN-MASGQMNITIPPQQPFALGSEQASDYLTFSNMNIMVSLNNPPIS---KNFSLTVKKRNTLIIPADPNTMYMTQDITSKPEQGSNAVRFVNGLSSEVNMSYAGNDKQFPALEYVYLPQGERIFTITNGIQS---------CSFSR----KFGFGGAYTFLIPSTLLWTENVLEV-EDIKPNTVHMALQIPQYFLITAGEVVFSVTGLEFSYSQAPSNMKAVLQAGWLFTVAVGNFIVLIVAELAKLPQQWAEYVLFASL-LVAVCIIFSIMAYFYTYVD 647          
BLAST of slc15a-3 vs. Ensembl Sea Lamprey
Match: slc15a1b (solute carrier family 15 member 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4661])

HSP 1 Score: 321.627 bits (823), Expect = 3.887e-100
Identity = 222/654 (33.94%), Postives = 358/654 (54.74%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKN-----------ILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVN-SYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLA-----SNGSVNL-----DLNPGLVQVSM-KCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGL----------VGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            +P+    I+++E  ERFS+YGMK +L +Y   +L +N+N  T +YH F GL Y +P+ GAIIAD++LG+F T+I + ++Y+LGHV+ ++ A+              ++  ++G+ ++A+G+GGIK  VAAFGGDQ   G D    K+FS+FY +IN G+  + FVTPILR D+ C    CY L FGVPA + ++  ++FI G  TYT  P   +VL   S+CI  +I+N    +     K    L++A+  Y+   I + K  LR++ ++ P+P+FWAL+DQQGSRWTLQA  M G     ++ +KP+Q+Q+IN +LI+ LIP+FD  IYP   K  I   P  R+    I+AAL+F+ A  +Q+ + +    +F ++G   L + +     LN+  +N +  +A     S  S  L     D+    +Q S+ K      + K   +  ++    +    N    D+ S   K  +    +RF+  N    IE + +   +    +  +YS  D   Y++        +  C  + V              +   +   E  +   ++   N I++ WQ+PQY L+T AE++ S+T L F+YS++P SMKS++QA +L+T+  GN+IV+ VA  G+ + Q  EF LFA L+ +
Sbjct:    1 YPISIAFIVVNEFCERFSYYGMKAVLVLYFRYFLHWNNNTATSVYHAFSGLCYFTPVLGAIIADSWLGKFKTIIYLSIIYVLGHVVKSIGALPDVGGHTVNVILIVMVLAMVGLGLIALGTGGIKPCVAAFGGDQFHPGMDHERGKFFSIFYLSINAGSLISTFVTPILRDDVQCFGADCYALAFGVPAILMVLALVVFIGGSSTYTKNPPEGNVLVNVSNCIGFAIKNRWNHRGKQFPKRDHWLDWAKGNYNDDLIMEVKMVLRVLFLYIPLPMFWALFDQQGSRWTLQATTMTGDFFQGAFVLKPDQMQTINPILILVLIPIFDVAIYPLIRKCGINFSPLRRMAVGMILAALAFVAAALVQLEIDKTLP-DFPSSGEFSLRVINAGAHPLNIQFENDQFDVANMSVYSTFSTVLYFICKDIYTVFLQASVHKSFNIVAKEKPFQIVAFRNGTMFPCSFNAEENDLVS---KPEEGMAAVRFVGGNS--EIETVNIGT-YSPVNVSGDYSFTD---YQLVFRG---KKETCKKIKVFLDFGAAYTILLKPISKTLQQDEFGILMIQDLPENSINLAWQVPQYFLLTAAEVMFSVTGLEFSYSQAPTSMKSVLQAGWLLTVAFGNVIVLIVAE-GANMEQWVEFILFACLLFV 640          
BLAST of slc15a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005298.1 (pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 gene:ENSPMAG00000004819.1 transcript:ENSPMAT00000005298.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 3.952e-6
Identity = 19/44 (43.18%), Postives = 30/44 (68.18%), Query Frame = 2
Query: 1709 EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKS 1840
            E+E   + + WQ+PQ++L+  +E+L SI  L FAYS +P  M+S
Sbjct:  119 EYEAARLTVWWQLPQFLLVGLSELLTSIGGLEFAYSAAPKHMQS 162          
BLAST of slc15a-3 vs. Ensembl Yeast
Match: PTR2 (Integral membrane peptide transporter; mediates transport of di- and tri-peptides; conserved protein that contains 12 transmembrane domains; PTR2 expression is regulated by the N-end rule pathway via repression by Cup9p [Source:SGD;Acc:S000001801])

HSP 1 Score: 103.219 bits (256), Expect = 2.243e-23
Identity = 96/414 (23.19%), Postives = 179/414 (43.24%), Query Frame = 2
Query:   59 EKMKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNL--------YLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIG------------SGGIKSSVAAFGGDQVP----------------TGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPE----YSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMN-GKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRG 1177
            E+M+  R  G      K P+ CW+I I E+ ERFS+YG+      Y+           L  N    T L + F    Y++P+FG  +AD + G++ T+     +Y+ G  ++ +T+I      P +G    AIG            +G IK++++    DQ+P                  +++ ++  F  FY  IN+G+ +    T +          + +   + +P   F +  +  I GK+ Y   P    V++K     ++  +N         + +      PE    ++ KF+D+ K+AL    VF   P++W  Y    S +  QA  M    I N +      +Q+ +++ +I  IP+F+  +YPF  ++  L KP +++   ++  + +   A  LQ ++ + 
Sbjct:   66 EEMQTLRHVGG-----KIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI------PSVGNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYH-------KGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFKVCWILTKN------KFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGIPNDF------LQAFDSIALIIFIPIFEKFVYPFIRRYTPL-KPITKIFFGFMFGSFAMTWAAVLQSFVYKA 448          

HSP 2 Score: 73.9442 bits (180), Expect = 3.905e-14
Identity = 41/109 (37.61%), Postives = 61/109 (55.96%), Query Frame = 2
Query: 1718 PNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMD 2044
            PN +H+ WQ+P Y+LI+ +EI  SIT L +AYS++P SMKS + +I+L+T   G+ I   ++ V      T  F   A    I+GC+ W+  R +    D   E   MD
Sbjct:  461 PNHVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKY---NDTEEEMNAMD 566          
BLAST of slc15a-3 vs. Ensembl Nematostella
Match: EDO33075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST97])

HSP 1 Score: 359.377 bits (921), Expect = 7.245e-115
Identity = 226/635 (35.59%), Postives = 363/635 (57.17%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI-----QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXX-XXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQ--NIEFNTAGSKLLIINSINDCKLNLT---IDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKN--LTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQN-HIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHF--WKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLI 1966
            +P+  W IL +E  ERFS+YGM  IL IYL   L  +D+  T +YH F  L Y SP+ GAI+AD++LG++ T++ V ++Y  G++++ +T+I     +  + G +IG+ ++AIG+GGIK  V+AFGGDQ     + +++ +FS+FY AINLG+  +  VTPILR D++C    CYPL FGVPA + + +  +F  G++ Y  +P   +V+ + +  +  +I+N  + K    K    +++A+ +Y  K I D K   +++ +F P+PVFW L+DQQGSRWTLQA+ M+G +     +KP+Q+Q++N + I+ LIP+F++ IYP   K N+LVKP  R+ A  ++AA+SF+ A FL I + + +   +E     + L +IN+   C L ++    D    +  ++   ++ +    ++V  +     +  KN  L +S++++    I   N   + +K   VK P + +  +R   P++  +   +R+ + H       NY SL  G   I   +    EY    V V    VG L +    +L    + +  P  I MLWQ+PQYI++T  E+L SIT L FAYS+SP SMKS + A +L+T+  GN IVV  A         TEFF FA L+ +
Sbjct:    7 YPISVWYILGNEFCERFSYYGMHAILVIYLTHMLKMDDDSATAVYHAFNMLCYFSPLLGAILADSWLGKYRTILYVSMIYAFGNIVVAITSIPAILAKVKLTGVMIGLLLIAIGTGGIKPCVSAFGGDQFSAAQENLLQSFFSIFYFAINLGSLLSMIVTPILRGDVNCFGNNCYPLAFGVPAILMITSVGLFWCGRKKYKKIPPEGNVVLQVTCAVGCAIKNRFRNKDPSVKKDHWMDWAENDYGAKMISDIKALFKVLFMFLPMPVFWTLFDQQGSRWTLQAEEMDGDLGAFGTLKPDQVQAMNPVFILILIPLFEYAIYPLLSKCNLLVKPLQRMCAGMLLAAISFVFAAFLHIAIQKSRLHVVEPPNGFANLRVINA-APCPLKVSGFGFDTSLAVDKASVYAHVPITLTNLKVESQNCSVAVPEKNFLLKISEHEVNTFVIGTKNKELVGLKVRQVKRPHNHSFKVRVKRPHN--HSFKVRVKRPH-------NY-SLKQG--RIGSVTTGGREYFLWAVKVC--RVGPLQVVCSFQLEMIRYTDVRPMSISMLWQLPQYIVLTSGEVLFSITGLEFAYSQSPVSMKSCIMAAWLLTVSIGNAIVVVFAEARITNNMATEFFFFAGLLAV 626          
BLAST of slc15a-3 vs. Ensembl Nematostella
Match: EDO28569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T640])

HSP 1 Score: 129.798 bits (325), Expect = 2.069e-34
Identity = 67/169 (39.64%), Postives = 106/169 (62.72%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAI----QKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISC 601
            +FP   W IL+ E  ERFS+YG+K +L +YL   L FN +    +YH F  +SY + + GA++AD++LG++ T+     VY L  +L+T T+     Q++ +GPLIG+ ++AI  G IK  +AAFGGDQ       ++E +F++FY ++N+GA    +  PI+R D+ C
Sbjct:   35 QFPKATWPILVAEFGERFSYYGIKTVLVLYLTKDLMFNKDKGKAIYHAFSMVSYFTGVIGAMMADSFLGKYKTIAYTLFVYCLSEILLTATSADDIGQRSSIGPLIGLFLMAIACGNIKPCLAAFGGDQFKVEQSHLLELFFAMFYASVNVGAVLCMYFIPIVRTDVQC 203          
BLAST of slc15a-3 vs. Ensembl Nematostella
Match: EDO33176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ4])

HSP 1 Score: 122.479 bits (306), Expect = 2.691e-29
Identity = 89/368 (24.18%), Postives = 175/368 (47.55%), Query Frame = 2
Query:  131 ILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGR-----------FYTXXXXXXXXXXXXXXMTLTAIQKNIL-------GPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXX--XXXXXAQPEYSMKF----IDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQI 1162
            IL+ E+ ER +FYG+   L  +    LGF     + +  LF G  Y  P+FG  +AD ++GR           F+  ++          ++ +   Q   L         ++ + ++A G+GGIK++V+ FG DQV       ++K+F+ FY  IN+G+F +  +   +++  +      +  G+ V A   ++  ++F++G+  Y + P   SVL+     + ++I+ +    K  + +    L+ A+  Y   F    +++ K  +R++ VFA   ++W LY Q  + + +QA+YM   +     +    +   + + ++ LIP+ D ++YP      +   P  R+    + AA S  +AG ++I
Sbjct:   49 ILLTELCERLTFYGITANLVPFCEDSLGFKRPMPSTVNLLFQGTCYFIPVFGGWLADTFMGRYNVIYGSCLVYFFGTVLFAAGACTTGDILNIFGKQTKYLSSSLRKASSIVALVVIAFGTGGIKANVSPFGADQVQGKGPRAVQKFFNWFYWFINIGSFLSFTLIVWVQQKYT------FFYGYAVTAISMMIGTVVFMTGRNWYVVRPPGGSVLTDTYRVVKLAIKRHWSSDKNLQSEGIHWLDRAKESYGGAFSYHRVENVKSLIRLLPVFAMFIIYWTLYSQMQTSYLIQAEYM--MLDYGIQLPAASLSIFDIVCVLLLIPLMDKVVYPLLRYCGVRFTPLRRVGVGMLFAAASVAVAGLVEI 408          

HSP 2 Score: 48.9062 bits (115), Expect = 6.374e-6
Identity = 21/52 (40.38%), Postives = 36/52 (69.23%), Query Frame = 2
Query: 1727 IHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGN 1882
            + + +Q+PQ++LI  +E+  SIT L FAYS++P  ++ L+  I+L+T   GN
Sbjct:  434 MSIFYQVPQFMLIGTSEVFTSITGLEFAYSQAPRCLQGLVMGIFLVTSGLGN 485          
BLAST of slc15a-3 vs. Ensembl Nematostella
Match: EDO29495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3H0])

HSP 1 Score: 71.633 bits (174), Expect = 5.274e-15
Identity = 35/89 (39.33%), Postives = 60/89 (67.42%), Query Frame = 2
Query: 1694 LHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLV 1960
            LH  ++ E  ++  L Q+PQY++IT AE++ S+T L FAYS++P+SMKS++Q+ +L+T+  G++IVV ++          E FL+  L+
Sbjct:    4 LH--QDAEGTIVSRLLQIPQYVVITAAEVMFSVTGLGFAYSQAPNSMKSVLQSFWLLTVAFGDLIVVILSSAKPVKGVEKEMFLYGGLM 90          
BLAST of slc15a-3 vs. Ensembl Nematostella
Match: EDO37372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ9])

HSP 1 Score: 77.0258 bits (188), Expect = 1.032e-14
Identity = 89/401 (22.19%), Postives = 184/401 (45.89%), Query Frame = 2
Query:  107 KFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFN-----------DNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRF---YTXXXXXXXXXXXXXXMT---------LTAIQKNILGPLIG-MSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIR----------NXXXXXXXXXXXXXXXXAQPEYSMKFID----DCKKALRIMIVF-APIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSI-NALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIE 1189
             FPL C  I++  +LER ++YG+   L ++L   + F             N   V    + G+++     G  I D+Y G +   Y  +++ ++      ++T         L   ++  +G  IG + +L+IG G  K++++AFG +Q+ + +     ++F+ +Y AIN+ +F A  +   ++ +        +  G+ +     L+  ++F   +  Y I P S ++L K    I  + R            +  ++    +S L+ A  +Y   F+D    + K   +I ++F A IP +W +Y Q  S +  Q  +MN   ++  +  P    ++ + + ++ LIPV D +IYP+  +  + V    R+   ++ A  + ++AG ++    + +N+E
Sbjct:    5 SFPLVC--IILAVLLERTTYYGILSNLVVFLTTEMDFAFGSLGVGNSTISNGIIVSVFAYTGMAWFMSTVGGFIGDSYSGHYNAIYGSLLIYILGSGSLFMITVLLKYSSSSLNDYKELSVGLTIGTLLVLSIGEGTYKANISAFGAEQLSSDDSKTYRQFFNWYYWAINVASFLAYMLLAYIQVNWG------FFYGYLISLCCILLACVLFCIPQSHYNIKPASGNILKKVCGVIREAYRLRKGRTENRYTIVILEEFLPIQSWLDRAMIKYGGTFLDTDVEEVKTLRKISLIFLAQIP-YWMIYFQMNSTFLNQGLHMNLIDISEGSHIPAAWLTVTDVIFVLLLIPVMDKLIYPWLDRRGLRVSVLMRISIGFLFAVAAMVVAGGVE---YKRRNVE 393          
BLAST of slc15a-3 vs. Ensembl Medaka
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:101160202])

HSP 1 Score: 366.311 bits (939), Expect = 2.601e-116
Identity = 231/676 (34.17%), Postives = 387/676 (57.25%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX-AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNA------RID-------IKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYS-----SLDVGVY-EIYCS--SPNYNEYKCGNVDVTPGLVGSLMMTSERKL-HFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 2047
            +PL    I+++E  ERFS+YGMK +L +Y   YL ++ + +T +YH F GL Y +PI GAIIAD++LG+F T+I + +VY++GHV+ ++ AI        +I   ++G+ ++AIG+GGIK  VAAFGGDQ    +    +K+FS+FY +IN G+  +  +TP+LR D+ C  G CY L FGVPA + +V  ++FI+G   Y   P   ++L +   CI  +I+N  +  K    +      A+ +YS + I + K  LR+++++ P+P+FWAL+DQQGSRWTLQA  MN    NS+N+KP+Q+Q +NALLI+  +P+FD +IYP      +   P  ++    I AAL+F+ A  ++I +++   ++    G  LL + ++    +++ I N    L  +    L   P    + ++    +L ++ ++ S  K+     ++D  A      ++D       ++    K+ D + ++RF +   +P+NI + ++     NF    +YS     ++D   Y  ++C   S +      G +D        LM  S + + H  ++ + N +H+ WQ+PQY+L+T  E++ SIT L F+YS++P +MKS++QA +L+T+  GN+IV+ VA  G+ L Q  EF LFA L L+  CI + ++  F+     +VE +NMD 
Sbjct:   10 YPLSICFIVVNEFCERFSYYGMKALLTLYFVTYLKWDKDLSTAIYHAFSGLCYFTPILGAIIADSWLGKFRTIIYLSIVYVIGHVVKSVGAIPTVGNTDVHIALSMVGLILIAIGTGGIKPCVAAFGGDQFDEEHVSERQKFFSIFYMSINAGSLLSTLITPVLRGDVQCFGGDCYALAFGVPAALMIVALVVFIAGSSLYKRNPPQGNILLQVCKCIGFAIKNRWRNSKHESKRKHWLDWAEEKYSKRLIQEVKMVLRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMAFGNSFNIKPDQMQMLNALLILLFVPIFDLVIYPLVRLCRVKTTPLRKMATGMIFAALAFVAATLVEINVVK-TVVDPAPEGKCLLQVINLAQGDISVKIPNND--LFPDAIAYLQDPPKYEMLELEAARMELNIE-VSFSGSKVVCQEKFEDQKAHSLIIYKVDTNLRCLLVEDNVEKNTDGKPYVRFFSTLQEPMNITVGQV-----NFYAPPDYSMSSNDTVDRNEYPAVHCDLQSEDCPGLNLGLLDFGASYTFILMKESGQIVAHRMEDVKANSVHIAWQIPQYVLLTAGEVMFSITGLEFSYSQAPSNMKSVLQAGWLLTVAFGNVIVLIVAE-GAGLEQWKEFVLFAAL-LLGVCIIFSVMSIFY----KYVEPENMDK 670          
BLAST of slc15a-3 vs. Ensembl Medaka
Match: slc15a2 (solute carrier family 15 member 2 [Source:NCBI gene;Acc:101160202])

HSP 1 Score: 365.54 bits (937), Expect = 7.217e-116
Identity = 231/676 (34.17%), Postives = 387/676 (57.25%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX-AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNA------RID-------IKSYFVKSPDSQNHIRFLNP-NDPVNIEMLRLAKDHKNFTIDSNYS-----SLDVGVY-EIYCS--SPNYNEYKCGNVDVTPGLVGSLMMTSERKL-HFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 2047
            +PL    I+++E  ERFS+YGMK +L +Y   YL ++ + +T +YH F GL Y +PI GAIIAD++LG+F T+I + +VY++GHV+ ++ AI        +I   ++G+ ++AIG+GGIK  VAAFGGDQ    +    +K+FS+FY +IN G+  +  +TP+LR D+ C  G CY L FGVPA + +V  ++FI+G   Y   P   ++L +   CI  +I+N  +  K    +      A+ +YS + I + K  LR+++++ P+P+FWAL+DQQGSRWTLQA  MN    NS+N+KP+Q+Q +NALLI+  +P+FD +IYP      +   P  ++    I AAL+F+ A  ++I +++   ++    G  LL + ++    +++ I N    L  +    L   P    + ++    +L ++ ++ S  K+     ++D  A      ++D       ++    K+ D + ++RF +   +P+NI + ++     NF    +YS     ++D   Y  ++C   S +      G +D        LM  S + + H  ++ + N +H+ WQ+PQY+L+T  E++ SIT L F+YS++P +MKS++QA +L+T+  GN+IV+ VA  G+ L Q  EF LFA L L+  CI + ++  F+     +VE +NMD 
Sbjct:   27 YPLSICFIVVNEFCERFSYYGMKALLTLYFVTYLKWDKDLSTAIYHAFSGLCYFTPILGAIIADSWLGKFRTIIYLSIVYVIGHVVKSVGAIPTVGNTDVHIALSMVGLILIAIGTGGIKPCVAAFGGDQFDEEHVSERQKFFSIFYMSINAGSLLSTLITPVLRGDVQCFGGDCYALAFGVPAALMIVALVVFIAGSSLYKRNPPQGNILLQVCKCIGFAIKNRWRNSKHESKRKHWLDWAEEKYSKRLIQEVKMVLRVLVLYIPLPMFWALFDQQGSRWTLQATRMNMAFGNSFNIKPDQMQMLNALLILLFVPIFDLVIYPLVRLCRVKTTPLRKMATGMIFAALAFVAATLVEINVVK-TVVDPAPEGKCLLQVINLAQGDISVKIPNND--LFPDAIAYLQDPPKYEMLELEAARMELNIE-VSFSGSKVVCQEKFEDQKAHSLIIYKVDTNLRCLLVEDNVEKNTDGKPYVRFFSTLQEPMNITVGQV-----NFYAPPDYSMSSNDTVDRNEYPAVHCDLQSEDCPGLNLGLLDFGASYTFILMKESGQIVAHRMEDVKANSVHIAWQIPQYVLLTAGEVMFSITGLEFSYSQAPSNMKSVLQAGWLLTVAFGNVIVLIVAE-GAGLEQWKEFVLFAAL-LLGVCIIFSVMSIFY----KYVEPENMDK 687          
BLAST of slc15a-3 vs. Ensembl Medaka
Match: slc15a1a (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101165016])

HSP 1 Score: 307.375 bits (786), Expect = 1.265e-93
Identity = 214/678 (31.56%), Postives = 361/678 (53.24%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXX--AQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGY-IYKDNNARI----DIKSYFV-----KSPDSQNHIRFLN--PNDPVNIEMLRLAKDHKNFTI-----DSNYSSLDVGVYEIYCSSPNYN-EY--KCGNVDVTPGLVGSLMM---TSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L ++D+  T +YH FV L YL+PI GAI+AD++LG+F T+I + +VY +G V M ++AI                 +++  ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY  IN G+  +  +TPILR     +  Q  CY L FGVPA + +V+ ++FI G   Y       +++     CI  +I+N  + +  +  K       A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M+G       ++P+Q+Q+ N +LI+ L+P+ + ++YP   K      P  R+     +AAL+F+ AG +Q+ + +   I  +T+ S+L ++N  N        +   + L +N +V+L   P   Q S +   Y+ Q  ++++    +T    + K     +     I+  ++     K  +  N IRF+N    D      L ++    NF I      SNYS L  G +     S + + EY  K G        + S        +  +   +E +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MK+++QA +L+T+  GN IV+ VA +     +  EFFLFA+L L+A C+ + ++  F+   D
Sbjct:   27 YPISIFFIVVNEFCERFSYYGMRAVLVLYFKYFLQWDDDLATSIYHTFVALCYLTPILGAIVADSWLGKFKTIIYLSIVYAIGQVAMAVSAIHDITDSDRDGTPNNMTFHVVLSMVGLFLIALGTGGIKPCVAAFGGDQFDDHQEKQRRTFFSVFYLCINGGSLLSTIITPILRGQTCGIYSQQKCYALAFGVPAALMVVSLVVFIVGSGMYYKAKPEGNIMLSVCKCIGFAIKNRYRHRSKAYPKRKHWMDWAEEKYDRLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGNF-GQLVIQPDQMQTFNPILILTLVPIMESVVYPLIKKCGFNFTPLKRMTVGMFLAALAFVCAGVVQLQIDKTLPIFPSTSESQLKLLNMGN--------NQLEVHLPNNFTVHLP--PA--QASEEYFTYKEQEVSISIGNPPVTETIPLVKGKRQTLLIPPTIREEWIDDLTSKPEEGNNAIRFVNGLATD------LNVSTAAVNFGIIEPLTSSNYSLLKNGKHTFSLKSGSQSCEYTIKFGFGSSYTIFIPSTFTFGPNCQESVTEVEEIKPNSVHMALQIPQYFLITAGEVMFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAVGNFIVLIVAEIAKLPKKWAEFFLFASL-LVAVCVIFSIMAYFYTYID 684          
BLAST of slc15a-3 vs. Ensembl Medaka
Match: slc15a1a (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101165016])

HSP 1 Score: 304.679 bits (779), Expect = 3.157e-93
Identity = 208/674 (30.86%), Postives = 354/674 (52.52%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVD---------VTPGLVGSLMM----------TSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L ++D+  T +YH FV L YL+PI GAI+AD++LG+F T+I + +VY +G V M ++AI                 +++  ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY  IN G+  +  +TPILR     +  Q  CY L FGVPA + +V+ ++FI G   Y       +++     CI  +I+N  + +  +  K K  +++A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M+G       ++P+Q+Q+ N +LI+ L+P+ + ++YP   K      P  R+     +AAL+F+ AG +Q+ + +   I  +T+ S+L ++N  N        +   + L +N +V+L   P              Q+ +LT                          K  +  N IRF+N           LA D     ++ + ++++ G+ E   SS NY+  K GN+          +  G   S  +            +  +   +E +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MK+++QA +L+T+  GN IV+ VA +     +  EFFLFA+L L+A C+ + ++  F+   D
Sbjct:   15 YPISIFFIVVNEFCERFSYYGMRAVLVLYFKYFLQWDDDLATSIYHTFVALCYLTPILGAIVADSWLGKFKTIIYLSIVYAIGQVAMAVSAIHDITDSDRDGTPNNMTFHVVLSMVGLFLIALGTGGIKPCVAAFGGDQFDDHQEKQRRTFFSVFYLCINGGSLLSTIITPILRGQTCGIYSQQKCYALAFGVPAALMVVSLVVFIVGSGMYYKAKPEGNIMLSVCKCIGFAIKNRYRHRSKAYPKRKHWMDWAEEKYDRLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGNF-GQLVIQPDQMQTFNPILILTLVPIMESVVYPLIKKCGFNFTPLKRMTVGMFLAALAFVCAGVVQLQIDKTLPIFPSTSESQLKLLNMGN--------NQLEVHLPNNFTVHLP--PA-------------QIDDLT-------------------------SKPEEGNNAIRFVN----------GLATD-----LNVSTAAVNFGIIEPLTSS-NYSLLKNGNLKSGSQSCEYTIKFGFGSSYTIFIPSTFTFGPNCQESVTEVEEIKPNSVHMALQIPQYFLITAGEVMFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAVGNFIVLIVAEIAKLPKKWAEFFLFASL-LVAVCVIFSIMAYFYTYID 622          
BLAST of slc15a-3 vs. Ensembl Medaka
Match: slc15a1a (solute carrier family 15 member 1 [Source:NCBI gene;Acc:101165016])

HSP 1 Score: 304.294 bits (778), Expect = 6.635e-93
Identity = 205/656 (31.25%), Postives = 347/656 (52.90%), Query Frame = 2
Query:  110 FPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK---------------NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQ--CYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXX--XXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVD----VTPGLVGSLMM----------TSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            +P+  + I+++E  ERFS+YGM+ +L +Y   +L ++D+  T +YH FV L YL+PI GAI+AD++LG+F T+I + +VY +G V M ++AI                 +++  ++G+ ++A+G+GGIK  VAAFGGDQ     +     +FS+FY  IN G+  +  +TPILR     +  Q  CY L FGVPA + +V+ ++FI G   Y       +++     CI  +I+N  + +  +  K K  +++A+ +Y    I   K  L+++ ++ P+P+FW L+DQ+GSRWTLQA  M+G       ++P+Q+Q+ N +LI+ L+P+ + ++YP   K      P  R+     +AAL+F+ AG +Q+ + +   I  +T+ S+L ++N  N        +   + L +N +V+L   P              Q+ +LT                          K  +  N IRF+N           LA D     ++ + ++++ G+ E   SS NY+  K G+      +  G   S  +            +  +   +E +PN +HM  Q+PQY LIT  E++ S+T L F+YS++P +MK+++QA +L+T+  GN IV+ VA +     +  EFFLFA+L L+A C+
Sbjct:   31 YPISIFFIVVNEFCERFSYYGMRAVLVLYFKYFLQWDDDLATSIYHTFVALCYLTPILGAIVADSWLGKFKTIIYLSIVYAIGQVAMAVSAIHDITDSDRDGTPNNMTFHVVLSMVGLFLIALGTGGIKPCVAAFGGDQFDDHQEKQRRTFFSVFYLCINGGSLLSTIITPILRGQTCGIYSQQKCYALAFGVPAALMVVSLVVFIVGSGMYYKAKPEGNIMLSVCKCIGFAIKNRYRHRSKAYPKRKHWMDWAEEKYDRLLIAQIKMVLKVLFLYIPLPMFWTLFDQKGSRWTLQATTMDGNF-GQLVIQPDQMQTFNPILILTLVPIMESVVYPLIKKCGFNFTPLKRMTVGMFLAALAFVCAGVVQLQIDKTLPIFPSTSESQLKLLNMGN--------NQLEVHLPNNFTVHLP--PA-------------QIDDLT-------------------------SKPEEGNNAIRFVN----------GLATD-----LNVSTAAVNFGIIEPLTSS-NYSLLKSGSQSCEYTIKFGFGSSYTIFIPSTFTFGPNCQESVTEVEEIKPNSVHMALQIPQYFLITAGEVMFSVTGLEFSYSQAPSNMKAVLQAGWLLTVAVGNFIVLIVAEIAKLPKKWAEFFLFASL-LVAVCV 620          
BLAST of slc15a-3 vs. Planmine SMEST
Match: SMESG000042203.1 (SMESG000042203.1)

HSP 1 Score: 1195.26 bits (3091), Expect = 0.000e+0
Identity = 620/625 (99.20%), Postives = 622/625 (99.52%), Query Frame = 2
Query:  173 MKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 2047
            MKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHVLMTLTAIQKNILGPLIGM ILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKI NSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKC+GYQLQVKNLTLSQYKMTGGYIYKDNN RID+KSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN
Sbjct:    1 MKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHVLMTLTAIQKNILGPLIGMCILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIGNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSVNLDLNPGLVQVSMKCLGYQLQVKNLTLSQYKMTGGYIYKDNNERIDMKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVENQNMDN 625          
BLAST of slc15a-3 vs. Planmine SMEST
Match: SMESG000039777.1 (SMESG000039777.1)

HSP 1 Score: 336.265 bits (861), Expect = 1.001e-104
Identity = 222/676 (32.84%), Postives = 367/676 (54.29%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQK-NILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCV-DGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDNRRIMLASNGSV---NLDLNPGLVQVSM---KCVGYQLQVKNL-TLSQYKMTGGYIYK--DNNARIDIKSY---------------FVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSNYSSL-DVGVYEIYCSSP--------NYNEY------KCGNVDVTPGLVGS-------LMMTSERKLHFWKEFEPN---LIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCI 1978
            F FP   + I+I E+ ERFS+YGM+ IL +YL  +L   +++   +YH+FV L Y + I G+ I+DNYLG++ T++++  +Y LG  LM+LT+I   N+ GP+I + ++A G+GG+K+ V   GGDQ+P    ++++ YFS+FY  INLGA A+  +TPILR +++C     CYPL FG+PA +  V  +I + G + Y  VP   S+  K   C   +++N+ +E+  S  K +LEYA  EY   FI+D +  LRI I++ P+PV+WALY+Q GSRWTLQA  M+G++ N+  + P+Q+  +N +++I LIP+FD  IYP     +  ++P  R+        LSF  A  LQ  +   Q +  N   S+L ++NS + C++ +TI N   +++    +   ++DL  G   + +   KC     ++  L +++       YI    +NN +I ++++                V S    N  +F+  +    +    +  +       S++ +L   G Y     SP        N +++         N++V P  + S       +M+++  +         N    I ++WQ PQY+LI+  EIL SIT LSF+Y ++PD MKSL+ A + ++   GNIIV+ VA +     Q+ E+ +FA L ++   I
Sbjct:   28 FHFPRAVYFIIITELCERFSYYGMRTILILYLTQHLLLKESNAVSIYHMFVSLCYFTTIIGSFISDNYLGKYRTLVILCSLYTLGSTLMSLTSIPAINLSGPIISLLLIAFGTGGVKACVGPLGGDQIPAHKKVLLDSYFSMFYFGINLGALASTILTPILRANVACNGTDDCYPLAFGIPAILMGVALLILLLGHKFYVHVPIRDSIYMKTISCFITAVKNWYRERHNSPKKELLEYASSEYDAAFINDLRTILRIAILYLPLPVYWALYEQMGSRWTLQAAQMDGELANNLVILPDQMSILNVIMVIVLIPIFDSCIYPISYNISPKLRPLRRMTIGIAFTCLSFFAAFALQKQIEARQPLPINVGNSRLFLVNS-HPCEVQMTIGNAYTLVSGGYKISQSSIDLPDGTYNIQLKYAKCNLINQEISTLISINLVPKRNNYILSNLENNQKISVQTFHAFQKSNPKGHPLAKLVASTALLNKYQFIIKHSTTGVLAAIVTVEGNQSVFQSDWITLMKTGRYIWNVKSPVLPPNVPSNTSKWDGVLSLNGNNLEVNPIRITSSEVIIFYMMLSNPEQTVITIPLLLNNGSTISIMWQFPQYLLISIGEILVSITGLSFSYDQAPDGMKSLVNAFWYLSNAFGNIIVMVVAKMDLVEKQSWEYLIFAILCIVFNVI 702          
BLAST of slc15a-3 vs. Planmine SMEST
Match: SMESG000011953.1 (SMESG000011953.1)

HSP 1 Score: 207.994 bits (528), Expect = 1.410e-57
Identity = 176/674 (26.11%), Postives = 326/674 (48.37%), Query Frame = 2
Query:  104 FKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISG--KRTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASY---IVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTI--DNRRIMLASNGSVNLDLNPGLVQVSMKCVG-YQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPDSQNH--IRFLN---PNDPVNIEMLRLAKDHKNFTIDS------NYSSLDVGVYEIYCSSPNYN-EYKCGNVDVTPGLVGSLMMTSERKLHFW---KEFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKDNFVE---NQNMDN 2047
            FKF    ++++ ++++     Y     + IY+   L F+D  +T ++H   G+  ++ I GAI+ D++LGR  T ++     +L    +++ AI     G +    +LAI  G +  ++     DQ+P  N +M+  +    Y   N G     ++ PI+ KDI C D +CYPL F +   +  + ++IF+ G   + + I   ++++L     CI+ +++  I   K    K+ L+Y+  +Y   FI+D K A  ++I     P+FW +++Q  S WTLQA+YM+G I   + +K +Q+Q++N +L++ +IP+F+ ++YP   K N   K   R+V      ++A +S I   F    +I  +N       S  ++    N  K NLT+  D++ + + S  + +  L     Q S   V  Y  +V  LT S        ++ +N       S  V    +  +  +R  N     DP++I +      +K F++ S      NY    +G+++++  + N N   K G V + P    +L+++ +     +    E    L ++LWQ+  YIL+T  EI  ++ +  F Y E+P SMK+++ A   I I  GNI ++ +  + S ++    F +   LV  +G +  +L   F++   N  +   N+N D+
Sbjct:   18 FKFSTGGYLLVCYQLISGMGSYCYILSMPIYMASILKFSDTTSTTIFHARSGIGTITNICGAILGDSFLGRSKTYLLFQPFSILLIGSISVMAIYTKTEGIITTYFLLAILGGLVSPAIRTIIADQIPKDNKIMLSTFLHCIYFMNNFGVIIVAYLAPIMHKDIYCFDNECYPLVFFISFLLSSLAFMIFVVGFLMKLFVIYKPTENLLLNILKCIHHAVKKRILLGKSPPTKTWLDYSNEKYDKSFINDIKIAKSLLIFLIAHPLFWTVFEQISSIWTLQAQYMDGMISEQFVIKADQMQTLNPILVVLIIPLFELVVYPCLDKINF--KVPYRIVTGQFFTVLACVSMIFIQFQIDSVIEPKN-------SDTILSTLFNGAKTNLTVKYDSKSLEITSFQTKSFRLK----QNSYFVVNFYNHKVNILTNSSSNKDFLTVFYENLTDFQYVSKEVTKQTNGGYANVRMFNLVESKDPISILLKARVGINKEFSLFSRGYEFGNYVKCGIGLFDVFLVNKNQNINKKIGKVTLFPAESKTLVISGKATNETFVDLSELRLKLPNILWQIIPYILVTLGEIFFNVNTGIFLYGEAPLSMKAMLLAAEYICIALGNIFILALKQLLSNMSLIYLFLICGILVFASGILTGVL-GYFYLKNRNITDCPVNENSDS 677          
BLAST of slc15a-3 vs. Planmine SMEST
Match: SMESG000011908.1 (SMESG000011908.1)

HSP 1 Score: 200.675 bits (509), Expect = 5.316e-55
Identity = 183/683 (26.79%), Postives = 326/683 (47.73%), Query Frame = 2
Query:   47 EKILEKMKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGK--RTYTIVPRSKSVLSKFSHCIYVSIRNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVASYIVAALSFIIA---GFLQIYLIRGQNIEFNTAGSKLLIINS-----INDCKLNLTIDN---RRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYKDNNARIDIKSYFVKSPD-SQNHIRFLNPNDPVNIEMLRLAKD---HKNFTIDSN------YSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSER-KLHFWK--EFEPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLITIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISKD 2017
            E   EK+KF+         +KFP    ++++++       Y    I  IY+   + ++D   T  YH   G+++   I GAIIAD+YLGR  T ++   + +L +  + + +I +     +  + I A+  G   S++ AF GDQ+P  + +M+  +  + Y   NLG     FV PI+ KDI C   +CYPL F +   + ++T+ I   G   R + I   +K++  +   CI   ++    +K  +     ++YA+ +Y + F+ DCK  L ++      P+F+ +++Q  S WT QA+YM+G + N + +K + IQ++N +L++ LIP+F+  IYP   K N  V P    V  Y  A   F +     F+   L+ G N   +  G K+L  NS     I+D   N TI     ++ +++S GS           +++    + + V N +   + M    +Y +N+    + S  +   D   + +R LN N     E + L      +KNF +  N      Y   ++G +E+   S N +  K     + PG    + + +E  KL   +  E++ +L  + WQ   Y+ +T  E+  ++ +  F YSE+P SMKS++ +   + I  G++I++ ++ V   L     F L   LV I+G +  +L R +   K+
Sbjct:    5 ESSTEKLKFWH-------KYKFPKGAALLIVYQFFSGMGVYAFTLIFPIYMTSMMMYSDATATSFYHARAGITFCMNIVGAIIADSYLGRIKTFLIFYPIDILMYFGVFIFSIYETYTTLVTVVLISAVLCGMYGSAMRAFVGDQIPETDQVMLSTFLHMIYLINNLGIIIIGFVGPIIHKDIYCFKKECYPLNFVLTVLLMVLTFSIVGLGLFLRWFVIKLPTKNIFIETLACIGYGMK-CRFQKGRNPGGHWMDYAEDKYGVVFVHDCKVVLGLIFFLLGHPIFFTVFEQMSSVWTFQARYMDGMVTNDFILKADHIQTLNPILVVILIPIFEMSIYPILDKINFKV-PYRISVGQYFTAISCFFMVLNQYFINQSLMNGLNP--SETGVKVLNSNSFPIVLIDDKYNNQTIPPQGVKKTIISSFGST--------ATIAVNQSRFNISVFNNS-GNFVMAA--VYFNNSIFTSVTSRILSQDDGGYSKVRLLNINGLSKDEEIFLNGKFGINKNFHLIKNGSQFGDYVKCEIGTFELVVKSKN-SVKKIMEFVLHPGQTELIYVYNENGKLQIQRMTEYKVHLPKIYWQFFPYLFVTIGEVFFNVNTGIFLYSEAPASMKSVLLSAQYMCIALGDVIIIILSSVFESLNLLYFFVLCTVLVFISGLVTTMLGRTYLKEKE 664          
BLAST of slc15a-3 vs. Planmine SMEST
Match: SMESG000030835.1 (SMESG000030835.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.550e-19
Identity = 95/366 (25.96%), Postives = 171/366 (46.72%), Query Frame = 2
Query:  131 ILIHEVLERFSFYGMKGILAIYLNLYLGFNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTXXXXXXXXXXXXXXMTLTAIQ-------------KNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEKYFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTYIIFISGKRTYTIVPRSKSVLSKFSHCIYVSI-------RNXXXXXXXXXXXXXXXXAQPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKIVNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGK-FNILVKPTSRLVASYIVAALSFIIAGFLQIY 1165
            IL+ E+ ER +FY +      +  ++L  ++     +  +F G  Y+  +F   I+D+ LG+F T+I+ G++Y +G +L+T    Q             + +L    G+  + I +GGIKS+V  FG +Q+   N+ +   +F  +Y  +NLG+  A      ++++I+      + +GF +P     V  ++FI   R Y    R++S  +  S   YVSI       R+    K               Y    I D +K +RI+ V      F+  Y Q  S + LQA+ +N  I +++ +    +  +N ++I+ +IP+   ++YP   K F        R+     +++LS I AG L+IY
Sbjct:   19 ILVFELCERLTFYSISANFVRFCTIFLQVDNVTAMNMSLIFTGSIYIVTLFCGWISDSVLGKFKTIILSGIIYFIGVLLITAVTFQSEPRLKITLSLTLRRVLTGF-GLVFIGIATGGIKSTVGPFGAEQLDQKNENITRLFFIWYYWFVNLGSAIAFLGVTYVQQNIN------FFIGFIIPLVSISVAMVLFIIPHRFY---KRNESFKNTSSIFTYVSIFWEAFQRRSRSIYKYSQFLDYASLSNGGSYDDTVIADFRKTIRIIPVLLTFIPFYIAYSQMQSTYLLQAERLNLNI-STFVIPVASLNVVNTVVILFIIPLLAILVYPILNKCFKASPNHLKRIALGLFLSSLSVIAAGVLEIY 373          
The following BLAST results are available for this feature:
BLAST of slc15a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC15A11.504e-10630.70solute carrier family 15 member 1 [Source:HGNC Sym... [more]
SLC15A21.213e-9634.35solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A27.486e-9532.61solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A25.161e-2845.70solute carrier family 15 member 2 [Source:HGNC Sym... [more]
SLC15A42.422e-1722.39solute carrier family 15 member 4 [Source:HGNC Sym... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pept-32.827e-8131.21Peptide transporter 3 [Source:UniProtKB/Swiss-Pro... [more]
pept-14.060e-6534.48Peptide transporter family 1 [Source:UniProtKB/Sw... [more]
pept-28.758e-6033.49Peptide transporter family 2 [Source:UniProtKB/Sw... [more]
pept-28.758e-6033.49Peptide transporter family 2 [Source:UniProtKB/Sw... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG29302.478e-10433.63gene:FBgn0028491 transcript:FBtr0070608[more]
CG29307.656e-10233.81gene:FBgn0028491 transcript:FBtr0070609[more]
CG29307.656e-10233.81gene:FBgn0028491 transcript:FBtr0070610[more]
CG29307.656e-10233.81gene:FBgn0028491 transcript:FBtr0340202[more]
CG29308.107e-10233.81gene:FBgn0028491 transcript:FBtr0340201[more]
back to top
BLAST of slc15a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a22.403e-10334.16solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a1b4.118e-9229.61solute carrier family 15 member 1b [Source:ZFIN;Ac... [more]
slc15a1a3.732e-8429.25solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
slc15a1a4.044e-8029.60solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
slc15a1a1.096e-7828.88solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC15A24.733e-9333.33solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A25.588e-7230.49solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A21.389e-6935.89solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A23.853e-6839.00solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A21.738e-6637.68solute carrier family 15 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc15a17.242e-10732.75solute carrier family 15 (oligopeptide transporter... [more]
Slc15a26.216e-10333.23solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a27.346e-10131.64solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a23.106e-4044.04solute carrier family 15 (H+/peptide transporter),... [more]
Slc15a21.720e-2446.43solute carrier family 15 (H+/peptide transporter),... [more]
back to top
BLAST of slc15a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WMX5|S15A1_CANLF3.937e-11032.40Solute carrier family 15 member 1 OS=Canis lupus f... [more]
sp|P36836|S15A1_RABIT8.158e-10932.63Solute carrier family 15 member 1 OS=Oryctolagus c... [more]
sp|Q9JIP7|S15A1_MOUSE5.066e-10632.75Solute carrier family 15 member 1 OS=Mus musculus ... [more]
sp|P46059|S15A1_HUMAN7.223e-10630.70Solute carrier family 15 member 1 OS=Homo sapiens ... [more]
sp|P51574|S15A1_RAT1.107e-10232.04Solute carrier family 15 member 1 OS=Rattus norveg... [more]
back to top
BLAST of slc15a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ330.000e+0100.00Slc15a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A267FN241.966e-13036.58Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IBP37.899e-13036.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G7E92.510e-12936.50Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8IGK55.036e-12636.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a28.300e-11135.45solute carrier family 15 member 2 [Source:NCBI gen... [more]
SLC15A17.419e-7632.94solute carrier family 15 member 1 [Source:HGNC Sym... [more]
SLC15A11.704e-7533.33solute carrier family 15 member 1 [Source:HGNC Sym... [more]
slc15a1a1.154e-7428.87solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
slc15a1a5.724e-7429.51solute carrier family 15 member 1a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc15a1b3.887e-10033.94solute carrier family 15 member 1b [Source:ZFIN;Ac... [more]
ENSPMAT00000005298.13.952e-643.18pep scaffold:Pmarinus_7.0:GL477384:58393:77162:-1 ... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PTR22.243e-2323.19Integral membrane peptide transporter; mediates tr... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330757.245e-11535.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285692.069e-3439.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331762.691e-2924.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294955.274e-1539.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373721.032e-1422.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc15a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc15a22.601e-11634.17solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a27.217e-11634.17solute carrier family 15 member 2 [Source:NCBI gen... [more]
slc15a1a1.265e-9331.56solute carrier family 15 member 1 [Source:NCBI gen... [more]
slc15a1a3.157e-9330.86solute carrier family 15 member 1 [Source:NCBI gen... [more]
slc15a1a6.635e-9331.25solute carrier family 15 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc15a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042203.10.000e+099.20SMESG000042203.1[more]
SMESG000039777.11.001e-10432.84SMESG000039777.1[more]
SMESG000011953.11.410e-5726.11SMESG000011953.1[more]
SMESG000011908.15.316e-5526.79SMESG000011908.1[more]
SMESG000030835.11.550e-1925.96SMESG000030835.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013800
GenBankAKN21489.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013800 ID=SMED30013800|Name=slc15a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2145bp
ATAGACTAATCAGCATTTCTCAAAATGGTGAATTGTAAAATATTTTGAGA
AGATTCTTGAGAAAATGAAATTTTTCAGACTTTCTGGTAATTTATTTGAG
AATTTTAAATTTCCGCTTCCGTGTTGGATAATTTTAATCCATGAAGTGCT
GGAACGGTTTTCATTTTACGGTATGAAGGGAATTTTGGCAATCTATTTGA
ACTTGTATCTGGGTTTCAATGACAATCATACGACTGTTCTTTATCATCTT
TTCGTCGGCCTATCTTATTTGAGCCCGATTTTCGGAGCGATAATTGCTGA
TAATTATTTGGGTAGATTTTATACGGTAATTGTTGTTGGTTTGGTATATT
TGCTGGGTCATGTTCTAATGACTTTAACGGCCATTCAGAAAAATATTCTA
GGCCCTTTAATTGGAATGAGCATTTTGGCAATTGGATCTGGCGGCATAAA
ATCATCGGTAGCTGCATTTGGTGGCGATCAAGTTCCGACAGGAAATGACA
TGATGATTGAAAAATATTTTTCATTATTTTATACAGCAATAAATCTTGGA
GCGTTTGCGGCACAATTTGTAACGCCGATTTTACGAAAGGATATTTCATG
TGTAGATGGTCAATGCTATCCTCTTGGCTTTGGGGTTCCAGCGTTTATAT
TTCTCGTTACATATATCATATTTATTTCAGGTAAACGAACTTATACTATA
GTTCCAAGATCCAAAAGCGTTTTATCGAAATTCTCTCATTGTATTTATGT
GAGTATTAGAAATTACATTAAAGAGAAAAAGATTTCTAAATATAAAAGTA
TTCTTGAATACGCTCAACCAGAATATTCCATGAAGTTTATTGATGACTGC
AAAAAGGCTTTAAGAATCATGATTGTTTTTGCACCAATTCCAGTATTTTG
GGCTTTGTATGACCAGCAGGGTTCAAGATGGACTTTACAAGCAAAGTACA
TGAATGGAAAAATTGTAAATAGTTACAACATGAAGCCTGAACAAATTCAG
TCAATCAATGCACTTTTAATCATTGGGCTGATTCCGGTTTTTGATTTTAT
AATCTATCCGTTTTTCGGAAAATTTAATATCCTTGTTAAACCAACCAGCC
GATTGGTTGCGTCATATATTGTCGCTGCGTTGTCTTTTATCATCGCTGGC
TTTCTTCAGATATATTTAATTCGAGGTCAAAACATTGAATTTAATACAGC
TGGGTCGAAATTGTTGATAATAAATTCTATAAACGACTGCAAATTAAACC
TAACAATAGACAATCGACGAATAATGCTAGCCTCGAACGGTTCAGTGAAT
CTGGATTTGAATCCCGGATTAGTTCAAGTCTCTATGAAATGTGTGGGTTA
TCAATTACAGGTAAAGAATTTAACACTGTCCCAATACAAAATGACTGGGG
GATATATTTATAAAGATAACAATGCAAGAATTGATATAAAGTCCTATTTT
GTTAAAAGCCCTGATAGTCAAAATCATATTAGGTTTTTAAATCCAAACGA
CCCAGTGAATATCGAAATGTTGAGATTAGCAAAAGATCATAAAAACTTTA
CTATTGATAGTAACTATTCTTCTTTGGACGTAGGAGTGTATGAAATATAT
TGTAGCAGTCCAAATTACAATGAATACAAATGTGGAAATGTTGACGTAAC
ACCCGGATTAGTGGGAAGTTTAATGATGACTTCAGAAAGAAAGTTACACT
TTTGGAAGGAATTTGAACCTAATTTGATACATATGTTATGGCAAATGCCG
CAATATATTTTAATCACTTGTGCAGAAATACTTTGCTCAATCACCTCCCT
TTCGTTTGCGTACAGCGAGTCGCCAGATTCTATGAAATCGTTGATGCAGG
CTATTTATTTAATAACTATTTTCGGGGGAAATATAATAGTCGTTTTTGTT
GCTGGAGTTGGGAGCAAACTGACCCAAACCACAGAGTTTTTTCTTTTCGC
AACTTTGGTTTTGATAGCTGGCTGTATAAATTGGATTCTAATTAGAGGAT
TTTGGATTTCCAAAGATAATTTCGTTGAAAATCAGAACATGGATAATTAA
TATGAATTTATGATAATAAACAATTATAAGGTTTAAGTATTGTTATAAAT
TTTTTTATTTATTTTTAAAGAAAAAATAAAGAAAATAAATTATTA
back to top

protein sequence of SMED30013800-orf-1

>SMED30013800-orf-1 ID=SMED30013800-orf-1|Name=SMED30013800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=662bp
MKFFRLSGNLFENFKFPLPCWIILIHEVLERFSFYGMKGILAIYLNLYLG
FNDNHTTVLYHLFVGLSYLSPIFGAIIADNYLGRFYTVIVVGLVYLLGHV
LMTLTAIQKNILGPLIGMSILAIGSGGIKSSVAAFGGDQVPTGNDMMIEK
YFSLFYTAINLGAFAAQFVTPILRKDISCVDGQCYPLGFGVPAFIFLVTY
IIFISGKRTYTIVPRSKSVLSKFSHCIYVSIRNYIKEKKISKYKSILEYA
QPEYSMKFIDDCKKALRIMIVFAPIPVFWALYDQQGSRWTLQAKYMNGKI
VNSYNMKPEQIQSINALLIIGLIPVFDFIIYPFFGKFNILVKPTSRLVAS
YIVAALSFIIAGFLQIYLIRGQNIEFNTAGSKLLIINSINDCKLNLTIDN
RRIMLASNGSVNLDLNPGLVQVSMKCVGYQLQVKNLTLSQYKMTGGYIYK
DNNARIDIKSYFVKSPDSQNHIRFLNPNDPVNIEMLRLAKDHKNFTIDSN
YSSLDVGVYEIYCSSPNYNEYKCGNVDVTPGLVGSLMMTSERKLHFWKEF
EPNLIHMLWQMPQYILITCAEILCSITSLSFAYSESPDSMKSLMQAIYLI
TIFGGNIIVVFVAGVGSKLTQTTEFFLFATLVLIAGCINWILIRGFWISK
DNFVENQNMDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0035673oligopeptide transmembrane transporter activity
GO:0005215transporter activity
GO:0015198oligopeptide transporter activity
GO:0015252hydrogen ion channel activity
GO:0015293symporter activity
GO:0042936dipeptide transporter activity
Vocabulary: biological process
TermDefinition
GO:0035672oligopeptide transmembrane transport
GO:0006810transport
GO:0006857oligopeptide transport
GO:0015031protein transport
GO:0015833peptide transport
GO:0015992proton transport
GO:0042938dipeptide transport
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000087proximal tubule
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR000109POT_fam
IPR018456PTR2_symporter_CS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 15..386
e-value: 1.7E-94
score: 318.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 532..656
e-value: 5.8E-24
score: 86.4
NoneNo IPR availablePANTHERPTHR11654:SF96PEPTIDE TRANSPORTER FAMILY 1coord: 23..642
NoneNo IPR availableCDDcd17347MFS_SLC15A1_2_likecoord: 21..638
e-value: 6.32595E-134
score: 398.144
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 32..51
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 265..282
NoneNo IPR availableTMHMMTMhelixcoord: 596..615
NoneNo IPR availableTMHMMTMhelixcoord: 625..647
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 564..583
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 184..206
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
IPR000109Proton-dependent oligopeptide transporter familyPFAMPF00854PTR2coord: 541..620
e-value: 5.8E-11
score: 41.8
coord: 85..371
e-value: 3.4E-68
score: 230.3
IPR000109Proton-dependent oligopeptide transporter familyPANTHERPTHR11654OLIGOPEPTIDE TRANSPORTER-RELATEDcoord: 23..642
IPR018456PTR2 family proton/oligopeptide symporter, conserved sitePROSITEPS01022PTR2_1coord: 74..98
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 19..365
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 556..644