Dual specificity phosphatase 10

Overview
NameDual specificity phosphatase 10
Smed IDSMED30013798
Length (bp)1124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity phosphatase 10 (SMED30013798) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity phosphatase 10 (SMED30013798) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity phosphatase 10 (SMED30013798) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity phosphatase 10 (SMED30013798) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013798

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013798 PL06017B2C09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013798 Contig43670newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013798 Contig43670uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30013798 dd_Smed_v4_653_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Match: DUSP6 (dual specificity phosphatase 6 [Source:HGNC Symbol;Acc:HGNC:3072])

HSP 1 Score: 127.487 bits (319), Expect = 6.935e-34
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:   84 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 226          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Match: DUSP6 (dual specificity phosphatase 6 [Source:HGNC Symbol;Acc:HGNC:3072])

HSP 1 Score: 127.102 bits (318), Expect = 1.407e-32
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Match: DUSP10 (dual specificity phosphatase 10 [Source:HGNC Symbol;Acc:HGNC:3065])

HSP 1 Score: 124.02 bits (310), Expect = 6.646e-31
Identity = 99/304 (32.57%), Postives = 166/304 (54.61%), Query Frame = 1
Query:  142 HLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNLKTQFNTTENL----PDKIVMYNQSDSIYNNVLLQ-----FIDKLDRKF-DARFLEGGFEKFSE---------LAPKQFFERSQNKIICS-------PTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLD 957
            HL S   V I D R    Y K+HI  + H+NC+  +        K+++++L +     ++       +I++Y+++ +  + V+        ++ L R+  +   L+GG   F +         L  ++  E        S       PT  D+  E+  LT I    P LFLGNE D+++LD ++ + I +++ VT++  L+  +  LF YKR+ A+DS+ QNL QYF+E+++FIE+A +    +L+HC AGVSRS TI +A+L+K  R+ + +A + VK KR I SPNLNF+GQL  + + L+
Sbjct:  166 HLPSQGPV-IIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGASAASSLLPQPIPTTPDI--ENAELTPI---LPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLN 463          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Match: DUSP2 (dual specificity phosphatase 2 [Source:HGNC Symbol;Acc:HGNC:3068])

HSP 1 Score: 118.627 bits (296), Expect = 4.953e-30
Identity = 67/183 (36.61%), Postives = 100/183 (54.64%), Query Frame = 1
Query:  403 FLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKI------SEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            FL GGF+ F    P    E     +   P   D  S       +       EI P LFLG+ + S +L  L++ GIT +L V+++   HF+ L  F YK I   D+    +  +F E+  FI+  K + G+VLVHC AG+SRS TI +A+L++  R+++ EA + VK +R + SPN +F+GQL
Sbjct:  127 FLRGGFDGFQGCCPDLCSEAPAPAL---PPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSCSHSSDLQGLQACGITAVLNVSASCPNHFEGL--FRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHCQAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQL 304          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Match: DUSP7 (dual specificity phosphatase 7 [Source:HGNC Symbol;Acc:HGNC:3073])

HSP 1 Score: 120.168 bits (300), Expect = 8.055e-30
Identity = 64/143 (44.76%), Postives = 92/143 (64.34%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            +I P L+LG   DS NLD+L   GI +IL VT N    F+    F YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L ++S
Sbjct:  247 QILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSS 389          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 120.939 bits (302), Expect = 1.031e-30
Identity = 59/139 (42.45%), Postives = 89/139 (64.03%), Query Frame = 1
Query:  553 LFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            L+LGN   ++N D+LK   I+H++ VTSN    F++     Y RI A D++S NL ++F E+  FI+ A+RN+   LVHC+AG+SRSVTI +A+L+K     +  A E V+ +    +PN +F+GQL  Y + L +NSN
Sbjct:  192 LYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEKMLGLNSN 330          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 120.168 bits (300), Expect = 1.497e-30
Identity = 59/139 (42.45%), Postives = 89/139 (64.03%), Query Frame = 1
Query:  553 LFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            L+LGN   ++N D+LK   I+H++ VTSN    F++     Y RI A D++S NL ++F E+  FI+ A+RN+   LVHC+AG+SRSVTI +A+L+K     +  A E V+ +    +PN +F+GQL  Y + L +NSN
Sbjct:  192 LYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEKMLGLNSN 330          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 99.7525 bits (247), Expect = 1.191e-22
Identity = 65/207 (31.40%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  355 VLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQN-----KIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHI--LCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFL 954
            VL + ++  D+      LEGGF++F++  P Q  E S+      + +  P       + I L     I P ++LG++ DS +  +L ++ I+ +  L +T    +  K+   F   RI  +DS  + L  YF  +Y+F+EK +R   K L+HC+AG+SRS T+A++++++  ++   +A   VK +R   SPN NF+GQL  Y   L
Sbjct:  122 VLRERLEDTDKFRSVMVLEGGFKQFAQQYP-QLCESSEGMTRLPQSLSQPCLSQPTGDGITL-----ITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNF--MRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVL 320          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 99.7525 bits (247), Expect = 1.191e-22
Identity = 65/207 (31.40%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  355 VLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQN-----KIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHI--LCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFL 954
            VL + ++  D+      LEGGF++F++  P Q  E S+      + +  P       + I L     I P ++LG++ DS +  +L ++ I+ +  L +T    +  K+   F   RI  +DS  + L  YF  +Y+F+EK +R   K L+HC+AG+SRS T+A++++++  ++   +A   VK +R   SPN NF+GQL  Y   L
Sbjct:  122 VLRERLEDTDKFRSVMVLEGGFKQFAQQYP-QLCESSEGMTRLPQSLSQPCLSQPTGDGITL-----ITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNF--MRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVL 320          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 99.7525 bits (247), Expect = 1.204e-22
Identity = 65/207 (31.40%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  355 VLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQN-----KIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHI--LCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFL 954
            VL + ++  D+      LEGGF++F++  P Q  E S+      + +  P       + I L     I P ++LG++ DS +  +L ++ I+ +  L +T    +  K+   F   RI  +DS  + L  YF  +Y+F+EK +R   K L+HC+AG+SRS T+A++++++  ++   +A   VK +R   SPN NF+GQL  Y   L
Sbjct:   47 VLRERLEDTDKFRSVMVLEGGFKQFAQQYP-QLCESSEGMTRLPQSLSQPCLSQPTGDGITL-----ITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNF--MRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVL 245          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0339722)

HSP 1 Score: 115.931 bits (289), Expect = 5.847e-29
Identity = 62/142 (43.66%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  514 DIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVT--SNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            DI     S + P L LGN  D+++     S+G   +L VT  S  + H + L   +Y +I ASD+  QN+ QYF E+Y FIE A++   +VL+HC AG+SRS TIA+A++++   + +LEA ++VK  R I SPNLNF+GQL
Sbjct:   21 DIETHPASPVFPHLLLGNGRDADDP---SSVGANCVLNVTCQSPNESHLQGL---KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQL 156          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Match: puc (gene:FBgn0243512 transcript:FBtr0081792)

HSP 1 Score: 115.931 bits (289), Expect = 2.783e-28
Identity = 58/140 (41.43%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  514 DIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            DI     S + P L LGN  D+++   + +  + ++ C + N   H + L   +Y +I ASD+  QN+ QYF E+Y FIE A++   +VL+HC AG+SRS TIA+A++++   + +LEA ++VK  R I SPNLNF+GQL
Sbjct:  128 DIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQSPNES-HLQGL---KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQL 263          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0301613)

HSP 1 Score: 108.227 bits (269), Expect = 3.719e-25
Identity = 56/139 (40.29%), Postives = 83/139 (59.71%), Query Frame = 1
Query:  553 LFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            ++LG+E ++ NL+ L+  G+ HIL VT      F     FEY  +   D    NLL+Y+D+++++I +AK    KVLVHC  GVSRS ++ +A+ +K Y+ +  +ALE VK +R    PN NFL QL+ Y   LD   N
Sbjct:  391 VYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGT--FEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKN 527          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0301612)

HSP 1 Score: 107.842 bits (268), Expect = 3.862e-25
Identity = 56/139 (40.29%), Postives = 83/139 (59.71%), Query Frame = 1
Query:  553 LFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            ++LG+E ++ NL+ L+  G+ HIL VT      F     FEY  +   D    NLL+Y+D+++++I +AK    KVLVHC  GVSRS ++ +A+ +K Y+ +  +ALE VK +R    PN NFL QL+ Y   LD   N
Sbjct:  392 VYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGT--FEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKN 528          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Match: ssh (gene:FBgn0029157 transcript:FBtr0084799)

HSP 1 Score: 107.071 bits (266), Expect = 7.374e-25
Identity = 60/148 (40.54%), Postives = 87/148 (58.78%), Query Frame = 1
Query:  526 TKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            TKI E    ++LG+E ++ NL+ L+  G+ HIL VT      F     FEY  +   D    NLL+Y+D+++++I +AK    KVLVHC  GVSRS ++ +A+ +K Y+ +  +ALE VK +R    PN NFL QL+ Y   LD   N
Sbjct:  385 TKIFE---HVYLGSEWNASNLEELQKNGVRHILNVTREIDNFFPGT--FEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVHCKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETYSGMLDAMKN 527          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 127.102 bits (318), Expect = 1.071e-32
Identity = 98/315 (31.11%), Postives = 158/315 (50.16%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL--KTQFNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQFFER-SQNKIICSPTNQ-----------------------DVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R++E Y  +H+  + +V   + ++ ++   NL  K+  +  E+          D IV+Y++    +N      +VL   + ++ D  + A +LEGGF KF    P         +    SPT+Q                          + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L + S
Sbjct:   36 VMDCRAQELYESSHVETAINVAIPSLMLRRLKKGNLPIKSLLSNGEDRERFARRCKTDTIVLYDEYSREWNENIDGGSVLGLLLRRMKDEGYKAFYLEGGFSKFQTDFPAMCETNLDGSSSSSSPTSQVLGLGGLRISSDSSDIESDIDRDPSSATDSDGSPLSNPQPSFPVEILPHLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNMFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGLKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLKS 350          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Match: dusp6 (dual specificity phosphatase 6 [Source:ZFIN;Acc:ZDB-GENE-030613-1])

HSP 1 Score: 127.102 bits (318), Expect = 1.071e-32
Identity = 98/315 (31.11%), Postives = 158/315 (50.16%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL--KTQFNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQFFER-SQNKIICSPTNQ-----------------------DVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R++E Y  +H+  + +V   + ++ ++   NL  K+  +  E+          D IV+Y++    +N      +VL   + ++ D  + A +LEGGF KF    P         +    SPT+Q                          + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L + S
Sbjct:   36 VMDCRAQELYESSHVETAINVAIPSLMLRRLKKGNLPIKSLLSNGEDRERFARRCKTDTIVLYDEYSREWNENIDGGSVLGLLLRRMKDEGYKAFYLEGGFSKFQTDFPAMCETNLDGSSSSSSPTSQVLGLGGLRISSDSSDIESDIDRDPSSATDSDGSPLSNPQPSFPVEILPHLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNMFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGLKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLKS 350          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Match: si:dkey-175m17.7 (si:dkey-175m17.7 [Source:ZFIN;Acc:ZDB-GENE-091204-18])

HSP 1 Score: 120.168 bits (300), Expect = 3.060e-32
Identity = 71/155 (45.81%), Postives = 104/155 (67.10%), Query Frame = 1
Query:  505 VSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            ++ D+    IS I P LFLGNE D+++LDLL  + I  ++ VT++  L+  D  L  YKR+ A+D+S QNL QYF+E ++FIE+A +    VLVHC AGVSRS TI +A+L+K   + + +A + V+ +R I SPNLNF+GQL  + +  D+NS 
Sbjct:    1 MTPDVENAVISPILPFLFLGNERDAQDLDLLLHLNIGFVVNVTTHLPLYHLDTGLVRYKRLPATDNSKQNLRQYFEEVFEFIEEAHQCGRGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRGRRPIVSPNLNFMGQLLEFER--DLNSG 153          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 118.242 bits (295), Expect = 1.037e-29
Identity = 63/143 (44.06%), Postives = 92/143 (64.34%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            +I P L+LG   DS NLD+L    I +IL VT N    F+    F+YK+I  SD  SQNL Q+F E+  FI++A+     +LVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L +NS
Sbjct:  192 QILPYLYLGCAKDSTNLDVLGKYNIKYILNVTPNLPNMFEHDGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSQKCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLNS 334          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 118.627 bits (296), Expect = 1.056e-29
Identity = 63/143 (44.06%), Postives = 92/143 (64.34%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            +I P L+LG   DS NLD+L    I +IL VT N    F+    F+YK+I  SD  SQNL Q+F E+  FI++A+     +LVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L +NS
Sbjct:  202 QILPYLYLGCAKDSTNLDVLGKYNIKYILNVTPNLPNMFEHDGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSQKCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLNS 344          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Match: npc1l1 (NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011])

HSP 1 Score: 133.65 bits (335), Expect = 2.010e-34
Identity = 63/143 (44.06%), Postives = 103/143 (72.03%), Query Frame = 1
Query:  505 VSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
             + DI   +++ I P L+LGNE D+++L+ +++  I++I+ VT++  L+  +  +F YKR+ A+DS+ QNL QYF+E+++FI++A +    +L+HC AGVSRS TI +A+L+K  R+ + +A + VK KR I SPNLNF+GQL
Sbjct:  295 TTPDIENAELTPILPFLYLGNEHDAQDLETMQTRNISYIVNVTTHLPLYHYEKGVFNYKRLPATDSNKQNLRQYFEEAFEFIDEAHQCGKALLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 437          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Match: usp48 (ubiquitin specific peptidase 48 [Source:Xenbase;Acc:XB-GENE-5938602])

HSP 1 Score: 130.568 bits (327), Expect = 5.988e-34
Identity = 99/316 (31.33%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL--KTQFNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVV-------------------------SEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R+ E Y  +HI  + +V     ++ ++   NL  ++ F   E+          D +V+Y++S   +N      +VL   + +L D    A +LEGGF KF    P        +   C  ++  V+                         + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F YK+I  SD  SQNL Q+F E+  FI++A+  +  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L +NS
Sbjct:   35 LMDCRAHELYESSHIEAAINVAIPGIMLRRLKKGNLPIRSLFACGEDREKFARRCGTDTVVLYDESSCDWNENTGGESVLGLLMKRLKDEGCRAYYLEGGFNKFQAEYPIHCETNLDSS--CGSSSPPVLGLGGLRISSDSSSDIESDIDRDPNSATDSDGSPLSNTQPSFPVEILPYLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFRYKQIPISDHWSQNLSQFFPEAISFIDEARGKSCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLNS 348          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Match: lrit2 (leucine-rich repeat, Ig-like and transmembrane domains 2 [Source:Xenbase;Acc:XB-GENE-923281])

HSP 1 Score: 130.568 bits (327), Expect = 6.263e-34
Identity = 95/323 (29.41%), Postives = 158/323 (48.92%), Query Frame = 1
Query:  160 NVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLP---DKIVMYNQSDSIYNN-----------VLLQFIDKLDRK-FDARFLEGGFEKFSELAPKQFFERSQNKIICS--PTNQDVVSEDIM-LTKIS------------------------------------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            N+ I D R+RE Y  +H+ K+ HV     ++ ++   NL        + P      ++Y++  S   +           +L+  + KL ++   A +L+GGF KF      +F    +  + C+   +N  + +  ++ L  +S                                    +I P L+LG+  DS N+D L  +GI +IL VT N    F+    F YK+I  SD  SQNL Q+F E+ +FI++A  +N  VLVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L ++S
Sbjct:   21 NLRILDCRARELYDSSHVEKALHVALPGLMLRRLRKGNLSAHSLLPGSPPTVRGVALLYDECTSSLESLEANHGDEQEPILVMLLHKLRKEGCQAYYLQGGFSKFQ----AEFPHHCETNLDCTNCASNSPLPTTPVLGLGGLSITSDCSDFESDLDREPLSGVDSEGMSPRNQAPSFPVQILPHLYLGSARDSGNIDTLAKLGIRYILNVTPNLPNIFEKDGEFHYKQIPISDHWSQNLSQFFPEAIEFIDEAASHNCGVLVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKTNISPNFNFMGQLLDFEKSLGLSS 339          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Match: ibtk (inhibitor of Bruton tyrosine kinase [Source:Xenbase;Acc:XB-GENE-5755983])

HSP 1 Score: 124.79 bits (312), Expect = 6.418e-32
Identity = 72/190 (37.89%), Postives = 107/190 (56.32%), Query Frame = 1
Query:  403 FLEGGFEKFSELAPKQFFERSQNKIICS---PTNQDVVSEDIMLTKIS----------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            FL+GG+E FS   P +F  +S   +  S    TN    S D   T             EI P L+LG+   +   D+L ++GIT ++ V++N   HF+    F+YK I   DS   ++  +F+E+  FI+  K + G+V VHC AG+SRS TI +A+L++  R+K+ EA E VK +R I SPN +F+GQL
Sbjct:  121 FLKGGYETFSSQCP-EFCNKSSPPVCLSLPLSTNNVPGSADSNCTPCGTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEGH--FQYKSIPVEDSHKADISSWFNEAIDFIDSVKNSGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQL 307          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Match: eci1 (enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB-GENE-999272])

HSP 1 Score: 123.25 bits (308), Expect = 2.277e-31
Identity = 97/317 (30.60%), Postives = 155/317 (48.90%), Query Frame = 1
Query:  160 NVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL-----------KTQFNTTENLPDKIVMYN------QSDSIYNNVLLQFIDKL-DRKFDARFLEGGFEKF-----------------SELAPKQFFERSQNKI--ICS-------PTNQDVVSEDIMLTKIS----EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            +V + D R  + Y  +HI  +  +     ++ ++   NL           K +F    N  D +++Y+      Q +    +VL   ++KL +    A +L+GG+ KF                 +E AP++       +I   CS       P++         LT  S    +I P L+LG   DS NLD+L    I +IL VT N    F+    F+YK+I  SD  SQNL Q+F E+  FI++A+  N  +LVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L + S
Sbjct:   22 SVLLLDCRPHDRYQSSHIEAAISLTIPGLMLRRLRKGNLSIRSIIPNDRDKERFAGRCNA-DTVLLYDEATQDWQENGSPGSVLPLLLNKLREEGCRAYYLKGGYTKFQREYPEHCETGLDNVCPNEPAPEKVLGLGSLRINSECSDGESDREPSSATESEGSPTLTSQSTFPVQILPYLYLGCAKDSANLDILAKYNIKYILNVTPNLPNMFEHNGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKNCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLKS 337          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Match: Dusp6 (dual specificity phosphatase 6 [Source:MGI Symbol;Acc:MGI:1914853])

HSP 1 Score: 127.102 bits (318), Expect = 9.565e-33
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Match: Dusp10 (dual specificity phosphatase 10 [Source:MGI Symbol;Acc:MGI:1927070])

HSP 1 Score: 124.02 bits (310), Expect = 5.961e-31
Identity = 97/291 (33.33%), Postives = 160/291 (54.98%), Query Frame = 1
Query:  142 HLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNLKTQFNTTENL----PDKIVMY----NQSDSIYNNVLLQFI-DKLDRKF-DARFLEGGFEKFSE---------LAPKQFFERSQNKIICSPT-NQDV-VSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            HL S   V I D R    Y K+HI  + H+NC+  +        K+++++L +     ++       +I++Y    N+   +  +  L  + + L R+  +   L+GG   F +         L  ++  E        S    Q V  + DI   +++ I P LFLGNE D+++LD ++ + I +++ VT++  L+  +  LF YKR+ A+DS+ QNL QYF+E+++FIE+A +    +L+HC AGVSRS TI +A+L+K  R+ + +A + VK KR I SPNLNF+GQL
Sbjct:  167 HLPSQGPV-IIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTNEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLCDNSLQLQECREVGGGASAASSMLPQSVPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQL 456          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Match: Dusp16 (dual specificity phosphatase 16 [Source:MGI Symbol;Acc:MGI:1917936])

HSP 1 Score: 124.405 bits (311), Expect = 1.186e-30
Identity = 88/274 (32.12%), Postives = 141/274 (51.46%), Query Frame = 1
Query:  163 VWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMS--------IMNLKTQFNTTENLPDKIVMYNQS----DSIYNNVLLQ-FIDKLDRKFDA-RFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            V + D R    Y  +HI ++ ++NCS  +  ++         ++    +     +   K+V+Y+QS     S+ ++  L   + KL+R F++   L GGF +FS   P       + K    PT        +     + I P L+LG + D  N DL++  GI ++L   SNT      +    + R+  +DS  + +L + D+S  FIEKAK +NG VL+HC+AG+SRS TIA+A+++K+  + + EA   VK KR   SPN NF+GQL  Y
Sbjct:   26 VLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQDKVLITELIQHSAKHKVDIDCNQKVVVYDQSSQDVGSLSSDCFLTVLLGKLERSFNSVHLLAGGFAEFSRCFPG----LCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKDLMQQNGIGYVL-NASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCVLIHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFMGQLMDY 294          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Match: Dusp7 (dual specificity phosphatase 7 [Source:MGI Symbol;Acc:MGI:2387100])

HSP 1 Score: 120.553 bits (301), Expect = 5.053e-30
Identity = 64/143 (44.76%), Postives = 92/143 (64.34%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            +I P L+LG   DS NLD+L   GI +IL VT N    F+    F YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L ++S
Sbjct:  250 QILPYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSS 392          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Match: Dusp2 (dual specificity phosphatase 2 [Source:MGI Symbol;Acc:MGI:101911])

HSP 1 Score: 118.242 bits (295), Expect = 5.528e-30
Identity = 66/182 (36.26%), Postives = 101/182 (55.49%), Query Frame = 1
Query:  403 FLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLT-----KISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            FL GGF+ F    P    E     +   P   +  + D  +         EI P L+LG+   S +L  L++ GIT +L V+++   HF+ L  F YK I   D+    +  +F E+  FI+  K + G+VLVHC AG+SRS TI +A+LI+ +R+++ EA + VK +R + SPN +F+GQL
Sbjct:  131 FLRGGFKSFQTYCPDLCSEAPAQAL--PPAGAENSNSDPRVPIYDQGGPVEILPYLYLGSCNHSSDLQGLQACGITAVLNVSASCPNHFEGL--FHYKSIPVEDNQMVEISAWFQEAISFIDSVKNSGGRVLVHCQAGISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISPNFSFMGQL 308          
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9DBB1|DUS6_MOUSE (Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 6.691e-32
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q16828|DUS6_HUMAN (Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 6.759e-32
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q64346|DUS6_RAT (Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 7.258e-32
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q2KJ36|DUS6_BOVIN (Dual specificity protein phosphatase 6 OS=Bos taurus OX=9913 GN=DUSP6 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 7.332e-32
Identity = 66/143 (46.15%), Postives = 97/143 (67.83%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+  N  VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L ++S
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSS 351          
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Match: sp|Q9ZR37|DUS1_ARATH (Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=DSPTP1 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.338e-31
Identity = 65/133 (48.87%), Postives = 86/133 (64.66%), Query Frame = 1
Query:  535 SEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            S IE GL+LG+ A + N ++LKS  +THIL V S+  L     D F YK +   D    NL  YFDE   FI++AKR  G VLVHC  G SRSVTI +A+L+KK+ + + +AL+ VK+KR +ASPN  F+ QL
Sbjct:   52 SLIEQGLYLGSVAAASNKNVLKSYNVTHILTVASS--LRPAHPDDFVYKVVRVVDKEDTNLEMYFDECVDFIDEAKRQGGSVLVHCFVGKSRSVTIVVAYLMKKHGMTLAQALQHVKSKRPVASPNAGFIRQL 182          
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Match: A0A183AFG3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5698 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.721e-41
Identity = 79/148 (53.38%), Postives = 103/148 (69.59%), Query Frame = 1
Query:  511 EDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLI---KKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYY 945
            ED+M   IS+I P L+LGN  D++NLDLL+ +GITHI+ VT    + FK    F Y  + ASD+ +Q+L   FD + QFI++A++ NG VLVHC AGVSRSV I MA+LI   KKY   VL ALE V+ +R +A PNL+F+GQL RYY
Sbjct:   92 EDVMSASISKILPYLYLGNARDAQNLDLLRRVGITHIINVTETVPMPFKRPVPFTYLHLPASDTINQDLRPAFDRAVQFIDEARKRNGIVLVHCQAGVSRSVAIVMAYLIHSAKKY--TVLNALEFVQNQRPVAGPNLHFMGQLQRYY 237          
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Match: G4VQ48 (Putative dual specificity protein phosphatase OS=Schistosoma mansoni OX=6183 GN=Smp_135160 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.164e-40
Identity = 102/300 (34.00%), Postives = 154/300 (51.33%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLP------------------DKIVMYNQSDSIYN---------NVLLQFIDKL-DRKFDARFLEGGFEK------FSELAPKQFFERSQNKIICSPTNQDVV---SEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYR-IKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFL 954
            I D+R    Y   HI  ++  NC T  MAK +I +    +  T   P                    IV+Y+Q  +               L FI  L DR      ++  FE        S L      E    +I  +P   + +   ++D++   IS+I P L+LGN  DS+++DL++ + +THI+ VT    + F+ L+  +Y  I A+D++ QNLL  FD + QFIEKA+++NG VLVHC+AGVSRSV + +A+L+   R + V +ALE V+ +R +A PNL+F+GQL  YY  L
Sbjct:   53 IVDMRETRLYQSGHILTARSANCYTKTMAKRAIQSWDIWYTETHGCPAPYMESPVSFISQISLVKPAIVVYDQRSNFAAISTLKDKKVRAELHFISALLDRGNRVYMIDDNFESNDTEKLISCLKDCSRDETLVVRIKQTPLRVNEIQQNNDDVLSASISQILPFLYLGNARDSQDVDLIRQLNVTHIINVTDTLPMPFRKLNRIQYLHIPATDTTKQNLLPSFDRAVQFIEKARKHNGIVLVHCLAGVSRSVAVVIAYLLYNNRGLNVYKALEFVQARRSVAGPNLHFMGQLQAYYHDL 352          
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Match: K1QUW9 (Dual specificity protein phosphatase 10 OS=Crassostrea gigas OX=29159 GN=CGI_10020490 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 3.942e-40
Identity = 108/299 (36.12%), Postives = 160/299 (53.51%), Query Frame = 1
Query:  127 QELIKHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNL------KTQFNTTENLPDKIVMYN------QSDSIYNNVLLQFIDKLDRKFDARFLEGGFEKFS----ELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLD 957
            QEL   +     V + D R   SY   HI  + +VNCS           K SI++L      K  F    +   +IV+Y+      QS S  +++ L     L    DA  L+GG E+F     +L      +  + + + SPT   ++   I     S+I P L+LGNE D+ NL  L+ + IT++L  TS+   +F++  +  YKRI ASDS  QNL QYF+E+  FI++A++N   +LVHC AGVSRS TI +A+L+K  ++ +++   +VK KR I SPN NF+GQL  Y Q L+
Sbjct:   82 QELASRMNKSRTVLVLDCRPFVSYNIAHIQGAVNVNCSDRFNRRRLQQGKASIVDLVASKEGKDMFKKRSS--KEIVIYDDHTKDVQSLSSESSMYLVLSSLLREGKDAYILKGGIEEFRNKHLDLC-DSSIKSQEARPLYSPTTP-IIEPQIETATASQILPFLYLGNERDAANLQRLQDLNITYVLNTTSHIPKYFENQGI-HYKRIPASDSGCQNLKQYFEEAAAFIDEARQNGANILVHCHAGVSRSATITIAYLLKHTKLSMMDIYRLVKGKRSIISPNFNFMGQLMEYEQALN 375          
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Match: R7V119 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_3954 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 5.911e-40
Identity = 110/300 (36.67%), Postives = 160/300 (53.33%), Query Frame = 1
Query:  127 QELIKHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMN-------------LKTQFNTTENLPDKI-VMYNQ-----SDSIYNNVLLQFIDKLDR-KFDARFLEGGFEKF----SELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFL 954
            ++L   L    NV + D RS  ++  NHI  + +V+C+  L  K    N              K +F    + P  + V+Y+      S S  N+ L   I  L R   +A FL+GG   F    S +  K   + + N  + SPT   + SE I    +SEI P L+LGNE D+ N D L  +GITHIL VTS+  L F+      Y R+ ASDS+ QNL+QYF  ++ FI+ A++ NGKV++HC AGVSRS T+ +A+++ +  + +  A   VK+KR I +PN NF+GQL  + Q L
Sbjct:  101 RDLAAKLVDPENVLLIDCRSFIAFNLNHINGALNVSCTDRLTKKRLQCNKVKAGDIVGPGQDAKDEFAEKRSSPSMVFVLYDDDTEDLSKSPINSPLQLVIHSLHRDGVEAVFLKGGISAFQSRYSHMCAKPQLKHA-NVPLFSPTTPLIHSE-IDTATVSEILPFLYLGNERDAANRDRLAELGITHILNVTSHLPLFFEGEADLSYCRLSASDSAHQNLMQYFQRAFDFIDCARKQNGKVMIHCQAGVSRSSTLVIAYIMMRSSLSMSSAFRFVKSKRSIIAPNFNFMGQLMDFEQQL 398          
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Match: F8WLE5 (Mitogen-activated protein kinase phosphatase OS=Dugesia japonica OX=6161 GN=DjmkpA PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 7.140e-40
Identity = 101/277 (36.46%), Postives = 160/277 (57.76%), Query Frame = 1
Query:  139 KHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYN-------QSDSIYNNVLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVS-EDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKK-YRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            K + + C++ I DLRS  ++ K HI  ++  NCS+ + ++ +I  +     T+ +L   IV+Y        Q D +   +L+QF+  L R  +  +L   F+KF E A  Q  E   + ++C    + V    DI  TK S + P L+LGNE D+ N   L +  ITH+L VT   K  F D   F+ KRI  +D++ Q+L+Q+F ++++FIE A+++NGK+LVHC AG+SRS TI +A+L+     + +  A + VK +R I SPN NF+GQL ++
Sbjct:   88 KLIATDCSLIILDLRSAYNFSKMHITTARLANCSSKMKSRRAIQIVIEILKTSLDL-HHIVLYTEFGLPFKQDDPL--TILIQFL--LGRSINCLYLTDSFKKF-ETAYPQLCESGSSNVLCQHIPKSVPDFTDIYFTKASLVLPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCTDNNVQDLIQFFPDAFKFIELARQSNGKILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQF 356          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:103030496])

HSP 1 Score: 127.872 bits (320), Expect = 3.773e-33
Identity = 100/316 (31.65%), Postives = 159/316 (50.32%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL--KTQFNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQFFERSQNKIICS--PTNQ-----------------------DVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R+RE Y  +H+  + +V   + ++ ++   NL  K+  ++ E+          D +V+Y++    +N      +VL   + ++ D    A +LEGGF KF    P    E + +    S  PT Q                          + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L I S
Sbjct:   36 VMDCRARELYDSSHVDTAINVAIPSLMLRRLKKGNLPVKSLLSSGEDRERFARRCKTDTVVLYDEYSRDWNENVDGGSVLGLLLRRMKDEGCRAFYLEGGFSKFQAEYPA-LCETNLDGSSSSSSPTAQVLGLGGLRISSDSSDIESDIDRDPSSATDSDGSPLSNPQPSFPVEILPHLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGIQS 350          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:103030496])

HSP 1 Score: 128.257 bits (321), Expect = 5.851e-33
Identity = 100/316 (31.65%), Postives = 159/316 (50.32%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNL--KTQFNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQFFERSQNKIICS--PTNQ-----------------------DVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R+RE Y  +H+  + +V   + ++ ++   NL  K+  ++ E+          D +V+Y++    +N      +VL   + ++ D    A +LEGGF KF    P    E + +    S  PT Q                          + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L I S
Sbjct:   76 VMDCRARELYDSSHVDTAINVAIPSLMLRRLKKGNLPVKSLLSSGEDRERFARRCKTDTVVLYDEYSRDWNENVDGGSVLGLLLRRMKDEGCRAFYLEGGFSKFQAEYPA-LCETNLDGSSSSSSPTAQVLGLGGLRISSDSSDIESDIDRDPSSATDSDGSPLSNPQPSFPVEILPHLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGIQS 390          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Match: taf1a (TATA-box binding protein associated factor, RNA polymerase I subunit A [Source:NCBI gene;Acc:103041075])

HSP 1 Score: 126.716 bits (317), Expect = 3.954e-32
Identity = 95/281 (33.81%), Postives = 157/281 (55.87%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNLKTQFNTTENL----PDKIVMYNQSDSIYNNVLLQ-----FIDKLDRKF-DARFLEGGFEKF----SELAPKQF-FERSQNK-----IICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            I D R    + K+HI  + H+NCS  +        K+++++L +   + ++       +IV+Y++S      + L       ++ L R+  D   L GG   F     EL       +  Q+      +  +  +    + DI   +I+ I P LFLGNE D+++ DL++ + I +IL VT++  L+   L LF+YKR+ A+DS+ QNL QYF+E+++FIE+A +    +L+HC AGVSRS TI +A+L+K   + + ++ + VKT+R I SPNLNF+GQL
Sbjct:  171 IIDCRPFTDFNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCRQSKDSFRGIFSKEIVVYDESTVDPGRLSLSQPLHVVLESLRREGKDPVVLRGGLSSFRQGHEELCEHSLHLQEGQDPGASVGLSGALPHSLPSTPDIENAEITPILPFLFLGNEQDAQDHDLMQRLNIGYILNVTTHLPLYHYSLGLFKYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDSYKFVKTRRPIISPNLNFMGQL 451          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Match: dusp4 (dual specificity phosphatase 4 [Source:NCBI gene;Acc:103029669])

HSP 1 Score: 123.25 bits (308), Expect = 1.560e-31
Identity = 82/276 (29.71%), Postives = 139/276 (50.36%), Query Frame = 1
Query:  157 CNVWIFDLRSRESYFKNHI--AKSKHVNCSTNLMAKMSIM-------NLKTQFNTTENLPDKIVMYNQSDSIYNNV-----LLQFIDKLDR---KFDARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            C + + D RS  ++   HI  A +   N      AK S+        + + +      L   +++Y++       V     L   ++ L R   + D   L+GG+++F    P    +     +  + ++    +         EI P LFLG+   +   D+L  +GI+ +L V+SN   HF+    ++YK I   D+  +++  +F E+ +FI+  K +NG+VLVHC AG+SRS TI +A+L+KK R+++ EA E VK +R I SPN +F+GQL
Sbjct:   26 CKLLLLDCRSFLAFSAGHIRGAVNARANTIVRRRAKGSVSLEQILSGDDEARSRLLAGLYSAVILYDERTQDARAVKEDSTLTLVLNALGRDTFRTDVYLLKGGYDRFCSQYPDYCLKSRTLPVPSTVSSTSCGTPHHDQGGPVEILPFLFLGSALHASKKDMLDGMGISALLNVSSNCPNHFEGA--YQYKCIPVEDNHKEDISSWFIEAIEFIDSIKDSNGRVLVHCQAGISRSATICLAYLMKKKRVRLEEAFEFVKQRRSIISPNFSFMGQL 299          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Match: si:dkey-175m17.7 (uncharacterized LOC103045335 [Source:NCBI gene;Acc:103045335])

HSP 1 Score: 125.176 bits (313), Expect = 6.419e-31
Identity = 71/159 (44.65%), Postives = 109/159 (68.55%), Query Frame = 1
Query:  493 NQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            ++ V++ D+    +S I P LFLGNE D+++LDLL  + I +++ VT++  L+  D  L  YKR+ A+D+S QNL QYF+E ++FIE+A +N   VLVHC AGVSRS TI +A+L+K   + + +A + V+ +R + SPNLNF+GQL  + +  D+NS 
Sbjct:  726 DESVMTPDVENAVVSPILPLLFLGNERDAQDLDLLLRLNIGYVVNVTTHLPLYHVDTGLVRYKRLPATDNSKQNLRQYFEEVFEFIEEAHQNGRGVLVHCQAGVSRSATIVIAYLMKHTLMTMTDAYKYVRGRRPVVSPNLNFMGQLLEFER--DLNSG 882          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 122.479 bits (306), Expect = 2.943e-32
Identity = 75/221 (33.94%), Postives = 114/221 (51.58%), Query Frame = 1
Query:  331 QSDSIYNNVLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKIS-----------------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            ++DS    V L  + +  R     FL GG+EKF     + F E   +  + SP      +   +L  +                  EI P L+LG+   +   +LL +IGIT +L V+++   HF+ L  F YK I   D+   ++  +F E+  FI+  +R  G+V VHC AGVSRS TI +A+L+K  R+++ EA E V+ +R + SPN NFLGQL  +
Sbjct:  119 RADSTLAMVALA-LGRETRGTPVYFLRGGYEKFH----RDFSELCLDAALTSPCK---TTPPALLPPVPIRLHTAGTPTYDQGGPVEILPFLYLGSAYHASRRELLDAIGITALLNVSADLPNHFEGL--FTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVISPNFNFLGQLQSF 329          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 117.472 bits (293), Expect = 1.527e-31
Identity = 68/157 (43.31%), Postives = 107/157 (68.15%), Query Frame = 1
Query:  499 DVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            D  + D+   +++ + P LFLGNE D+++L  L+ + I +I+ VTS+  L+  +     YKR+ A+DS  QNL QYF+E+++FIE+A ++   +L+HC AGVSRS TI +A+L+K  R+ + +A + VK KR I SPNLNF+GQL ++ +  D+NS 
Sbjct:   36 DASTPDVENAEMTAVLPFLFLGNEQDAQDLAQLQRLNIGYIINVTSHLPLYHYERGALRYKRLPATDSCKQNLRQYFEEAFEFIEEAYQSGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLQFEE--DLNSG 190          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp7 (dual specificity phosphatase 7 [Source:ZFIN;Acc:ZDB-GENE-030131-5457])

HSP 1 Score: 117.472 bits (293), Expect = 3.545e-31
Identity = 60/132 (45.45%), Postives = 87/132 (65.91%), Query Frame = 1
Query:  538 EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            +I P LFLG   DS N++ L   GI +IL VT N    F+ +  F+YK+I  SD  +QNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL
Sbjct:   99 QILPHLFLGCAQDSSNMEALAQHGIRYILNVTPNLPNTFERIADFKYKQIPISDHWNQNLSQFFPEAIAFIDEARNKQCGVLVHCLAGISRSVTVTVAYLMQKLSLPLNDAYDFVKHKKSNISPNFNFMGQL 230          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006071.1 (pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-1 gene:ENSPMAG00000005490.1 transcript:ENSPMAT00000006071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 1.224e-29
Identity = 62/136 (45.59%), Postives = 90/136 (66.18%), Query Frame = 1
Query:  574 DSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSS----QNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            D+++L  L+ +GI  +L VT+    H++   L  YKR+ A+DS +    QNL QYF+E+++FIE A R    +LVHC AGVSRS TI +A+L+K  R+ + +A + VK KR I SPNLNF+GQL  + +  D+NS 
Sbjct:    1 DAQDLSKLQRLGIGLVLNVTA----HYERGGL-HYKRLPANDSDNDSDKQNLRQYFEEAFEFIEDAHRRGQGLLVHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEE--DLNSG 129          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Match: dusp10 (dual specificity phosphatase 10 [Source:ZFIN;Acc:ZDB-GENE-041014-271])

HSP 1 Score: 113.235 bits (282), Expect = 7.437e-29
Identity = 77/287 (26.83%), Postives = 130/287 (45.30%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNLKTQFNTTENL--------PDK--IVMYNQSDSIYNNVLLQFIDKLDRK-FDARFLEGGFEKFSEL---------------APKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            + D R    Y ++HI  + HVNCS  L        K+ +  L +  +             P +  +V+Y+ S       L   ++ L R+  D   L GG   F  L               A   F      +      +   + E    + +S + P LF+G E  + +L  L+ + +  +L VT++   +        Y+R+ ASD+  Q+L QYF  ++  IE+A+R    VL+HC AGVSRS T+A+A++++   +   +A   V+ +R   +PNL+F+GQL
Sbjct:   43 LLDCRPFGEYTRSHIRGALHVNCSDRLSRRRLAQGKLRVTQLASATSAPAAAAAAVAAAGPPRRDMVLYDGSSGDPAAALKLVLESLRREGADPLVLRGGLSDFRALHESLCEHHGVEDVSEATSPFDAHVNGRAGALLRSSAPLDERSESSDVSRLLPYLFVGGERAARDLPTLRRLNVGLVLNVTAHVPHYHAGAGSIAYRRLPASDTHGQDLRQYFRPAFLLIEEARRCGCSVLLHCQAGVSRSPTVAIAYVMRIRGLGASDAYAFVRARRAAVAPNLSFMGQL 329          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 67.781 bits (164), Expect = 4.149e-13
Identity = 48/154 (31.17%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  529 KISEIEPGLFLGN-EADSENLDLLKSIGITHILCVTS-NTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIE-----------------KAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            +++ I  G++LG      ++  L     ITHIL V        +     +  K I   D    ++LQYFDE+ +FI+                 K K   G V  HC AG+SRSVT  +A+L+ +Y + +  A+  VK K+    PN NF+ QL
Sbjct:   11 EVTRILGGIYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQL 164          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Yeast
Match: PPS1 (Protein phosphatase; has specificity for serine, threonine, and tyrosine residues; has a role in the DNA synthesis phase of the cell cycle [Source:SGD;Acc:S000000480])

HSP 1 Score: 55.4546 bits (132), Expect = 8.260e-9
Identity = 31/96 (32.29%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  670 FEYKRIEASDSSSQN-LLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKR--CIASPNLNFLGQLDRYYQ 948
            F+  +IE  D + ++ L    D+   FI  ++   GKVLVHC+ GVSRS T+ +A  ++  +  +  A   V+ +R   I  PNL F+ +L ++++
Sbjct:  684 FQICQIENLDDNGKDPLFHQIDKVLDFISNSEATGGKVLVHCMVGVSRSATVCIAECMRYLQCDLASAYLFVRVRRLNVIIQPNLFFVYELFKWWK 779          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 46.2098 bits (108), Expect = 4.595e-6
Identity = 24/75 (32.00%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  742 QFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + I  A     K+LVHC  GVSRS ++ +A++++ Y + + +A   +K      SPN+  + QL  +   L  NS
Sbjct:  303 RIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEWGTMLSKNS 377          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Match: EDO45432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA2])

HSP 1 Score: 128.257 bits (321), Expect = 3.493e-34
Identity = 90/310 (29.03%), Postives = 157/310 (50.65%), Query Frame = 1
Query:  133 LIKHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMN------------LKTQFNTTENLPDKIVMYNQSD----SI-YNNVLLQFIDKLDRKFDA---RFLEGGFEKFSELAP---------------------KQFFERSQNKIICSPTNQDVVSEDIMLT--KISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            L + + S   V + D R    + ++HI  + ++   + ++ +M   N             K QFN   ++   +V+Y+ +     SI  N+V+   I KL  +  +   R LEGGF KF E  P                     ++  E++    I  P  Q    E+  ++  +++EI P L+LG+E D+ N++LL+   I+++L VT +    F  ++ F+YK +   D+   NL + F E++ FI++ ++ +  VLVHC+AG+SRSVTI +A+L+    + + EA + VK ++   SPN NF+GQL
Sbjct:   10 LSEQMRSGNYVLLLDCRPFAEFVRSHIQGAINLTIPSLMLRRMKKGNNFSFTSLISSEEGKEQFNKNLHMATAVVLYDSNTKDIASIGINSVMAVLIKKLADECASGTLRLLEGGFSKFEERFPSFCEPGEESGRPLLSLSGLTIREASEQAVPSRILLPNVQPSTPENRNVSNCELAEILPRLYLGSEKDASNIELLRKHKISYVLNVTHDRPNTFAHIEGFKYKNLPVEDNLMANLTELFPEAFAFIDEGRQKSSNVLVHCLAGISRSVTITIAYLMSSQHLSLNEAYDFVKARKSNVSPNFNFMGQL 319          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Match: EDO49250 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX7])

HSP 1 Score: 122.094 bits (305), Expect = 6.097e-32
Identity = 88/300 (29.33%), Postives = 146/300 (48.67%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYNQSDSIY-------------NNVLLQFIDKL----DRKFDARFLEGGFEKFSELAPKQF-FERSQNKIICSP----------------TNQDVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            + D RS  ++   HI  + +++C   L  K  ++      +   + P+  V+  ++D+I              N+  ++ + KL     RK    +++GGFE+FS L      F +  N  + SP                   D  ++D  L +          E+ P L+LG+E  +   D+LK +GI+ I+ V+ N    F+D   F YK I   D+ + ++  +F+E+  FI+  K + G+VLVHC AG+SRS TI +A+LI +   ++ EA E VK +R + SPN NF+GQL  Y
Sbjct:   11 LVDCRSFMAFNVAHIRGAVNIHCPPIL--KRRLLRGSATLSALVSCPESKVILEEADTIIFYDDRTCDWKDLENDSTMKIVAKLLRWEKRKATLFYIKGGFERFSALFSTMCEFIKPCNSSLTSPLKLKLMTSADGRKPFSPRWDTDNKDDQLPRAHSNSVNEPVELLPHLYLGSELHASRRDVLKRLGISAIVNVSRNIPNTFEDS--FTYKTIPVDDTYNADIGVWFEEAAGFIDSVKASGGRVLVHCQAGISRSATICLAYLISRLNFRLDEAYEYVKKRRSVISPNFNFMGQLLHY 306          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Match: EDO37000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGZ1])

HSP 1 Score: 105.916 bits (263), Expect = 1.006e-27
Identity = 55/134 (41.04%), Postives = 84/134 (62.69%), Query Frame = 1
Query:  541 IEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            I P LFLG+E  + + DL+  + I  IL +T      F + +   YKRI+ +DS  +++ Q+FDE+  FI++A+     VLVHC AGVSRS T+ +A++++   + + EA + VK KR   SPNLNF+G L +Y
Sbjct:    1 ILPFLFLGSEEGAADEDLIDRLAIKFILNLTPVCPNFFSEREDIIYKRIQINDSYQEDIGQHFDEAIAFIDEARSRGSSVLVHCHAGVSRSATVTVAYVMQHLGLSLNEAYQFVKEKRPTISPNLNFMGHLLKY 134          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Match: EDO34920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN01])

HSP 1 Score: 99.3673 bits (246), Expect = 2.550e-25
Identity = 52/142 (36.62%), Postives = 81/142 (57.04%), Query Frame = 1
Query:  520 MLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYY 945
            M   +++I PGL+LGN  DS++ + L+   ITHIL +  N     +D+    YK I A+DS  Q+L+ +F E  +FI   +      LVHC+AG+SRS TI  A+++    +   + L+ ++  R IA+PN  F  QL  +Y
Sbjct:    1 MGNGMNKIIPGLYLGNIRDSKDAEQLQEHNITHILSIHDNANPLREDI---MYKCIHAADSPDQDLMPFFQECIEFIHSCRVKEMNCLVHCIAGISRSTTICAAYIMTITELSWRQTLQAIRANRSIANPNYGFKRQLQDFY 139          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Match: EDO43689 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV7])

HSP 1 Score: 98.5969 bits (244), Expect = 9.566e-24
Identity = 76/251 (30.28%), Postives = 127/251 (50.60%), Query Frame = 1
Query:  160 NVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMN-------LKTQFNTTENLPDKIVMYNQSDSIY-----NNVLLQFIDKLDRKF-DARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKI-SEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEA 870
            ++ I D RS   Y   H+  S ++ CS  L+ +  I N       LKT  N   N   K+++Y+Q          +N +     KL   + D  FL+GGF  F+   PK    RS N   C    + V+S+  + T+  + I P L+LG +  S + + L + GI ++L ++ +        +   Y RI   D+ ++N+L +F  ++ FI+K +  +G+VL+HC AG SRS TIA+ +++K  R+ + EA
Sbjct:   19 SLLIIDSRSFLEYNDAHVINSINIGCS-KLIKRRLITNKISIQELLKTGENVQPNQLGKVIVYDQDTQDMEGLSKDNFMSVVFSKLTSSYKDVCFLKGGFSFFAREFPKLCESRS-NPGRCG--VRAVLSQPCLSTEAPTHILPFLYLGTQEHSLDEEFLNATGINYVLNISCSCPALPGLENTGRYLRIPVKDTINENILDWFPTAFDFIDKVREVHGRVLLHCYAGKSRSATIAIGYIMKHLRLSLDEA 265          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:101164462])

HSP 1 Score: 131.339 bits (329), Expect = 2.266e-34
Identity = 100/317 (31.55%), Postives = 159/317 (50.16%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQ--FNTTENL--------PDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAP---KQFFERSQNKIICSPTNQ-----------------------DVVSEDIMLTKIS--------EIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            + D R++E Y  +H+  + +V   + ++ ++   NL  +   +  E+          D IV+Y++    +N      +VL   + K+ D  + A +LEGGF KF    P   +   + S N    SPT Q                          + D   + +S        EI P L+LG   DS NLD+L+  GI +IL VT N    F++   F+YK+I  SD  SQNL Q+F E+  FI++A+     VLVHC+AG+SRSVT+ +A+L++K  + + +A ++VK K+   SPN NF+GQL  + + L + S
Sbjct:   37 VMDCRAQELYESSHVETAINVAIPSLMLRRLKKGNLPVRSLLSNGEDRDKFVRRCKTDTIVLYDEYSREWNENVDGGSVLGLLLRKMKDEGYRAYYLEGGFSKFQAEYPALCETNLDGSPNNS-SSPTAQVLGLGGLRISSDSSDIESDIDRDPSSATDSDGSPLSNPQPSFPVEILPHLYLGCAKDSTNLDVLEEYGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGQKRGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLKS 352          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Match: dusp10 (dual specificity phosphatase 10 [Source:NCBI gene;Acc:101167166])

HSP 1 Score: 130.568 bits (327), Expect = 1.633e-33
Identity = 98/283 (34.63%), Postives = 155/283 (54.77%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNL------MAKMSIMNL------KTQFNTTENLPDKIVMYNQSDS-----IYNNVLLQFIDKLDRKF-DARFLEGGFEKFSE---------LAPKQFFERSQNKIICSPTNQDVVS-EDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            I D R    Y K+HI  + H+NCS  +        K+++++L      K  F    +   +IV+Y++S         N  L   ++ L R+  D   L+GG   F +         L   +  +      +  P    + S  DI   +++ I P L+LGNE D+++ +LL+ + I +IL VT++  L+  D  LF YKR+ A+DS+ QNL QYF+E+++FIE+A +    +L+HC AGVSRS TI +A+L+K   + + +A + VKT+R I SPNLNF+GQL
Sbjct:  165 IIDCRPFLEYNKSHIRGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKGIFS--KEIVVYDESTVDPNRLTSNQPLHAVLESLRREGKDPIILKGGLSYFRQSHENLCEHSLHLHEGLDPGAAAGLTGPLPHSLPSTPDIENAELTPILPFLYLGNEQDAQDANLLQRLNIGYILNVTTHLPLYHYDTGLFIYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGMGLLIHCQAGVSRSATIVIAYLMKHTWMTMTDAYKFVKTRRPIISPNLNFMGQL 445          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Match: dusp7 (dual specificity phosphatase 7 [Source:NCBI gene;Acc:101158099])

HSP 1 Score: 120.168 bits (300), Expect = 2.863e-30
Identity = 92/324 (28.40%), Postives = 152/324 (46.91%), Query Frame = 1
Query:  160 NVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTEN----------LPDKIVMYNQSDS------IYNNVLLQFIDKL-DRKFDARFLEGGFEKFSELAP--------------------------------------KQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINS 966
            ++ + D R+ E Y  +HI  + ++     ++ ++   NL  +     N            D +V+Y+++ S      + ++V+   + KL D    A +LEGGF KF    P                                      ++    ++++    P+NQ      I+        P L+LG   DS NLD+L    I +IL VT N    F+    F+YK+I  SD  SQNL Q+F E+  FI++A+     +LVHC+AG+SRSVT+ +A+L++K  + + +A + VK K+   SPN NF+GQL  + + L +NS
Sbjct:   36 SLLLLDCRAHELYESSHIESAINLAIPGLMLRRLKKGNLPIRSIIPNNEDKEKFVKRCKTDVVVLYDEATSERQESGLGSSVMGLLLQKLRDDGCKAFYLEGGFSKFQSEYPEHCETNLDCSCPSSSPPASVLGLGGLRISSDCSDGESDREPGSATESEGSPLPSNQPAFPVQIL--------PYLYLGCAKDSANLDVLSKYNIKYILNVTPNLPNMFEHEGDFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLNS 351          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Match: dusp16 (dual specificity phosphatase 16 [Source:NCBI gene;Acc:111946967])

HSP 1 Score: 122.479 bits (306), Expect = 3.374e-30
Identity = 98/288 (34.03%), Postives = 147/288 (51.04%), Query Frame = 1
Query:  118 ISVQELIKHLYSHCN-VWIFDLRSRESYFKNHIAKSKHVNCSTNLMA------KMSIMNLKTQFNTTE---NLPDKIVMYNQSDS----IYNNVLLQ-FIDKLDRKFDA-RFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            I VQ L+  L        + D R    +   HI ++ +VNCS  LM       K+ I  L       E       ++V+Y+QS S    + ++  L   + KL++ F +   L GGF  FS L P     RS   ++ S  +Q  +   I     + I P L+LG + D  N DL++   I ++L   SNT      +    + R+  +DS  + +L + D S +FIE+AK +NG+VLVHC+AG+SRS TIA+A+++K+  + + EA   VK KR   SPN NFLGQL
Sbjct:    6 IGVQALVALLEGGLERAVLIDSRPFVDFNAAHILEAVNVNCS-KLMKRRLQQDKVQITELLQHSAKKELDLQAAQEVVVYDQSSSDPAALGSDCFLSVLLVKLEKNFTSVHLLSGGFSTFSRLFPGLCEGRS--ALVPSCVSQPCLP--ISSPGPTRILPHLYLGCQRDVLNTDLMRENDIAYVL-NASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDRSVEFIERAKASNGRVLVHCLAGISRSATIAIAYIMKRMDLSLDEAYRFVKEKRPTISPNFNFLGQL 287          
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Match: ENSORLT00000014597.2 (dual specificity protein phosphatase 7 [Source:NCBI gene;Acc:101175078])

HSP 1 Score: 119.013 bits (297), Expect = 4.611e-30
Identity = 92/303 (30.36%), Postives = 144/303 (47.52%), Query Frame = 1
Query:  169 IFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTEN----------LPDKIVMYNQSDSIYN------NVLLQFIDKL-DRKFDARFLEGGFEKFSELAPKQ---FFERSQNKII----------------CS------------PTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            + D RS E Y  +HI  + ++  +  ++ +    N+  Q    ++            D +V+Y++  + +       +VL   + KL +    A +LEGGF KF+   P+    F + S                     CS            P+NQ      I+        P L+LG   DS NLD+L    IT+IL VT N    F+    F YK+I  SD  SQNL Q+F E+  FI++A+     +LVHC+AG+SRSVT+ +A+L+++  + + +A + VK K+   SPN NF+GQL
Sbjct:   26 LLDCRSHELYESSHIESAINLAMTGLMLRRFKKGNIPIQTVIPKHEEKEKFIGRCKTDTVVLYDECSAEWPASGAPASVLFVLLQKLWEDGCKAFYLEGGFVKFNTEYPEHCETFLDSSCPSSSPPVSALGFGNLRISSDCSDGESTEPEESPFPSNQPDFPVQIL--------PYLYLGCAKDSANLDVLGQYNITYILNVTPNLPNMFEHDGHFRYKQIPISDHWSQNLSQFFPEAISFIDEARSKRCGILVHCLAGISRSVTVTVAYLMQRLNLSLNDAYDFVKRKKSNISPNFNFMGQL 320          
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Match: SMESG000078269.1 (SMESG000078269.1)

HSP 1 Score: 191.815 bits (486), Expect = 7.054e-57
Identity = 116/282 (41.13%), Postives = 170/282 (60.28%), Query Frame = 1
Query:  118 ISVQELIKHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYNQSDSIYNNVLLQFIDKLDRKFDA-RFLEGGFEKFSELAPKQFFERS--QNKII---CSPTNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYY 945
            ISV EL   L +   + + D R   ++   HI  ++  NC+T  M   +  N   +F+      + IV+YNQ      + L+ FID L + FD+  F+ GG+E++ +   K F E S  + KI     SPTN+   S D++   ISEI P LFLGNE DS ++++L+   ITHIL VT+N   + +DL  F YKR+ A+D + Q++  Y+DE+ QFI++A   NGKVLVHC AGVSRS TI  A+L+K  ++ VL+ +  +++KR I  PN NFLGQL+R+Y
Sbjct:   83 ISVTELDSKLRAKNTICLIDTRDVRTFKNGHIIGAELFNCTTRTMMMKAKKNWD-KFSQRRCDFETIVLYNQRGEKTVH-LIDFIDNLKKDFDSVYFVTGGYEEYIKYFSKGFIESSIPEEKIDQYHYSPTNESNRSTDVLNATISEILPFLFLGNEMDSNDIEVLQEKKITHILNVTTNVPFYREDL--FVYKRLSATDCNRQDMRAYYDEAIQFIDEAYSKNGKVLVHCWAGVSRSATIVAAYLLKHTKLSVLQTIMFLQSKRPIVEPNFNFLGQLERFY 360          
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Match: SMESG000063504.1 (SMESG000063504.1)

HSP 1 Score: 187.578 bits (475), Expect = 7.717e-56
Identity = 112/278 (40.29%), Postives = 172/278 (61.87%), Query Frame = 1
Query:  166 WIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYNQSDSI--YNNVLLQFIDKL--DRKFDARFLEGGFEKFSELAPKQFFERSQNK-----IICSPTNQDVV-SEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYYQFLDINSN 969
            +I DLR    +   HI  +K  NC+T LM+K ++M+ K      E   D  ++Y+Q   +   N+  +  ID L  + K    +L+GG+++F ++  +   E S  K        SPTN  +  SED++    S+I P +F+GNE DS +L+LLK + ITHIL VTS +  +FK+L++F+Y+R+ A DS  QNL   ++E++ FI+ A+ +NG+VLVHC AGVSRS +I +A+L+K     VLE L+ V+ KR I +PN++FLGQL++Y   LD+N N
Sbjct:   83 FILDLRDSRHFQNGHIKGAKTANCTTKLMSKKTLMDWKRSDYDNE---DHYILYDQQSDLPAANSPQIVLIDYLLLNNK-QITYLQGGYDEFKKVCKESLIETSLPKEKLQSYNYSPTNVHINNSEDVLNATASQIFPFIFIGNERDSSDLELLKELEITHILNVTSTSPFYFKNLNIFQYQRLPACDSHMQNLRVLYNEAFNFIDAARFSNGRVLVHCWAGVSRSPSIVIAYLLKHSNNSVLEILKFVQGKRSIVAPNIHFLGQLEKYN--LDLNQN 354          
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Match: SMESG000030100.1 (SMESG000030100.1)

HSP 1 Score: 174.481 bits (441), Expect = 3.267e-51
Identity = 113/284 (39.79%), Postives = 168/284 (59.15%), Query Frame = 1
Query:  112 SLISVQELIKHLYSHCNV-WIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYNQSDSIYNNVL--LQFIDKLDRKFD-ARFLEGGFEKFSELAPKQFFER--SQNKII---CSPTNQDVVSEDIMLTKISEIEPG-LFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQL 933
            S IS  ELI+ + +  ++  I D+R    +   HI  + + +CST LM++ S   +K     +  L   IV+Y++ D + +  L  ++ I+++       + L GGF +F   A KQ+ E+  S  KI+    SPT  +  SED+M T +SEI P  L+LGNE D+++   L+   IT I+ VTS+    F+++  F+Y RI ASDS  QNL QYFDE++  IE  ++ NG++ +HC AGVSRS TI M +L+K   + VLE L+ V+  R IA PNLNFLGQL
Sbjct:   48 SHISCMELIELIDNKTDMDLIIDVRGNRFFQMQHIRHAMNFSCSTKLMSRRS--QVKWMKFHSNKLFSSIVIYDEKDILKDRDLFAMKLINQIQLTCSLVQVLSGGFSEFKTYADKQYLEKKMSSQKILEYAASPTRLECSSEDVMKTTMSEIIPKFLYLGNELDAKDKHALREKKITDIMNVTSHVPFFFENI--FKYYRIPASDSDKQNLSQYFDEAFNIIEDVRKRNGRIFIHCWAGVSRSSTIVMMYLMKTKGLDVLETLKYVQEHRPIADPNLNFLGQL 327          
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Match: SMESG000035381.1 (SMESG000035381.1)

HSP 1 Score: 158.303 bits (399), Expect = 1.427e-44
Identity = 105/284 (36.97%), Postives = 162/284 (57.04%), Query Frame = 1
Query:  118 ISVQELIKHLYSHCNVWIFDLRSRESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYN-------QSDSIYNNVLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQNKIICSPTNQDVVS-EDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKK-YRIKVLEALEMVKTKRCIASPNLNFLGQLDRY 942
            I   EL K + + C+V I DLRS  ++ K HI  +K  NCS+ + ++ +I  +     T+ +L  +IV+Y        Q D I   VL+QF+  + R  +  +L   F+KF    P    E   + ++C    + V    DI  TK S I P L+LGNE D+ N   L +  ITH+L VT   K  F D   F+ KRI  +D++ Q+L+Q+F ++++FIE A+++NG++LVHC AG+SRS TI +A+L+     + +  A + VK +R I SPN NF+GQL ++
Sbjct:   74 IESAELEKLISTDCSVIILDLRSAYNFSKMHITTAKLANCSSKMKSRRAIQIVNEILKTSIDL-HRIVLYTEFGLPFKQDDPI--TVLIQFL--IGRSINCLYLTDSFKKFETTYP-NLCESGSSNVLCLHIPKSVPDFTDIYFTKASLILPFLYLGNELDALNSTFLTNNKITHVLNVT--IKASFLDEIKFKSKRINCNDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQF 349          
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Match: SMESG000014789.1 (SMESG000014789.1)

HSP 1 Score: 105.531 bits (262), Expect = 7.230e-26
Identity = 59/138 (42.75%), Postives = 90/138 (65.22%), Query Frame = 1
Query:  532 ISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSNTKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVHCVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDRYY 945
            + EI   L+LG+  D+ N+DLLKS+ I +IL V  +  LH   ++ F YK I+A D  +Q+L+ YFDE+ +FIE  ++  G VL+HC+AG+SRS TI  A+++K ++I   +A+E +K K  I  PN  F+ QL  Y+
Sbjct:    1 MKEIISNLWLGSYEDASNVDLLKSLQIKYILTVMDSPLLH--KMEDFNYKFIKAYDVPNQDLISYFDETSEFIENGRKFGG-VLIHCLAGISRSGTILTAYIMKHFKIDPNDAIEKIKEKSFIC-PNDGFMKQLKIYF 134          
The following BLAST results are available for this feature:
BLAST of Dual specificity phosphatase 10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP66.935e-3446.15dual specificity phosphatase 6 [Source:HGNC Symbol... [more]
DUSP61.407e-3246.15dual specificity phosphatase 6 [Source:HGNC Symbol... [more]
DUSP106.646e-3132.57dual specificity phosphatase 10 [Source:HGNC Symbo... [more]
DUSP24.953e-3036.61dual specificity phosphatase 2 [Source:HGNC Symbol... [more]
DUSP78.055e-3044.76dual specificity phosphatase 7 [Source:HGNC Symbol... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lip-11.031e-3042.45Dual specificity protein phosphatase lip-1 [Sourc... [more]
lip-11.497e-3042.45Dual specificity protein phosphatase lip-1 [Sourc... [more]
vhp-11.191e-2231.40Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-11.191e-2231.40Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-11.204e-2231.40Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
puc5.847e-2943.66gene:FBgn0243512 transcript:FBtr0339722[more]
puc2.783e-2841.43gene:FBgn0243512 transcript:FBtr0081792[more]
ssh3.719e-2540.29gene:FBgn0029157 transcript:FBtr0301613[more]
ssh3.862e-2540.29gene:FBgn0029157 transcript:FBtr0301612[more]
ssh7.374e-2540.54gene:FBgn0029157 transcript:FBtr0084799[more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp61.071e-3231.11dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
dusp61.071e-3231.11dual specificity phosphatase 6 [Source:ZFIN;Acc:ZD... [more]
si:dkey-175m17.73.060e-3245.81si:dkey-175m17.7 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
dusp71.037e-2944.06dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
dusp71.056e-2944.06dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npc1l12.010e-3444.06NPC1 like 1 [Source:Xenbase;Acc:XB-GENE-964011][more]
usp485.988e-3431.33ubiquitin specific peptidase 48 [Source:Xenbase;Ac... [more]
lrit26.263e-3429.41leucine-rich repeat, Ig-like and transmembrane dom... [more]
ibtk6.418e-3237.89inhibitor of Bruton tyrosine kinase [Source:Xenbas... [more]
eci12.277e-3130.60enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp69.565e-3346.15dual specificity phosphatase 6 [Source:MGI Symbol;... [more]
Dusp105.961e-3133.33dual specificity phosphatase 10 [Source:MGI Symbol... [more]
Dusp161.186e-3032.12dual specificity phosphatase 16 [Source:MGI Symbol... [more]
Dusp75.053e-3044.76dual specificity phosphatase 7 [Source:MGI Symbol;... [more]
Dusp25.528e-3036.26dual specificity phosphatase 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DBB1|DUS6_MOUSE6.691e-3246.15Dual specificity protein phosphatase 6 OS=Mus musc... [more]
sp|Q16828|DUS6_HUMAN6.759e-3246.15Dual specificity protein phosphatase 6 OS=Homo sap... [more]
sp|Q64346|DUS6_RAT7.258e-3246.15Dual specificity protein phosphatase 6 OS=Rattus n... [more]
sp|Q2KJ36|DUS6_BOVIN7.332e-3246.15Dual specificity protein phosphatase 6 OS=Bos taur... [more]
sp|Q9ZR37|DUS1_ARATH1.338e-3148.87Dual specificity protein phosphatase 1 OS=Arabidop... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183AFG31.721e-4153.38Uncharacterized protein OS=Echinostoma caproni OX=... [more]
G4VQ481.164e-4034.00Putative dual specificity protein phosphatase OS=S... [more]
K1QUW93.942e-4036.12Dual specificity protein phosphatase 10 OS=Crassos... [more]
R7V1195.911e-4036.67Uncharacterized protein OS=Capitella teleta OX=283... [more]
F8WLE57.140e-4036.46Mitogen-activated protein kinase phosphatase OS=Du... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp63.773e-3331.65dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
dusp65.851e-3331.65dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
taf1a3.954e-3233.81TATA-box binding protein associated factor, RNA po... [more]
dusp41.560e-3129.71dual specificity phosphatase 4 [Source:NCBI gene;A... [more]
si:dkey-175m17.76.419e-3144.65uncharacterized LOC103045335 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp42.943e-3233.94dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
dusp101.527e-3143.31dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
dusp73.545e-3145.45dual specificity phosphatase 7 [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000006071.11.224e-2945.59pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-... [more]
dusp107.437e-2926.83dual specificity phosphatase 10 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YVH14.149e-1331.17Dual specificity protein phosphatase; regulates gr... [more]
PPS18.260e-932.29Protein phosphatase; has specificity for serine, t... [more]
MSG54.595e-632.00Dual-specificity protein phosphatase; exists in 2 ... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454323.493e-3429.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492506.097e-3229.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370001.006e-2741.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349202.550e-2536.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436899.566e-2430.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp62.266e-3431.55dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
dusp101.633e-3334.63dual specificity phosphatase 10 [Source:NCBI gene;... [more]
dusp72.863e-3028.40dual specificity phosphatase 7 [Source:NCBI gene;A... [more]
dusp163.374e-3034.03dual specificity phosphatase 16 [Source:NCBI gene;... [more]
ENSORLT00000014597.24.611e-3030.36dual specificity protein phosphatase 7 [Source:NCB... [more]
back to top
BLAST of Dual specificity phosphatase 10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078269.17.054e-5741.13SMESG000078269.1[more]
SMESG000063504.17.717e-5640.29SMESG000063504.1[more]
SMESG000030100.13.267e-5139.79SMESG000030100.1[more]
SMESG000035381.11.427e-4436.97SMESG000035381.1[more]
SMESG000014789.17.230e-2642.75SMESG000014789.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013798 ID=SMED30013798|Name=Dual specificity phosphatase 10|organism=Schmidtea mediterranea sexual|type=transcript|length=1124bp
CATTTAAGTACTATGCATATTTAAAACAAACAATTAATAATGATAAAAAT
CGACATTCTAAACCCACACGTTGAAAATTTAATATCAGACAAATCGTATC
GGAAATTTCGAAGTTTAATTTCTGTTCAAGAATTAATAAAACATCTATAC
AGCCATTGCAACGTGTGGATTTTCGACCTCCGGAGCCGGGAAAGCTACTT
CAAGAACCACATTGCCAAGTCAAAGCATGTCAACTGTTCGACAAACCTAA
TGGCTAAAATGTCGATAATGAATCTAAAAACTCAATTCAACACAACCGAA
AATCTCCCGGACAAAATCGTCATGTACAATCAGTCAGACTCGATTTACAA
TAATGTCCTTCTGCAATTTATTGACAAACTGGATCGAAAATTTGATGCGA
GATTTTTGGAAGGAGGATTTGAAAAGTTTTCGGAATTGGCGCCGAAGCAA
TTTTTTGAAAGATCTCAAAATAAAATCATTTGTAGCCCTACGAACCAGGA
TGTCGTGTCTGAGGATATCATGCTAACGAAAATTAGTGAAATCGAGCCGG
GTTTATTTTTGGGAAATGAGGCTGACAGTGAAAACTTGGATTTGCTAAAG
TCAATTGGAATAACTCATATTTTGTGCGTGACTTCGAATACGAAGTTACA
CTTCAAAGACTTGGATTTATTTGAGTACAAAAGAATAGAAGCTAGTGATT
CCTCAAGTCAAAATCTCTTACAGTATTTTGATGAATCGTATCAATTTATA
GAAAAGGCTAAAAGGAATAATGGAAAGGTTTTAGTGCATTGCGTCGCTGG
CGTTTCTCGATCAGTGACAATAGCAATGGCCTTTCTCATTAAAAAATATA
GAATCAAGGTTTTGGAAGCCTTGGAAATGGTGAAAACGAAACGATGCATT
GCGTCTCCAAATTTGAATTTTTTGGGTCAACTTGATCGATATTATCAATT
TTTGGATATTAATTCAAACAAATAATTTTTAATGAAAATATTCAAAATTA
TATTACTTTCAAGTTTAATTTATTGACTTGGTAATAAATAAGTTTTACTT
TGGTTTTAATAAATTTGTAATTAATTATCTATTAAATAATTTATCTATGT
TCATTAAATCCATTATCAATAAAT
back to top

protein sequence of SMED30013798-orf-1

>SMED30013798-orf-1 ID=SMED30013798-orf-1|Name=SMED30013798-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MIKIDILNPHVENLISDKSYRKFRSLISVQELIKHLYSHCNVWIFDLRSR
ESYFKNHIAKSKHVNCSTNLMAKMSIMNLKTQFNTTENLPDKIVMYNQSD
SIYNNVLLQFIDKLDRKFDARFLEGGFEKFSELAPKQFFERSQNKIICSP
TNQDVVSEDIMLTKISEIEPGLFLGNEADSENLDLLKSIGITHILCVTSN
TKLHFKDLDLFEYKRIEASDSSSQNLLQYFDESYQFIEKAKRNNGKVLVH
CVAGVSRSVTIAMAFLIKKYRIKVLEALEMVKTKRCIASPNLNFLGQLDR
YYQFLDINSNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0017017MAP kinase tyrosine/serine/threonine phosphatase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036873Rhodanese-like_dom_sf
IPR020417Atypical_DUSP
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR001763Rhodanese-like_dom
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0000188inactivation of MAPK activity
GO:0035335peptidyl-tyrosine dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020417Atypical dual specificity phosphatasePRINTSPR01908ADSPHPHTASEcoord: 169..181
score: 31.42
coord: 213..222
score: 33.4
coord: 186..197
score: 44.33
coord: 229..240
score: 32.98
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 164..304
e-value: 5.7E-49
score: 178.7
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 164..306
score: 37.75
IPR001763Rhodanese-like domainPFAMPF00581Rhodanesecoord: 31..132
e-value: 2.1E-5
score: 25.0
IPR001763Rhodanese-like domainPROSITEPS50206RHODANESE_3coord: 38..139
score: 9.153
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 151..310
e-value: 5.2E-47
score: 161.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 160..309
IPR036873Rhodanese-like domain superfamilyGENE3DG3DSA:3.40.250.10coord: 25..140
e-value: 1.5E-9
score: 40.5
IPR036873Rhodanese-like domain superfamilySUPERFAMILYSSF52821Rhodanese/Cell cycle control phosphatasecoord: 26..135
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 172..303
e-value: 2.2E-33
score: 114.9
NoneNo IPR availablePANTHERPTHR10159DUAL SPECIFICITY PROTEIN PHOSPHATASEcoord: 45..303
NoneNo IPR availableCDDcd14498DSPcoord: 165..298
e-value: 1.10832E-55
score: 175.042
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 227..285
score: 13.755