Protocadherin-9

Overview
NameProtocadherin-9
Smed IDSMED30013790
Length (bp)3261
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-9 (SMED30013790) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30013790) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-9 (SMED30013790) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-9 (SMED30013790) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013790

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013790SMESG000076350.1 SmedASXL_016723SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013790SMESG000076350.1 dd_Smed_v4_15033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013790SMESG000076350.1 dd_Smed_v6_15033_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30013790SMESG000076350.1 SMED30013790smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH18 (protocadherin 18 [Source:HGNC Symbol;Acc:HGNC:14268])

HSP 1 Score: 226.098 bits (575), Expect = 9.108e-67
Identity = 147/468 (31.41%), Postives = 242/468 (51.71%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSN--IFKIQPKST--FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN-VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
              +N+ Y + EE  VG+ +  L+ D    + K+   ST  F+    G       + E  G++ I   IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+ S   I+ISE+  VG RI L +A DPDV  N++ TY +   ND FNI        +    LIV+  LD E + +Y+  L A D G+P   G+  L IS+ D NDN P F Q+ Y + + EN+ VG ++ ++ A D D G  G++ Y F     P ++  F I +  G + L + ++ + I + + ++++A D G      +  + + + DVN+ +P ININ + P K++ + + E   + +  A++ V D D G+N E+ C L  G  +FKL  +      + Y +  N   DRE  S + + ++  DRGTP L+T +  TV+I D+N+  P F++  Y   +SEN++ G
Sbjct:   26 LGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPNPSTVRFRAMQRGNS-PLLVVNEDNGEISIGATIDREQLCQKNLN----CSIEFDVITLPTEHLQLFHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSA-NDFFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKIDSERGHLTLFKQVDYE-ITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLH-GHGHFKLQKTY----ENNYLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPG 481          

HSP 2 Score: 50.0618 bits (118), Expect = 9.108e-67
Identity = 51/160 (31.87%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQL 2139
            ID   G +    I D E+  +I  +V A D G P+   + TTV +TI D NDN P VI  P L+    E T+P        +T+I+A D D G N  +   I            +  N   IF ID  S ++    S+D      + L +++ D+G PQL
Sbjct:  520 IDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIG-PALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAI------------VAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQL 666          

HSP 3 Score: 115.546 bits (288), Expect = 2.241e-25
Identity = 117/415 (28.19%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE------------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPK-----FAESYYQIQ-ISEAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK--VGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTE 1489
            +F  +   K+++ F ++   G L + +++D E             + P S  A   C+I             +I + DVND++P+      +    +I  I E   +   ++L    D D   N   VC    HG +     T+ N  YLI+ NA LD E +  Y  T++A D G P L   +   + + DINDN P F +  Y+ +I EN   G  +  VTA D D G  GQV Y   +  +   S+ +Y  I    G I   RI + + ++Q  +  +EA DGGS PK  V   TV + + D N+  PV+    +GPA +    +  + +      H   I   D D GVNAE+ C +  G  EN  + + ++    DI+T   N   D    + +++ ++  D+G P+L T+
Sbjct:  284 SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPA--HCKI-------------IIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHG-HFKLQKTYENN-YLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ-ITFVVEARDGGS-PKQLVSNTTVVLTIIDENDNVPVV----IGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSC---DIHT---NVSMDSVPYTEWELSVIIQDKGNPQLHTK 669          

HSP 4 Score: 81.2629 bits (199), Expect = 9.428e-15
Identity = 81/292 (27.74%), Postives = 128/292 (43.84%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPKWFQPVA--HSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSIREGHYL---IKLVANDNGNPNLSTEIKINLYI-----SSKSTFSTVINISDDQFRVVIVIAM 2553
            LDREK  +  L V+A D+G P S +      + I D+NDNPP         V     +   ++T + A DPDLGENG V + I    +   L   I    T   +ID  +G +   +  D E +      +   D G P QL S   + LT++D NDN P    P    ++  IT          +   +A D DS  NA ++  +  G  +++  ID    D+    S+    Y    + ++  D GNP L T++ +   I     S  ST  T ++ +     ++I+I++
Sbjct:  423 LDREKRSEYSLTVIAEDRGTP-SLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTIL---ESFILGSSI----TTYVTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISL 706          

HSP 5 Score: 62.003 bits (149), Expect = 7.325e-9
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F ID   G+L     +D E     E+ V A D G P S  A   + I + DVNDN P +    ++P K ++    E  P+  F+  ++ +D D G NG +   +      +   +K  EN   I +            +LDRE    Y L ++  D+G P L++++  T+ + DINDNPP  FQ   +   I+  +  +    I    A+DPD   N  +TY + E
Sbjct:  297 FKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLG-PNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFK--LQKTYENNYLILT----------NATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPH-FQRSRYEFVISENN--SPGAYITTVTATDPDLGENGQVTYTILE 506          

HSP 6 Score: 58.5362 bits (140), Expect = 8.420e-8
Identity = 67/261 (25.67%), Postives = 113/261 (43.30%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVT-----------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            LDRE     EL + A D G P+ ++ ++ + I+I+D NDN P        +Q+ EN     + L  + A DPD G NG + +           +  +     + F ID   G+LT++K +D E   SY + +   D G   + +   I + V+D+NDN P+    +          +      D  + + +  D DS  N  I   +            E + L+  +A +   R ++S     Y + ++A D G P+LST
Sbjct:  204 LDRELKSSYELQLTASDMGVPQ-RSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLL-DLNATDPDEGANGKIVY---------SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATLD--REKRS----EYSLTVIAEDRGTPSLST 447          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH18 (protocadherin 18 [Source:HGNC Symbol;Acc:HGNC:14268])

HSP 1 Score: 226.098 bits (575), Expect = 9.337e-67
Identity = 147/468 (31.41%), Postives = 242/468 (51.71%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSN--IFKIQPKST--FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN-VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
              +N+ Y + EE  VG+ +  L+ D    + K+   ST  F+    G       + E  G++ I   IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+ S   I+ISE+  VG RI L +A DPDV  N++ TY +   ND FNI        +    LIV+  LD E + +Y+  L A D G+P   G+  L IS+ D NDN P F Q+ Y + + EN+ VG ++ ++ A D D G  G++ Y F     P ++  F I +  G + L + ++ + I + + ++++A D G      +  + + + DVN+ +P ININ + P K++ + + E   + +  A++ V D D G+N E+ C L  G  +FKL  +      + Y +  N   DRE  S + + ++  DRGTP L+T +  TV+I D+N+  P F++  Y   +SEN++ G
Sbjct:   26 LGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPNPSTVRFRAMQRGNS-PLLVVNEDNGEISIGATIDREQLCQKNLN----CSIEFDVITLPTEHLQLFHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSA-NDFFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKIDSERGHLTLFKQVDYE-ITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLH-GHGHFKLQKTY----ENNYLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPG 481          

HSP 2 Score: 50.0618 bits (118), Expect = 9.337e-67
Identity = 51/160 (31.87%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQL 2139
            ID   G +    I D E+  +I  +V A D G P+   + TTV +TI D NDN P VI  P L+    E T+P        +T+I+A D D G N  +   I            +  N   IF ID  S ++    S+D      + L +++ D+G PQL
Sbjct:  520 IDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIG-PALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAI------------VAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQL 666          

HSP 3 Score: 115.546 bits (288), Expect = 2.360e-25
Identity = 117/415 (28.19%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE------------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPK-----FAESYYQIQ-ISEAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK--VGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTE 1489
            +F  +   K+++ F ++   G L + +++D E             + P S  A   C+I             +I + DVND++P+      +    +I  I E   +   ++L    D D   N   VC    HG +     T+ N  YLI+ NA LD E +  Y  T++A D G P L   +   + + DINDN P F +  Y+ +I EN   G  +  VTA D D G  GQV Y   +  +   S+ +Y  I    G I   RI + + ++Q  +  +EA DGGS PK  V   TV + + D N+  PV+    +GPA +    +  + +      H   I   D D GVNAE+ C +  G  EN  + + ++    DI+T   N   D    + +++ ++  D+G P+L T+
Sbjct:  284 SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPA--HCKI-------------IIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHG-HFKLQKTYENN-YLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ-ITFVVEARDGGS-PKQLVSNTTVVLTIIDENDNVPVV----IGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSC---DIHT---NVSMDSVPYTEWELSVIIQDKGNPQLHTK 669          

HSP 4 Score: 81.2629 bits (199), Expect = 8.812e-15
Identity = 81/292 (27.74%), Postives = 128/292 (43.84%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPKWFQPVA--HSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSIREGHYL---IKLVANDNGNPNLSTEIKINLYI-----SSKSTFSTVINISDDQFRVVIVIAM 2553
            LDREK  +  L V+A D+G P S +      + I D+NDNPP         V     +   ++T + A DPDLGENG V + I    +   L   I    T   +ID  +G +   +  D E +      +   D G P QL S   + LT++D NDN P    P    ++  IT          +   +A D DS  NA ++  +  G  +++  ID    D+    S+    Y    + ++  D GNP L T++ +   I     S  ST  T ++ +     ++I+I++
Sbjct:  423 LDREKRSEYSLTVIAEDRGTP-SLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTIL---ESFILGSSI----TTYVTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISL 706          

HSP 5 Score: 62.003 bits (149), Expect = 6.789e-9
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F ID   G+L     +D E     E+ V A D G P S  A   + I + DVNDN P +    ++P K ++    E  P+  F+  ++ +D D G NG +   +      +   +K  EN   I +            +LDRE    Y L ++  D+G P L++++  T+ + DINDNPP  FQ   +   I+  +  +    I    A+DPD   N  +TY + E
Sbjct:  297 FKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLG-PNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFK--LQKTYENNYLILT----------NATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPH-FQRSRYEFVISENN--SPGAYITTVTATDPDLGENGQVTYTILE 506          

HSP 6 Score: 58.5362 bits (140), Expect = 7.803e-8
Identity = 67/261 (25.67%), Postives = 113/261 (43.30%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVT-----------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            LDRE     EL + A D G P+ ++ ++ + I+I+D NDN P        +Q+ EN     + L  + A DPD G NG + +           +  +     + F ID   G+LT++K +D E   SY + +   D G   + +   I + V+D+NDN P+    +          +      D  + + +  D DS  N  I   +            E + L+  +A +   R ++S     Y + ++A D G P+LST
Sbjct:  204 LDRELKSSYELQLTASDMGVPQ-RSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLL-DLNATDPDEGANGKIVY---------SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATLD--REKRS----EYSLTVIAEDRGTPSLST 447          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHGB4 (protocadherin gamma subfamily B, 4 [Source:HGNC Symbol;Acc:HGNC:8711])

HSP 1 Score: 229.95 bits (585), Expect = 2.247e-62
Identity = 150/457 (32.82%), Postives = 241/457 (52.74%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YF++   +G+L+++ R+DRE++C         C +E       P++++   + I+D+NDH PKF ++ +++QISE+ Q G R  L +A D D+  N +  Y +   +D F++        S    +++   LD E Q +Y  TL A D G PPL     + + V D NDN PVFSQ  Y+V + EN   G  V  VTA D D G+  ++ + F +    S ++ F +++ TGEI +   L+ + + +++S+ +EA DGG +  +   TV V + D N+  P +   SL        + E+  L +H A++ V D D   N EV C L  G   FK+  S     R+ Y L  + V DRE +  + + +  +DRG P L++   IT+ I DVN+ +P F + +Y V+V+EN+  G
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLG-FSVQELPTRKLRVSSEK-PYFTVSAESGELLVSSRLDREEICGKK----PACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILGSAHDADIGSNTLQNYQLSP-SDHFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFSFSEA---SQITQFDLNSNTGEITVLNTLDFEEV-KEYSIVLEARDGGGM--IAQCTVEVEVIDENDNAPEVIFQSLPNL-----IMEDAELGTHIALLKVRDKDSRHNGEVTCKLE-GDVPFKILTSS----RNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPG 466          

HSP 2 Score: 103.219 bits (256), Expect = 1.047e-21
Identity = 104/405 (25.68%), Postives = 175/405 (43.21%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHY-AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR--------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY--RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHLTVGAE 1342
            L S  QI + ++  N+    F+++++  ++ E +  G  V  +        +  + TF  + +   +  F L  +TG++ +   +D E+V   S     R        C +E+ +              D ND+ P+         I E  ++G  I+L    D D   N   T  + G      +T S   Y +V +A LD E    Y  T+ A D G PPL  + ++ + + D+NDN PVFSQ  Y V + EN   G  ++ V A D D G  GQV Y      ++   + SY  IS  +G +  QR  + + + + F L ++A D GS       ++ V + D N+  P +   +LGP     F++  +     +     V+ D D G NA +  H+   +E
Sbjct:  222 LSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFS-FSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI-------------DENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQL-RAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASE 611          

HSP 3 Score: 102.449 bits (254), Expect = 2.192e-21
Identity = 106/404 (26.24%), Postives = 184/404 (45.54%), Query Frame = 2
Query:  371 YFSL---EESTG----KLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVD-CHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            +FSL   E+S G    ++++   +DRE+      + TALD     L+    I      + + D ND+ P F++  Y++ +SE V  G  +   TA+D D   N   T+    F++   IT     SN   + V+N LD+E    Y   L A D G   +    T+ + V+D NDN P    +    +I E+A +G  +A +   D DS   G+V  +  G V           S  T ++    +L+ +    ++++ + A+D G  P    +++ +H+ DVN+  PV + +S        +V EN    +  + +  SD D+G N +V  C +    E  +LS+  ++           R FD E    F++ +   D+G+P L+    + V + D N+ +PR
Sbjct:  177 HFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIH-----VLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITF---SFSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGG--MIAQCTVEVEVIDENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVP----FKILTSSRNTYKLVTDAVLD-REQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSY-----IVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFA-QRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPR 559          

HSP 4 Score: 91.6633 bits (226), Expect = 3.692e-18
Identity = 89/322 (27.64%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYL-------IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDN-----HPVFSQKEYKV--IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD 1171
            + E+ ++G  +  L +     +   + T KL  D    K  +   +T KL+    +DREQ      + TA DR +  L+    I      + I DVND+ P F++S Y + ++E    G  IS   ASDPD+ PN   +Y +   +D      S+ + +           A D+E    ++ TL A D G P L  N +L + V D NDN     +P        +  ++   A  G +V  V AVD DSG    + Y   Q  +P +   F +   TGE++  R L  ++  +   L +   DGG  P    AT+ +   D
Sbjct:  354 IMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPF-KILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSI-----TLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMA-SDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL---FSLGLRTGEVRTARALGDRDAVRQ-RLLVAVRDGGQPPLSATATLHLVFAD 664          

HSP 5 Score: 79.337 bits (194), Expect = 2.440e-14
Identity = 84/308 (27.27%), Postives = 151/308 (49.03%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVE-DKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI--REGHYLIKLVA-NDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVT 2559
            L T  +LDRE+  +  + V A D+G+P   ++++++ + I DVNDN P V +     V   E   P   ++Q++A DPDLG NG V + I   + ++R L+  +        SI   SG +   ++ D E + ++ L +   DQG P L++  ++ + V D NDN P+   P           ++  A +   ++ +  A D DS  NA ++YHV +  +  L  +    G++R  +++  R+      LVA  D G P LS    ++L + + S    + +I+D           QF +V+ +A+++
Sbjct:  402 LVTDAVLDREQNPEYNITVTATDRGKP-PLSSSSSITLHIGDVNDNAP-VFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYV--------SISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAVRQRLLVAVRDGGQPPLSATATLHL-VFADSLQEVLPDITDRPDPSDLQAELQFYLVVALALIS 698          

HSP 6 Score: 66.6254 bits (161), Expect = 2.274e-10
Identity = 75/284 (26.41%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP--VAH-STNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +   N LD E+  +  +++ A D G   +Q       I   D NDN P VI  + P L +++ E  L   +  ++ RD D   NG V   ++             +   KI +    +  L     LDRE    Y + +   D+GKP L+S  +ITL + D+NDN P + Q   + H + N    + ++Q       +ASDPD  PN  ++Y +   D         V I A  G + A+++        + + L A D G+P LS  + + + +
Sbjct:  290 FDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI---DENDNAPEVIFQSLPNLIMEDAE--LGTHIALLKVRDKDSRHNGEVTCKLE------------GDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQ------VRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLV 550          

HSP 7 Score: 52.373 bits (124), Expect = 4.748e-6
Identity = 71/252 (28.17%), Postives = 106/252 (42.06%), Query Frame = 1
Query: 1642 IPTR----SKSKCLFFIDQYMGNLRTANILDREK--GDK----IELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP---VAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID 2355
            +PTR    S  K  F +    G L  ++ LDRE+  G K    +E   +A       +      V + I D+ND+ P    N  +LQ+ E+ +    F+    A D D+G N T++ Y     D   L  K   + +K          + +   LDRE   SY L +   D G P L+S   I + V D NDN P + Q    V+ S N+   + + Q        A+D D   NA IT+  +E   +   D
Sbjct:   61 LPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVA------ENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILG-SAHDADIGSN-TLQNYQLSPSDHFSLINKEKSDGSKY-------PEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQ------VTATDQDEGVNAEITFSFSEASQITQFD 291          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDHGB4 (protocadherin gamma subfamily B, 4 [Source:HGNC Symbol;Acc:HGNC:8711])

HSP 1 Score: 229.95 bits (585), Expect = 8.503e-62
Identity = 150/457 (32.82%), Postives = 241/457 (52.74%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YF++   +G+L+++ R+DRE++C         C +E       P++++   + I+D+NDH PKF ++ +++QISE+ Q G R  L +A D D+  N +  Y +   +D F++        S    +++   LD E Q +Y  TL A D G PPL     + + V D NDN PVFSQ  Y+V + EN   G  V  VTA D D G+  ++ + F +    S ++ F +++ TGEI +   L+ + + +++S+ +EA DGG +  +   TV V + D N+  P +   SL        + E+  L +H A++ V D D   N EV C L  G   FK+  S     R+ Y L  + V DRE +  + + +  +DRG P L++   IT+ I DVN+ +P F + +Y V+V+EN+  G
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLG-FSVQELPTRKLRVSSEK-PYFTVSAESGELLVSSRLDREEICGKK----PACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILGSAHDADIGSNTLQNYQLSP-SDHFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFSFSEA---SQITQFDLNSNTGEITVLNTLDFEEV-KEYSIVLEARDGGGM--IAQCTVEVEVIDENDNAPEVIFQSLPNL-----IMEDAELGTHIALLKVRDKDSRHNGEVTCKLE-GDVPFKILTSS----RNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPG 466          

HSP 2 Score: 103.219 bits (256), Expect = 1.236e-21
Identity = 104/405 (25.68%), Postives = 175/405 (43.21%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHY-AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR--------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY--RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHLTVGAE 1342
            L S  QI + ++  N+    F+++++  ++ E +  G  V  +        +  + TF  + +   +  F L  +TG++ +   +D E+V   S     R        C +E+ +              D ND+ P+         I E  ++G  I+L    D D   N   T  + G      +T S   Y +V +A LD E    Y  T+ A D G PPL  + ++ + + D+NDN PVFSQ  Y V + EN   G  ++ V A D D G  GQV Y      ++   + SY  IS  +G +  QR  + + + + F L ++A D GS       ++ V + D N+  P +   +LGP     F++  +     +     V+ D D G NA +  H+   +E
Sbjct:  222 LSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFS-FSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI-------------DENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQL-RAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASE 611          

HSP 3 Score: 102.449 bits (254), Expect = 2.119e-21
Identity = 106/404 (26.24%), Postives = 184/404 (45.54%), Query Frame = 2
Query:  371 YFSL---EESTG----KLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVD-CHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            +FSL   E+S G    ++++   +DRE+      + TALD     L+    I      + + D ND+ P F++  Y++ +SE V  G  +   TA+D D   N   T+    F++   IT     SN   + V+N LD+E    Y   L A D G   +    T+ + V+D NDN P    +    +I E+A +G  +A +   D DS   G+V  +  G V           S  T ++    +L+ +    ++++ + A+D G  P    +++ +H+ DVN+  PV + +S        +V EN    +  + +  SD D+G N +V  C +    E  +LS+  ++           R FD E    F++ +   D+G+P L+    + V + D N+ +PR
Sbjct:  177 HFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIH-----VLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITF---SFSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGG--MIAQCTVEVEVIDENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVP----FKILTSSRNTYKLVTDAVLD-REQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSY-----IVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFA-QRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPR 559          

HSP 4 Score: 92.4337 bits (228), Expect = 2.752e-18
Identity = 89/322 (27.64%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYL-------IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDN-----HPVFSQKEYKV--IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD 1171
            + E+ ++G  +  L +     +   + T KL  D    K  +   +T KL+    +DREQ      + TA DR +  L+    I      + I DVND+ P F++S Y + ++E    G  IS   ASDPD+ PN   +Y +   +D      S+ + +           A D+E    ++ TL A D G P L  N +L + V D NDN     +P        +  ++   A  G +V  V AVD DSG    + Y   Q  +P +   F +   TGE++  R L  ++  +   L +   DGG  P    AT+ +   D
Sbjct:  354 IMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPF-KILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSI-----TLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMA-SDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL---FSLGLRTGEVRTARALGDRDAVRQ-RLLVAVRDGGQPPLSATATLHLVFAD 664          

HSP 5 Score: 79.7221 bits (195), Expect = 1.977e-14
Identity = 84/308 (27.27%), Postives = 151/308 (49.03%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVE-DKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI--REGHYLIKLVA-NDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVT 2559
            L T  +LDRE+  +  + V A D+G+P   ++++++ + I DVNDN P V +     V   E   P   ++Q++A DPDLG NG V + I   + ++R L+  +        SI   SG +   ++ D E + ++ L +   DQG P L++  ++ + V D NDN P+   P           ++  A +   ++ +  A D DS  NA ++YHV +  +  L  +    G++R  +++  R+      LVA  D G P LS    ++L + + S    + +I+D           QF +V+ +A+++
Sbjct:  402 LVTDAVLDREQNPEYNITVTATDRGKP-PLSSSSSITLHIGDVNDNAP-VFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYV--------SISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAVRQRLLVAVRDGGQPPLSATATLHL-VFADSLQEVLPDITDRPDPSDLQAELQFYLVVALALIS 698          

HSP 6 Score: 66.6254 bits (161), Expect = 2.344e-10
Identity = 75/284 (26.41%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP--VAH-STNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +   N LD E+  +  +++ A D G   +Q       I   D NDN P VI  + P L +++ E  L   +  ++ RD D   NG V   ++             +   KI +    +  L     LDRE    Y + +   D+GKP L+S  +ITL + D+NDN P + Q   + H + N    + ++Q       +ASDPD  PN  ++Y +   D         V I A  G + A+++        + + L A D G+P LS  + + + +
Sbjct:  290 FDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI---DENDNAPEVIFQSLPNLIMEDAE--LGTHIALLKVRDKDSRHNGEVTCKLE------------GDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQ------VRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLV 550          

HSP 7 Score: 52.7582 bits (125), Expect = 4.517e-6
Identity = 71/252 (28.17%), Postives = 106/252 (42.06%), Query Frame = 1
Query: 1642 IPTR----SKSKCLFFIDQYMGNLRTANILDREK--GDK----IELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP---VAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID 2355
            +PTR    S  K  F +    G L  ++ LDRE+  G K    +E   +A       +      V + I D+ND+ P    N  +LQ+ E+ +    F+    A D D+G N T++ Y     D   L  K   + +K          + +   LDRE   SY L +   D G P L+S   I + V D NDN P + Q    V+ S N+   + + Q        A+D D   NA IT+  +E   +   D
Sbjct:   61 LPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVA------ENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILG-SAHDADIGSN-TLQNYQLSPSDHFSLINKEKSDGSKY-------PEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQ------VTATDQDEGVNAEITFSFSEASQITQFD 291          
BLAST of Protocadherin-9 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 167.548 bits (423), Expect = 3.822e-60
Identity = 137/469 (29.21%), Postives = 215/469 (45.84%), Query Frame = 2
Query:  245 HYAVKEEIDVGNFVGNLNIDSNIFKIQPKS-----TFKLYDDGKLLKYFSLEESTGKLII-AQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITI----QDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL-GPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT----LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +Y ++EEI     +GNL  D N+  I  KS      FKL      +    +EE TG++     RIDRE++C       + C  E+ + +  D    ++ I    +D+ND+ P F  +   I I E   +  + +L  A DPDV  N V  Y +    + F +          +  LIV   LD E +  Y   +   D G P       L +SV D NDNHPVF + E +V I ENA VG  V  + A D D G   ++ + F  +        F+++  TG I ++  L+ +    +  L + ASDGG +P    A V V++ DVN+  P I+I  +  P      + EN  L +  A+I V+D D   N  V C  T     F+L        R +++    L+     D E    + +++L +D G P L     + +K++D N+ +P F +   TV++ EN++ G
Sbjct:   59 NYTIREEIPENVLIGNLLKDLNLSLIPNKSLTTTMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLC-AGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLD-REETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRL--------RPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPG 514          

HSP 2 Score: 86.2705 bits (212), Expect = 3.822e-60
Identity = 96/292 (32.88%), Postives = 141/292 (48.29%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLT--QIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL-AQDQRIIIAQ--ASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIRE---GHYLIKLVANDNGNPN-LSTEIKINLYISSKSTFSTVIN 2511
            F +D+  G L     LDREK DK    +LA D G P   T+  TVF++I D NDN P    N  K  V EN   LP   T   I   DPD G+N  V   I            +DEN    F+ID  +G +    S DRE  +SY  Y+   D G+   +S   +T+ V+D+NDN P +  P     N + + VL + +   ++ Q  A D D+  NA + Y +  G+  DL  ID   G++   +       G + + + AND G P+ L + + +NL+++   T +T+IN
Sbjct:  545 FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVP-PLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN---LPRHGTVGLITVTDPDYGDNSAVTLSI------------LDENDD--FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVP---PYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNESVTNATLIN 815          

HSP 3 Score: 132.109 bits (331), Expect = 1.835e-30
Identity = 133/472 (28.18%), Postives = 194/472 (41.10%), Query Frame = 2
Query:  158 HRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYD--DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYY------QIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM-HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
             RSS A L VS+        V  E    I  ++ E   VG  V  L+          K  F   +       + F L  +TG + I + +DRE+        L  D   +     V       ++ + DVND+ P     Y        + +SE + +  +I+L T +D D + N   T F  H         FSN   L     LDYE+   Y   L+A D G PPL  +  L I V D NDN PVF+Q    V I EN   G  +  V+A D DSG   ++ Y  G    P     F +   TG + + + L+ +     +   I A D G  P     TVFV + D N+  PV   N     +  F V EN        +I V+D D G N+ V   +    ++F + +SQT        ++PN  FDRE    +   +   D G    ++  ++T+ + DVN+  P F
Sbjct:  260 QRSSTAILQVSVTDTNDNHPVFKE--TEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMV-------LVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLG----PDAPPEFSLDRRTGMLTVVKKLD-REKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHN-----EYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTI-DSQT------GVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVF 705          

HSP 4 Score: 91.6633 bits (226), Expect = 5.301e-18
Identity = 95/375 (25.33%), Postives = 163/375 (43.47%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLL-----YLIVINA----------LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP------VFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE-NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            +++ D ND+ P F E+  ++ I E   VG  ++   A+D D+           G N   + +FSNL+      L  +NA          LD E   N+K  ++A D G+ P      + ++V D+NDN P      + +     V++ EN  +   +A +T  D D+   G+V   F   + P  L   + + +   ++    L+ ++  +++++ + A+D G  P    A +F+ +KD N+  PV   + +       ++ EN +       +  +D D G NAE++  L   A   F L        R    L   +  DRE +  +   +L  D G P LT+   + V I D N+ SP F    Y   V EN
Sbjct:  269 VSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADI-----------GENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFL--LENAAYLDYES-TKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVT-----VSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLD-------RRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPEN 614          

HSP 5 Score: 81.6481 bits (200), Expect = 5.989e-15
Identity = 80/275 (29.09%), Postives = 124/275 (45.09%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDR------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKV---IIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHL 1165
            FSL+  TG L + +++DRE+     FT L +          +T+FV         +I D ND+ P F  + Y+  + E +     + L T +DPD   N+  T  +   ND F I     +    I + D E Q +Y   + A D G      +  + I+V+D+NDN PVF    Y     ++  +   G VV  V AVD D+G+  +VRY    G  +D      F I   TG I L    +  ++     L ++A+D G  P   ++ V V+L
Sbjct:  545 FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFV---------SIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNI-SFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPYNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRD-----LFAIDQETGNITLMEKCDVTDLGLHRVL-VKANDLGQ-PDSLFSVVIVNL 802          

HSP 6 Score: 68.9366 bits (167), Expect = 4.738e-11
Identity = 72/272 (26.47%), Postives = 121/272 (44.49%), Query Frame = 1
Query: 1675 FIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F +Q++  L  A  LD E   +  + +LA D G+P     +  +FI + D NDN P V     + V   E   P + L ++ A D D G N  + + +               +    FS+D  +G LT+ K LDRE  D Y+  I+  D G P LTS   + ++++D NDN P +     +         L +   + +   +DPD   N+ +T  + + +D   ID+  G +R   S    ++  Y   + A D G  + S+  K+ + +
Sbjct:  444 FSNQFL--LENAAYLDYESTKEYAIKLLAADAGKP-PLNQSAMLFIKVKDENDNAP-VFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLL-------------GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTH---NEYKFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINV 695          

HSP 7 Score: 60.077 bits (144), Expect = 2.470e-8
Identity = 82/307 (26.71%), Postives = 133/307 (43.32%), Query Frame = 1
Query: 1660 SKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT-----VINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ---RIIIAQASDPDSRPNANITYHVTEGDDL---VYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRV 2535
            ++ LF ++   G +     LDRE+    +L+VLA D G   ++     V + +TDVNDN P+     ++NP    V  +E   L   +  I   D D   NG V  +            +I      +FS   +  N      LD E    Y + ++  D GKP L     + + V D NDN P + Q      +  T S+   +    +++   A+D DS PNA I Y +  G D      +D   G L   + +   +E  YL  ++A DNG P L++ + + + I  ++  S V   ++ +F V
Sbjct:  328 ARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDH---------EIPFRLRPVFSNQFLLENAAY---LDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQ------SFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLL--GPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYV 611          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 125.561 bits (314), Expect = 5.228e-40
Identity = 123/414 (29.71%), Postives = 184/414 (44.44%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTS-FTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYIS------TYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVK--ENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +++ STG++ + +RID +    T+   A D  Q  L+  VP+   INVI   D+NDH P    +   I + E V +G  +    A D D  PN +  Y M G  D      S L+    +  LD ET   Y   + A D G P L  + T+A+ + DINDN P F +KEY V I E    G  +  + AVD D     ++ YR  +  D  V S   I       + +GE+K Q             + I A+D G +   G   V V + DVN+  P  N          F+VK  E+  +      +   D D G NA +  +    ++ F++  S      DI     +   DRE  + F V +  SD  +P L T  +I V + D+N+ SP+F   +Y   +SE+  +G
Sbjct:  423 LTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLT--INVI---DINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL--LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQD--------HKVRVEISATDQGGLQ--GRCVVNVFIDDVNSA-PYFN-------DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-VYSIDSSQFFRIDPSSG----DISV---SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVG 800          

HSP 2 Score: 60.077 bits (144), Expect = 5.228e-40
Identity = 77/269 (28.62%), Postives = 116/269 (43.12%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYID-----SYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYL-IKLVANDNGNPNLST 2454
            LF +D+  G LR ++ LDRE+   I L + A D+G P S +A + + +T++DVNDN PT       L + EN        T I ARD D G+N  + F I    D             K+F I+E +    + + L R   D     +   + +    G  QL+S   + + V D+NDN P     V          +  Q   I    A DPD   NA + Y + E +DL+  +   G +  +Q  +    +  K   +D  N   ST
Sbjct:  834 LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGDNADISFRIFGGAD------------AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQ---IGFIPAFDPDQ--NATLEYFLEE-NDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECST 1080          

HSP 3 Score: 138.272 bits (347), Expect = 1.378e-32
Identity = 113/419 (26.97%), Postives = 192/419 (45.82%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWIN-----VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA--LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            D +    F+L+  +G++ +A+ +DRE         LD+  +++T +  +D  I+     V+ + DV D+ P F +  Y  +I E   +G  +    A D D   N    Y + G  +  N+   N    ++  A  LD ET    +  ++A D G P       + I+V+D+NDN PVF+   Y V I EN  +  V+A V A D D G  G+V Y        S +    I   TGE+ L+  ++ KN     +  I A DG          + +++ D+N+  P     +L  A+K   ++EN  +      ++  D D G N  +   +  G+E+F       +   D   ++  ++ DRE  + + +++   D GTP L T   I V ++D+N+ +P F K+ Y V +SE    G
Sbjct:  206 DSRSQNLFTLDTMSGEIRLAKSMDRE--------VLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSL-GEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERIDAKN--SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP-----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-GSEDF-------IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRG 597          

HSP 4 Score: 100.138 bits (248), Expect = 6.728e-21
Identity = 114/453 (25.17%), Postives = 200/453 (44.15%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNL-NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK----GRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++E + +G  VG +  ID +     P    K   +G   + F ++E +G +   + +DRE     S   TA D     L     I      + ++D+ND+ P F +  Y + ISE +  G +I    A D D E   +         + F+I    +   ++ ++          +  + A D G   L G   + + + D+N + P F+   + V I E++ +G  V  + A D D G   ++ Y     Q      +F I   +G+I +   L+ ++ A  FS+ + ASD  S P      + V L D+N+  P    +S         + E+  + + F  +   D DIG N  VD  L       + S+S +++     R   TL+ +   DRE  +   + +   DRGTP L+   EIT+ + DVN+ +P F++ +Y + ++ENS +G
Sbjct:  488 LEENVAIGEEVGRVYAIDEDS---GPNGIIKYSMEGS--EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTI-----AVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND-EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ------FFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA-----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLN------ESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVG 908          

HSP 5 Score: 86.6557 bits (213), Expect = 8.182e-17
Identity = 66/229 (28.82%), Postives = 104/229 (45.41%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID 2355
             F ID   G++  ++ LDRE      +IV A D   P     +T + + + D+NDN P   +         +  +     Q+ A D D+G NG V ++         L E       ++F +D  SG L +   LDRE     +L I   D+G P L++   ITLT+ D+NDN P  F+ +++   I   S +      I+A+  D D   NA+I++ +  G D    D
Sbjct:  726 FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF---------LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT-FEQLSYDLYIAENSPVGSTVGTIVAR--DADEGDNADISFRIFGGADAKLFD 941          

HSP 6 Score: 85.1149 bits (209), Expect = 2.953e-16
Identity = 85/340 (25.00%), Postives = 141/340 (41.47%), Query Frame = 2
Query:  524 IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK 1543
            I DVN   P F +  + ++I E   +GY +    A D D   N    Y +   +  F I  S+   + V + LD E +  +   + A D   PPL  +  + + + DINDN P F+   Y   I E+  VG     V+A+D D G  G V Y   +      +  F +   +G +++   L+ +  A    L I A D G+      + + + L DVN+  P     S      D  + EN  + S    I   D D G NA++   +  GA+       +  +   +  +     FD E  ++     L +  G  +L++   + + + DVN+  P  K
Sbjct:  673 IDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-SQFFRIDPSSG-DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAV-IVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSY-----DLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALK 1001          

HSP 7 Score: 83.9593 bits (206), Expect = 5.434e-16
Identity = 90/330 (27.27%), Postives = 151/330 (45.76%), Query Frame = 1
Query: 1588 SAVATSSCDRR*RHRTIAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLT--QIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV--TEGDDLVYIDAIIGDLRARQSIREGHYLIKLV--ANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVT 2559
            ++V  S    +  + ++  P  S+S+ LF +D   G +R A  +DRE  DK  L V A ++ +P + +A+TTV + + DV DN P  I        E  E  P+  T   + ARD D GENG + + +             + N   + +I+  SG +     LDRE +    L ++  D+G P+  S   + +TV+D+NDN P +    + S N+T    +     I   +A+D D   N  + Y +  + G   + ID   G++  R+ I   +  I  V  A D   P LS+ + + +          VI+I+D    ++    M+T
Sbjct:  185 ASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDP-TISASTTVVVHVLDVQDNSP--IFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLG------------EGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVF---ASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTI---------NVIDINDHAPTLIAAQKMIT 487          

HSP 8 Score: 78.9518 bits (193), Expect = 1.751e-14
Identity = 76/268 (28.36%), Postives = 123/268 (45.90%), Query Frame = 1
Query: 1705 TANILDREKGDK----IELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-----REGHYL-IKLVANDNGNPNLSTEIKINLYI 2478
            T  +  RE+ D     I  ++ A D  +P + ++T  + I + D+ND+ PT+I   K+   E    +   + ++ A D D G NG +++ ++  ED               F IDE SG +   K LDRE    Y L +   D G P L +   I + + DINDN P + +      N+T    + +  +II  +A D D   +  ITY + E D  V+    IGD  A  S+     R+ H + +++ A D G   L     +N++I
Sbjct:  429 TGEVTLRERIDAKNSPITAVIRAKDGAQP-ALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---------------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK---KEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFI 673          

HSP 9 Score: 59.6918 bits (143), Expect = 1.463e-8
Identity = 64/261 (24.52%), Postives = 109/261 (41.76%), Query Frame = 1
Query: 1723 REKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----LVYIDAIIGDLRARQSI-REGHYLIKL--VANDNGNPNLSTEIKINLYIS 2481
            + +  K+ + + A DQG  + +           DVN  P    +P  +++ E+       +T ++A D D G+N  + + I               + ++ F ID  SG++++   LDRE   ++ + +   D   P L +   I + + DINDN P++    + S   T    +      +   A D D  PN  + Y + E        L  +D   G LR    + RE   +I L   A D G P+LS   +I L +S
Sbjct:  645 KRQDHKVRVEISATDQGGLQGRCVVNVFID---DVNSAPYFNDHPFSVKIPEHSPIGYPVIT-LKAEDHDRGDNARIVYSI---------------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLS 883          

HSP 10 Score: 51.9878 bits (123), Expect = 3.676e-6
Identity = 72/273 (26.37%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYI-LYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID+  G ++T  +LDRE   +  L V A D G P S   +TT+ + + D+NDN PT  +  +  V  +EE +P     I  +  D  E+  + + I          E+ D     I  I +    L++   L R+  D  + + I   DQG  Q   +  + + + D+N  P  +F     S  I   S +     +I  +A D D   NA I Y + +      ID   GD+     + RE    + + + A+D+ +P L+T  +I + +
Sbjct:  524 FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPT-FDKKEYNVTISEE-MPRGSQIITLKAVDNDEDQKITYRI----------EEADREVFSILDIGDQGAILSVSGELKRQ--DHKVRVEISATDQGGLQGRCV--VNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYP--VITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVIL 774          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 125.176 bits (313), Expect = 1.048e-39
Identity = 123/414 (29.71%), Postives = 184/414 (44.44%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTS-FTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYIS------TYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVK--ENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +++ STG++ + +RID +    T+   A D  Q  L+  VP+   INVI   D+NDH P    +   I + E V +G  +    A D D  PN +  Y M G  D      S L+    +  LD ET   Y   + A D G P L  + T+A+ + DINDN P F +KEY V I E    G  +  + AVD D     ++ YR  +  D  V S   I       + +GE+K Q             + I A+D G +   G   V V + DVN+  P  N          F+VK  E+  +      +   D D G NA +  +    ++ F++  S      DI     +   DRE  + F V +  SD  +P L T  +I V + D+N+ SP+F   +Y   +SE+  +G
Sbjct:   64 LTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLT--INVI---DINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL--LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED--QKITYRIEEA-DREVFSILDIGDQGAILSVSGELKRQD--------HKVRVEISATDQGGLQ--GRCVVNVFIDDVNSA-PYFN-------DHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-VYSIDSSQFFRIDPSSG----DISV---SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVG 441          

HSP 2 Score: 59.3066 bits (142), Expect = 1.048e-39
Identity = 78/269 (29.00%), Postives = 115/269 (42.75%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYID-----SYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-REGHYLIKLVANDNGNPNLST 2454
            LF +D+  G LR ++ LDRE+   I L + A D+G P S +A + + +T++DVNDN PT       L + EN        T I ARD D G+N  + F I    D             K+F I+E +    + + L R   D     +   + +    G  QL+S   + + V D+NDN P     V          +  Q   I    A DPD   NA + Y + E +DL+  +   G +  +Q   R      K   +D  N   ST
Sbjct:  475 LFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTP-SLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGDNADISFRIFGGAD------------AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQ---IGFIPAFDPDQ--NATLEYFLEE-NDLIEAEKYTGKILVKQEWKRNMDVSFKTCVSDGANTECST 721          

HSP 3 Score: 95.5153 bits (236), Expect = 3.651e-39
Identity = 98/368 (26.63%), Postives = 158/368 (42.93%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWV----SDGDIGV-------NAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            IT+ DVND+ P FA   Y + I E + +   I+   A+D D   N    Y M   +    +T       + +              + A D   P L     L I+V+DIND+ P     +  + ++EN  +GE V  V A+D DSG  G ++Y     +D      F I   +G IK  ++L+ +  A+ +SL + A D G+       T+ V LKD+N+  P  +       KK++NV  ++ +     II +    +D D  +       + EV   L +G +   LS S  +K +               D   +V +  +D+G   L     + V I DVN  +P F    ++V + E+S IG
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED------FIIDEDSGLIKTTKLLDRETTAR-YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD-------KKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ---------------DHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIG 339          

HSP 4 Score: 87.0409 bits (214), Expect = 3.651e-39
Identity = 66/229 (28.82%), Postives = 104/229 (45.41%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID 2355
             F ID   G++  ++ LDRE      +IV A D   P     +T + + + D+NDN P   +         +  +     Q+ A D D+G NG V ++         L E       ++F +D  SG L +   LDRE     +L I   D+G P L++   ITLT+ D+NDN P  F+ +++   I   S +      I+A+  D D   NA+I++ +  G D    D
Sbjct:  367 FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASP-PLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYF---------LNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT-FEQLSYDLYIAENSPVGSTVGTIVAR--DADEGDNADISFRIFGGADAKLFD 582          

HSP 5 Score: 107.842 bits (268), Expect = 3.327e-23
Identity = 73/253 (28.85%), Postives = 120/253 (47.43%), Query Frame = 2
Query:  830 ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I+V+D+NDN PVF+   Y V I EN  +  V+A V A D D G  G+V Y        S +    I   TGE+ L+  ++ KN     +  I A DG          + +++ D+N+  P     +L  A+K   ++EN  +      ++  D D G N  +   +  G+E+F       +   D   ++  ++ DRE  + + +++   D GTP L T   I V ++D+N+ +P F K+ Y V +SE    G
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS---SSGIGGLTIDYSTGEVTLRERIDAKN--SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAP-----TLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME-GSEDF-------IIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRG 238          

HSP 6 Score: 99.7525 bits (247), Expect = 9.698e-21
Identity = 114/453 (25.17%), Postives = 200/453 (44.15%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNL-NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK----GRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++E + +G  VG +  ID +     P    K   +G   + F ++E +G +   + +DRE     S   TA D     L     I      + ++D+ND+ P F +  Y + ISE +  G +I    A D D E   +         + F+I    +   ++ ++          +  + A D G   L G   + + + D+N + P F+   + V I E++ +G  V  + A D D G   ++ Y     Q      +F I   +G+I +   L+ ++ A  FS+ + ASD  S P      + V L D+N+  P    +S         + E+  + + F  +   D DIG N  VD  L       + S+S +++     R   TL+ +   DRE  +   + +   DRGTP L+   EIT+ + DVN+ +P F++ +Y + ++ENS +G
Sbjct:  129 LEENVAIGEEVGRVYAIDEDS---GPNGIIKYSMEGS--EDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTI-----AVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND-EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG--LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ------FFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA-----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLN------ESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVG 549          

HSP 7 Score: 84.3445 bits (207), Expect = 3.967e-16
Identity = 85/340 (25.00%), Postives = 141/340 (41.47%), Query Frame = 2
Query:  524 IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK 1543
            I DVN   P F +  + ++I E   +GY +    A D D   N    Y +   +  F I  S+   + V + LD E +  +   + A D   PPL  +  + + + DINDN P F+   Y   I E+  VG     V+A+D D G  G V Y   +      +  F +   +G +++   L+ +  A    L I A D G+      + + + L DVN+  P     S      D  + EN  + S    I   D D G NA++   +  GA+       +  +   +  +     FD E  ++     L +  G  +L++   + + + DVN+  P  K
Sbjct:  314 IDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS-SQFFRIDPSSG-DISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAV-IVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSY-----DLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALK 642          

HSP 8 Score: 78.5666 bits (192), Expect = 2.700e-14
Identity = 66/225 (29.33%), Postives = 103/225 (45.78%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-----REGHYL-IKLVANDNGNPNLSTEIKINLYI 2478
            D+ND+ PT+I   K+   E    +   + ++ A D D G NG +++ ++  ED               F IDE SG +   K LDRE    Y L +   D G P L +   I + + DINDN P + +      N+T    + +  +II  +A D D   +  ITY + E D  V+    IGD  A  S+     R+ H + +++ A D G   L     +N++I
Sbjct:  112 DINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---------------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDK---KEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFI 314          

HSP 9 Score: 69.707 bits (169), Expect = 1.165e-11
Identity = 66/227 (29.07%), Postives = 104/227 (45.81%), Query Frame = 1
Query: 1822 DVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDS----YILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            DVNDN P   +    + + EN  T+P  +  ++A D D G NG V + +       GL            +ID  +G +T+     RE ID+        I   D  +P L+S   +T+ V+DIND+ P     +A    IT +  +A  + +    A D DS PN  I Y +   +D + ID   G ++  + + RE    Y +K+ A D G P+L+T   I + +
Sbjct:    8 DVNDNAPVFASDSYNVTILENI-TIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL------------TIDYSTGEVTL-----RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTL---IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI-IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVL 212          

HSP 10 Score: 59.6918 bits (143), Expect = 1.334e-8
Identity = 64/261 (24.52%), Postives = 111/261 (42.53%), Query Frame = 1
Query: 1723 REKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----LVYIDAIIGDLRARQSI-REGHYLIKL--VANDNGNPNLSTEIKINLYIS 2481
            + +  K+ + + A DQG  + +           DVN  P    +P  +++ E+       +T ++A D D G+N  + + I               + ++ F ID  SG++++   LDRE   ++ + +   D   P L +   I + + DINDN P+ F   +++  I+    +      +   A D D  PN  + Y + E        L  +D   G LR    + RE   +I L   A D G P+LS   +I L +S
Sbjct:  286 KRQDHKVRVEISATDQGGLQGRCVVNVFID---DVNSAPYFNDHPFSVKIPEHSPIGYPVIT-LKAEDHDRGDNARIVYSI---------------DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQ-FTSSSYAATISED--IPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLS 524          

HSP 11 Score: 51.6026 bits (122), Expect = 4.554e-6
Identity = 72/273 (26.37%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYI-LYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID+  G ++T  +LDRE   +  L V A D G P S   +TT+ + + D+NDN PT  +  +  V  +EE +P     I  +  D  E+  + + I          E+ D     I  I +    L++   L R+  D  + + I   DQG  Q   +  + + + D+N  P  +F     S  I   S +     +I  +A D D   NA I Y + +      ID   GD+     + RE    + + + A+D+ +P L+T  +I + +
Sbjct:  165 FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTP-SLNTSTTIAVVLKDINDNAPT-FDKKEYNVTISEE-MPRGSQIITLKAVDNDEDQKITYRI----------EEADREVFSILDIGDQGAILSVSGELKRQ--DHKVRVEISATDQGGLQGRCV--VNVFIDDVNSAP--YFNDHPFSVKIPEHSPIGYP--VITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVIL 415          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 85.1149 bits (209), Expect = 1.138e-34
Identity = 83/278 (29.86%), Postives = 129/278 (46.40%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQ--PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPNLSTEIKINLYISSKST 2493
            IDQ+ G L T ++LD E     +L V A D G P  +++  T+FI + DVNDN P        ++V EN       + ++ ARD D  ENG + + I               N ++ F IDE  GN+   +S+DRE I    + I+  D+G P  +S  +  ++VLD+NDNPP      P+     +   S L+     I+A   DPD   N ++ Y       L  + +  GD+  R+ +    E H  + ++ +D G P  S    + + IS  S 
Sbjct:  887 IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIP-PRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPP-KTIVGKVVARDKDSLENGQIVYRIT--------------NGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV----VPAGSPLSTAIGTIVAM--DPDKGLNGSVLYRAQLQSSLFVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSA 1141          

HSP 2 Score: 82.4185 bits (202), Expect = 1.138e-34
Identity = 79/355 (22.25%), Postives = 152/355 (42.82%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVI-NALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            V  + D     P+F ++ +Q++I E   +G  +    A++     +    Y +   N   ++T   +   + I    D+E Q +Y+TT++A +           ++I + D+NDN P+F   EY + ++E     E +  V+A DMDSG FG+V Y        S  S F I+  TGE+  Q+ L        F L + A DGG       A + + + D + + P         ++  + ++  + ++   AI     G +G  ++V   +  G ++   S  +     D   +   R  D +V  H  V +          + + ++ + I+D N+  P+F      +++ E+
Sbjct:  527 VADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ--NQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHIL-----SESSSFSINPVTGEVFAQKPLARGR----FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF-------SRSKYEIRTTEDILPGIAI-----GSVGAMSKVKYSIYSGDQDHNFSIDE-----DTGKIYVTRYLDADV--HDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIRED 849          

HSP 3 Score: 87.0409 bits (214), Expect = 2.476e-30
Identity = 112/454 (24.67%), Postives = 194/454 (42.73%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHG-FNDTFNITFSNL-----LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + V E   +G  +G ++         PK  F ++ D +  K+  ++E +G++     +D E+       A+   +   TI +       ++ + D ND+ P FA+   +++ISE  Q+G   +L T +D D    +V  +  + G  N+ F +    +       L+V   LD E +  Y+  + A D G P   G    +I ++D NDN PVFS+  Y   +  N  +G  +  V A D D G   ++ Y   +   PS  S F IS  +G I     L     A    + + ASD GS      A V + +       P ++I  L  +    ++ EN TL S  A + ++          D  L +   +  L   QT +   +Y L    + DRE  S   ++ L    G  ++  E    + I D+N+ +P++   +  +++S N T G
Sbjct:   29 FTVPESAQIGTRIGWIS-GKREESAAPK-YFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETIDI-------LVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSN-SNFAIS-QSGVITTTASLLP---ASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNS-AHLMENSTLGSIVARVSIA------QQYRDTKLRLIGSS-ALCPQQTDQAH-VYLLLLCGILDRETASEHHLKFLLEKDG--QIIIEHPQLLTIGDINDNAPQW--HSSQIHISLNRTQG 455          

HSP 4 Score: 66.2402 bits (160), Expect = 2.476e-30
Identity = 63/276 (22.83%), Postives = 122/276 (44.20%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKST 2493
            L  ID+  G +   N +D   G +I+  V A D G P + +    V   + D    PP        QV+  E+T +   L ++ A +   G +  +R+ +Q              N+ +  ++D +SG + I K+ D E   SY   ++  +      TS+  I++ + D+NDN P ++    H   +T +     ++ +++  ASD DS     ++YH+        I+ + G++ A++ +  G + + + A D G  +      I++ +  K T
Sbjct:  482 LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSP-ALSTDLQVVADLLDTESKPPQ-FEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ--------------NQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL--ISIRLKDVNDNWPIFYPNEYH---LTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDT 736          

HSP 5 Score: 111.694 bits (278), Expect = 1.965e-24
Identity = 104/380 (27.37%), Postives = 170/380 (44.74%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLL-YLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKI 1510
            FS++E TGK+ + + +D +       T L   Q  L         + VI I+D ND+ P+F+ S  +I I E +++     +  ASD D + N    Y +   +   +I        L   + LDYE   NYK  + A D G+PP   N TL I VLD+NDN P F +  Y + + EN+    +V  V A D DS   GQ+ YR     +     YF I    G +  +R ++ + +     ++I A D G  P+   A+  + + DVN+  P  +  S+ P      V     L +    I   D D G+N  V     + +  F + ++      D+Y     R  +   + H ++ ++ SD+G P+ +    + V+I
Sbjct:  782 FSIDEDTGKIYVTRYLDAD----VHDTVLLNIQATLPSGESNQTQV-VIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE-----YFGIDEKLGNVYTKRSID-REVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP--SCLSITP----IVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNG-----DVYL---RRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRI 1136          

HSP 6 Score: 70.0922 bits (170), Expect = 7.148e-21
Identity = 82/357 (22.97%), Postives = 158/357 (44.26%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR-FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP--KVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            I ++DVND+ P F  + Y + + E  +    + + +ASD D       +Y +   + +F+I   N +   V  A     +  +   + A D G      +  + I+V+D +   P FS+ +Y++   E+ + G  + +V       G   +V+Y  +   QD      F I   TG+I + R L+  ++     LNI+A+    +P  +     V + ++D N+  P  + + +     + +++E+  L   F ++  SD D   N EV   +        +   Q         L    + D E   ++++R+  +D G P  ++   + + + DVN+ +P F+K  YT+ V ENS
Sbjct:  629 IRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSI---NPVTGEVF-AQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIYSGDQD----HNFSIDEDTGKIYVTRYLDA-DVHDTVLLNIQAT----LPSGESNQTQVVIFIEDHNDNPPQFSSSLV-----EISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTG-----QLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENS 955          

HSP 7 Score: 51.2174 bits (121), Expect = 7.148e-21
Identity = 43/155 (27.74%), Postives = 79/155 (50.97%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQ 2136
            F ID+ +GN+ T   +DRE    +++ ++A D+G P  +++T +  I++ DVNDNPP+ ++   + V      L   +  I A DPD G NG+V +  Q               ++ +F +   +G++ + + L+        L ++V DQG P+
Sbjct:  988 FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVP-PRSSTASARISVLDVNDNPPSCLSITPIVVPAGSP-LSTAIGTIVAMDPDKGLNGSVLYRAQL--------------QSSLFVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVPR 1125          

HSP 8 Score: 89.7373 bits (221), Expect = 9.899e-18
Identity = 86/341 (25.22%), Postives = 150/341 (43.99%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQT-LAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            IT+ D +   P+F+ S Y+I+ +E +  G  I         V   +   Y ++  +   N +   +   + V   LD +    + T L+     +P    NQT + I + D NDN P FS    ++ I+E+  + E    V A D D    G+VRY        S +    I  +TG++    +L+ +   +++ L ++A+D G  P+    T+F+H+ DVN+  P         +     V EN    +    +   D D   N ++   +T G+E F +      K  ++YT    R  DREV SH  + ++  D+G P  ++     + + DVN+  P
Sbjct:  729 ITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIG-------SVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADV---HDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIE---IDQFTGQLSTGSLLDYE-ATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAP-----EFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDE----KLGNVYT---KRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPP 1043          

HSP 9 Score: 76.2554 bits (186), Expect = 1.173e-13
Identity = 79/267 (29.59%), Postives = 123/267 (46.07%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQ--ASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLST 2454
            F ID+  G +     LD +  D +   +L I    P  ++  T V I I D NDNPP   +   ++ ++E+ +    F   +QA D D  +NG VR+ I            I  +      ID+ +G L+    LD E   +Y L +   D G P  +S   + + VLD+NDN P+ F+   ++  +   S      + I+ +  A D DS  N  I Y +T G +   ID  +G++  ++SI RE   H  I +VA D G P  S+
Sbjct:  782 FSIDEDTGKIYVTRYLDADVHDTV---LLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYV-VQASDKDKKKNGEVRYSI------------ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPE-FEKSWYTMEVLENS----PPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSS 1027          

HSP 10 Score: 60.4622 bits (145), Expect = 7.501e-9
Identity = 69/264 (26.14%), Postives = 121/264 (45.83%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDLRARQSIREGH-YLIKLVANDNGNPNLSTEIKINLYI 2478
            G +RT   LDRE  ++  L V+    G    Q   T V + + ++NDN P+       +V EN   +  ++  + A+D D      +R+++  V D  G            F+ID+ +G + +   LD E +  + L I   D      T++   T+ V DINDN P + +P+  +T   + +  +  Q     +A D D+R    +TY + +G   ++ +    G L  +     G  YL+ + A DNG P+ ST + +++ I
Sbjct: 1880 GVIRTNLELDREILERYSLKVIGTGSG----QQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLR-VGSYVATVGAKDVD--NLAPLRYFL--VSDSSG-------QTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNL---TIFVSDINDNAPTFSKPLYQTT--VSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYLVTVTATDNGVPSFSTSVPVSVII 2120          

HSP 11 Score: 54.6842 bits (130), Expect = 4.564e-7
Identity = 74/309 (23.95%), Postives = 136/309 (44.01%), Query Frame = 1
Query: 1636 IAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQ-GEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSI------DEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP---VAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAII---GDLRARQSIREG--HYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINI 2514
            +  P    SK L  +D+  G + T   LD EK  K +++ + +++ GE      T  + + + D NDN P+  +   KL++ E  +    F        P + +    +F + R    +G       N   +F +      +++  +L +   LDRE+ D Y L I   D GKP        ++ ++D NDN P + +     + S NI+  S       +I  QA+D D   N+ I+Y + +       +  I   G +    S+     H +I +VA+D+G+P+LS+   + + +   +  S  ++I
Sbjct:   58 VVFPDEQTSKFLK-VDERSGEISTIAHLDYEKRSKFDIVAVKVEESGE------TIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFAL------PTVTDGDGPKFDVHRFVILQG-------NVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGS------HLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDVI-VVASDHGSPSLSSSAVVTITVLGSTLSSPPLDI 339          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 84.7297 bits (208), Expect = 4.056e-32
Identity = 90/373 (24.13%), Postives = 162/373 (43.43%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGF-----------NDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQD-FSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVINI-NSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDV--NEFSPRFKKQNYTVNVSENSTIG 1588
            +I  +  N H P F+     ++++E   +G  ++   A+D D   N    Y +H               +  IT ++ L  ++   L+    ++ +  + A D G P     +T+ + + D+N++ P F +  Y + I EN   G+ +  VTA D D G  G++++  G  Q+ S  S   I   TG +KL + L+ ++  QD  +  I ASD G   +V    + + ++DVN+  P   + +S     +D       + M+ F      D DIG N+++   L      F++ +        I+   P    D      F + +  +D G P L+T   + V++ D+  N  +  F       +V ENS IG
Sbjct:  595 IIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEV---LDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKS--SVISIDAKTGIVKLLKSLDRED--QDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAF------DEDIGQNSKLKFLLNSEKVPFRIDHHSGC----IFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIG 950          

HSP 2 Score: 73.9442 bits (180), Expect = 4.056e-32
Identity = 80/277 (28.88%), Postives = 120/277 (43.32%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQG-----EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRG----------LAEKIDENRTK-IFSIDEISGNLTI--YKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIR-EGHYLIKLVANDNGNPN 2445
            F IDQ  G +RT ++LDRE      + V A D       +PR +         + D ND+ P    P             M++  +        EN      I +VE              L  KI+    +  F ID  SG +T    + LDRE    + L++ +CD G+PQL S   + + VLD NDN P + Q + H    + +S  A   ++    A D D   NA +TY++TEGD    ID   G++ A ++I  +  Y + + A D+G P 
Sbjct:  985 FSIDQ-KGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRIL-DRNDHRPVAKKP-------------MYIASV-------AENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHH---YSVRSKFA--GKLCRIFAVDADEGENARLTYNITEGDARFSIDN-NGNIIASEAIHGDESYALTVQATDHGTPG 1233          

HSP 3 Score: 113.235 bits (282), Expect = 6.916e-25
Identity = 104/370 (28.11%), Postives = 174/370 (47.03%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL----LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQ----DPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI---NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTV-----GAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            ++T+ D ND+ P F +S Y +++ E+  +GY ++   AS  D   N    Y++   + T   +F NL      L +   LD+ET    K T+VA D G+PPL     + ISV+D NDN P F +++Y   +KEN+  GE V  V A+D+DS  FG V Y    V     D  VL +   S   G++ + + ++ + I + ++L + A DGG  P    A + +H++D N+  P     N+ +L        V+E + +        VSD D   N       TV     GA++FK++         +  L   ++  R+ D +    +    +G    TT+  +T+ I+  +  +P  K     +N  +N
Sbjct: 3100 LVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVT---SFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINS--NGDVLISQSIDYEKIKK-YNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTAL--------VQEGEAIGHRLLKFSVSDLDGPKNG---APFTVEIQGDGAKSFKVNEK-------LELLTAKKLEYRKKDKYLLTVIAKDVKGK---TTDCPLTIFIRQTSRHAPTMKPMKIQINTLQN 3440          

HSP 4 Score: 56.9954 bits (136), Expect = 4.210e-14
Identity = 79/307 (25.73%), Postives = 128/307 (41.69%), Query Frame = 2
Query:  731 INALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININS---LGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIY----TLQPNRVFDREVDS-----HFQVRMLCSDRGTPKLTTE-------EEITVKIQDVNEFS--PRFKKQNYTVNVSENSTIG 1588
            I  LD E Q  ++  +  CD G P LC N  + ++VLD NDN P F+Q  +   ++ +   G+ +  + AVD D G   ++ Y   +       + F I      I  + I       + ++L ++A+D G+  +   AT  V   +   Q+P  + NS   +   K D+             +I +SD D          LTVG    KL  S    G +++    +  P+ VFD   D+       +V +L   RG  +L          +  TV IQ   + S  P+F   +Y  +VSE   +G
Sbjct: 1111 IRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVR-SKFAGK-LCRIFAVDADEGENARLTYNITEGD-----ARFSIDNNGNIIASEAIHG----DESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDY-------------VIPISDAD-------QVGLTVG----KLEASD-ADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELL--KRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVG 1379          

HSP 5 Score: 41.2022 bits (95), Expect = 4.210e-14
Identity = 45/168 (26.79%), Postives = 71/168 (42.26%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDRE--YIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNP 2190
            GN+     LD E   +I  +V    Q +  +  +  T  + I D NDN P  +        +  +T+   L  + A D D GENG V + I            +  N   +F ID  SG + + K LD E  +++S IL I   D     L   + ++L + + N+ P
Sbjct: 1420 GNVIVMEPLDYEAARRIRAVV----QVQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSI------------VSGNEESLFKIDAKSGEVRLAKPLDPELQHVES-ILRIRAIDSAANSLK--DEMSLHIRNSNEAP 1568          

HSP 6 Score: 70.0922 bits (170), Expect = 9.607e-12
Identity = 57/190 (30.00%), Postives = 98/190 (51.58%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELI-----VLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHS 2220
            +  +D+  G +  A+ L +   +K+E++     V AID G P  +++  T+ + I DVN++ P        L++ ENE+       ++ A D D G NG ++F +             ++ ++ + SID  +G + + KSLDRE  D +   I+  D+G P   S+  +T++V D+NDNPPK    V HS
Sbjct:  657 VLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTP-VKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIF-KVTANDFDGGNNGKIKFSLGN-----------NQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCV--VQHS 831          

HSP 7 Score: 68.5514 bits (166), Expect = 2.730e-11
Identity = 67/259 (25.87%), Postives = 113/259 (43.63%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV----PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPN----NVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGS 1126
            F + + TG+L++A++++           L R ++ L I V      D+   +I +      +PKF+ S+YQ  +SE V VG +I    AS   +       N+ +       D   +  S+   +IV+  LDYE     +  +      M       T ++++ D NDN P F        + E+  V +V+A VTA D D G  G V Y      + S+   F I   +GE++L + L+ +    +  L I A D  +
Sbjct: 1309 FDVRQDTGQLLLAKKVE----------LLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSERVAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSG-NVIVMEPLDYEAARRIRAVVQVQQANMKSFA---TFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESL---FKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAA 1550          

HSP 8 Score: 66.2402 bits (160), Expect = 1.378e-10
Identity = 84/363 (23.14%), Postives = 155/363 (42.70%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYR----ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININS-LGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             + I+++ND++PK  E   ++ I E +         I+   A D D   + +    +  F   F I   N + + V+  LD E    +  T+VA D          T+ ++V+D NDN P F +  Y + + E+  +G  +A+  A   D      + Y    ++   V S+  ++  TG + L + L+ + ++    L + A D G  P    A V + + D N+  P       +G  K+  N K  + +++  A+   S+    V+ E++       +   L  +    G D+   Q     D E    + ++++  D G P L +E  + + ++D N+ +P F   N T  V E   IG
Sbjct: 2998 TVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADF--DEIKFRMVDDFGGLFQIDDINGV-VTVVKPLDSEILGFFNLTVVASDGEFE---DKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQN--ETIEY---YLKPSDVTSFVNLNAQTGILTLAKPLDFETLSA-LKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKE--NSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNG-DVLISQS---IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIG 3342          

HSP 9 Score: 65.4698 bits (158), Expect = 2.324e-10
Identity = 72/262 (27.48%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  818 QTLAISVLDINDNHPVFSQKEYKVIIKENAMVGE----VVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + + + ++NDN P   +K  KV I EN    E     +  + A D D   F ++++R   V D   L  F I    G + + + L+ + I   F+L + ASDG    K   AT+ V + D N+  P    ++         V E++++    A    S GD   N  ++ +L      +F   N+QT     I TL   +  D E  S  ++ ++  D G P L TE ++ + + D N+ +P+F+K+ Y   V ENS  G
Sbjct: 2995 ELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRM--VDDFGGL--FQIDDINGVVTVVKPLDSE-ILGFFNLTVVASDGEFEDK---ATILVTVIDQNDNAPTFEKSTYS-----MKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQT----GILTLA--KPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSG 3232          

HSP 10 Score: 60.077 bits (144), Expect = 1.308e-8
Identity = 75/281 (26.69%), Postives = 125/281 (44.48%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-----TEGDDLVYIDAI--IGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            LF ID   G +     LD E      L V+A D GE   +       I   D NDN PT       ++V E+E ++   L   +A   D  +N T+ +Y++              + T   +++  +G LT+ K LD E + +  L ++  D G P L +   + ++V+D NDN PK F+   +   +   S     ++++  +A D DS     ++Y +     T  D  V   AI   GD+   QSI   +   Y +K++A D G P L +E  + +++
Sbjct: 3058 LFQIDDINGVVTVVKPLDSEILGFFNLTVVASD-GEFEDKATILVTVI---DQNDNAPTFEKSTYSMKVMESE-SIGYELAHFRASGGD--QNETIEYYLK------------PSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPK-FEKEKYVGKVKENS--KSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHV 3316          

HSP 11 Score: 59.3066 bits (142), Expect = 2.206e-8
Identity = 78/277 (28.16%), Postives = 124/277 (44.77%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIREG--HYLIKLVANDNGNPNLSTEIKINLYISSKS 2490
            F +++  G +   + LDRE+ ++ ++ + A   G   +    TTV + I DVNDN P      +      +  +   +T   A D D   +G +RF +            ++EN    F ++E SG LT+   LDRE ID Y L     D+G     +    T+ V D+ND+PP++ +      NI     L     I+     D D  PN    + + +G++  + +ID+    L  R  I E    Y +K+ A D G    ST++KINL  S  S
Sbjct: 2657 FSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHA---ITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL------------VEEN--PYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVNDSPPQFEK---EEFNIDLH--LPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFD-GVFETSTKVKINLKSSKDS 2908          

HSP 12 Score: 57.7658 bits (138), Expect = 5.430e-8
Identity = 73/326 (22.39%), Postives = 140/326 (42.94%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS---NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVF---VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVN 1306
            DG   ++FS+    G + +A++++ +     S T  A D           ++  I   +++      P+F+ S+Y   + E   VG  I      + +++            +D+F + FS   +   +IV ++LD E +  +K T+ A   G   +    T+ + + D+NDN P F     +  I E+A VG  V   +A+D D    G++R+   + ++P    YF ++  +G + +   L+ + I   + L   A+D G     G+ T     + + DVN+  P          K++FN+  +    S      + D D+  N
Sbjct: 2544 DGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVK-----VPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSF-LPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGG--VHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVE-ENP----YFDLNENSGWLTVASQLDREKIDH-YKLIARATDEG-----GFNTDLPFTIVVSDVNDSPPQFE-------KEEFNIDLHLPSTSPILHFSIKDDDLSPN 2843          

HSP 13 Score: 57.3806 bits (137), Expect = 8.426e-8
Identity = 63/228 (27.63%), Postives = 108/228 (47.37%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPP-TVINPPKLQVKENEETLP--MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYK---SLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNA-NITYHVTEGD 2337
            ID   G ++    LDRE  D     ++A D+G P  + + T + I++ DVNDNPP  V+   + ++ E+   LP   F++ + A D D+G+N  ++F +         +EK+       F ID  SG + I+     LD      + L I V D G P L++   + + ++DI  N     F  VA   ++   S +  +  +I A+ +  + +  A N+ Y +  GD
Sbjct:  771 IDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPM-RVSVTNLTISVEDVNDNPPKCVVQHSRARIPED---LPHGAFVSCMAAFDEDIGQNSKLKFLLN--------SEKVP------FRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGD 980          

HSP 14 Score: 54.299 bits (129), Expect = 6.985e-7
Identity = 52/217 (23.96%), Postives = 99/217 (45.62%), Query Frame = 1
Query: 1828 NDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDR------EYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV---TEGDDLVYIDAIIGDLRARQSI-REGH--YLIKLVANDNGNP 2442
            N + P   + P++     +  +   + ++QA D D G NG +R+ I            I  +  ++ ++DE SG +T+   L +      E +D   L +   D G P  +S++ + L + D+N++ P+ F  V++   I+      +D  I    A+D D   N  I + +    E   ++ IDA  G ++  +S+ RE    +   ++A+D G P
Sbjct:  602 NKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIH----------DIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQ-LKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQ-FDEVSYYLRISENEKPGKD--IFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFP 804          

HSP 15 Score: 53.9138 bits (128), Expect = 7.591e-7
Identity = 58/238 (24.37%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  551 KFAESYYQIQISEAVQVGYRISLRTASDP-----DVEPNNVCTYF-MHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLA---ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVAN-------VTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGY--ATVFVHLKDVNNQRPVININSL 1210
            KF    YQ  + ++ + G  + +  A         +EPN  CT+F +H        T S  ++L       + T++ ++ + V C   +    G Q +A     ++  N + P+F ++ Y+  I+EN   G  V +       V+A+D D G  G V YR    +D  +   F +  Y+G I+ Q   + + + +++S  ++A D G  P+     + + V + D N++ P    NSL
Sbjct: 1572 KFDRKVYQTTLYDSTRPGTPVLVLNALHHGTVSYKLEPN--CTFFEVH--------TLSGAVHLAT-----WLTKLKHRKS-VECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQM---FSVDQYSGAIRTQMSFDFEKM-KEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSL 1789          

HSP 16 Score: 51.6026 bits (122), Expect = 3.859e-6
Identity = 75/304 (24.67%), Postives = 120/304 (39.47%), Query Frame = 2
Query:  728 VINALDYETQINYKTTLVACDCGMPPLCGNQ---TLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIG--------VNAEVD-CHLTV--GAE---NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            V   L+Y     Y+  LV  D       G +   TL +SV+DIND  P F    Y   I E+A  G+ V  V+A D D      + Y    + D S   +F +    G I + + L  K      SL I+A+D  + P     TV V++   + + P  +                    SH+    + D D+G        +  E+D    T+  G+E   +F   + +   G+ I         DRE  + +++ +     G     T   +TV I DVN+ +P F        +SE++ +G
Sbjct: 2461 VSRVLNYHRDKRYQIPLVVEDA-----TGRRAFSTLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDEN--DTIEY---SLLDGSESQFFSVHPRQGTITVAKKLEHK-AGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFS-------------------NSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIV----KSSLDRERKNQWKMTIRADAAGGVHAIT--TVTVDIGDVNDNAPAFHGDYERFTISEDAAVG 2728          

HSP 17 Score: 51.6026 bits (122), Expect = 4.573e-6
Identity = 48/212 (22.64%), Postives = 92/212 (43.40%), Query Frame = 1
Query: 1891 LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSI--EAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS-SKSTFSTVINIS 2517
            LP+ ++ I   D D G NG V + +   +D+            ++FS+D+ SG +    S D E +  Y  Y+   D G+P   S+    I +TV+D ND PP++      S ++    +L     + +   +  D     ++ Y + +      +D+  GD+              LV + NG  +++    + ++++  K + S V+ IS
Sbjct: 1695 LPLVVSAI---DEDPGSNGLVGYRMLSPKDE------------QMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRF-----PSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQSVPFSVDSKTGDV--------------LVKDSNGISDMTKLFDLEVFVTDGKQSASYVMKIS 1872          
BLAST of Protocadherin-9 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 68.9366 bits (167), Expect = 6.856e-24
Identity = 78/300 (26.00%), Postives = 127/300 (42.33%), Query Frame = 2
Query:  722 LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMV--------GEVVANVTAVDMDS-GLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD-------GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
            ++++  LDYE   NY  TL A D     +   +T  + V D+ND  P F+   +   I E            G+ +  V A+D DS G   +V YR     +     +F I   TGEI      + + I   + L +EASD       G + P      V + + DVN+  P     S    K    VKE++       +I +   D+  ++ +  HL +GA   ++          I+  +P    D E    + + ++ SD G    TT   + + I+DVN+ +P+F++Q Y   V E
Sbjct: 1164 VVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDM-YILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAP-----SFEEQKYIGRVKESEG--EGHDVITIKAHDLDKHSNLRYHL-IGAGGGRIPFGVRTDSGTIFVKEP---LDFEASDQYHLVLIASD-GRHNATT--NVYIHIEDVNDNAPQFEQQKYATTVIE 1447          

HSP 2 Score: 62.3882 bits (150), Expect = 6.856e-24
Identity = 70/274 (25.55%), Postives = 121/274 (44.16%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKI---ELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL--QVKENEETL---PMFLTQIQARDPD--LGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDS--YILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANI-TYHVTEGDDLVYI-------DAIIGDLRARQSI-------REGHYL 2409
            +F I +Y G +     LDR+    +     +V AID  +         V + + D+NDN P  I P +L   ++EN E +    ++   +QARD D    EN  + + I R +   G           +F ID+ +G +   +SLDRE      +I+ +   D+G P       +T+ V D+NDN P +F+   +  ++   + +     ++   A D D     N+ TY ++E  D  Y+        + +G LR +Q +       R+G +L
Sbjct: 1485 VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDD-DGNGLVGYADVQVNVRDINDNSP--IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING---------ESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP-FFEKTRYEGSVEETAPIG--AAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHL 1743          

HSP 3 Score: 108.227 bits (269), Expect = 2.475e-23
Identity = 123/430 (28.60%), Postives = 198/430 (46.05%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELT-IFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKV-IIKENAMVGEVVANVTAVDMDSG-LFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLN--IEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIW--VSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQ--PNRVFDREVDSH--FQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +G+  K+F ++E TG++   ++ DRE++     T  A DR    L     P    + V I I DVND+ P F E  Y  ++ E+   G+ +    A D D   N    Y + G      I F   ++   + V   LD+E    Y   L+A D G      N  + I + D+NDN P F Q++Y   +I+E+  + +V+ NV A D D      ++ YR  GQ  D      F I  Y+G I+L + L+    A   S N  ++A D      VGYA V V+++D+N+  P+       P +    ++EN+  +    + +  V   D       + ++  G    KL N ++V   D  T +    R  DRE+ S   F + +  +DRG P       +T+K+ D+N+ +P F+K  Y  +V E + IG
Sbjct: 1264 NGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGG-RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD----EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF------PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIG 1677          

HSP 4 Score: 90.5077 bits (223), Expect = 5.857e-18
Identity = 117/482 (24.27%), Postives = 198/482 (41.08%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKL----------------LKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDY--ETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVF-SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSV--LSYFYISTYTGEIKLQRILNCKNIAQ---DFSLNIEASDGGSV------PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWV--SDGDIGVNAEVDCHLTVGAENFKLSNSQTV----KGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             K+E +V     NL +D ++  ++ +S F+ ++DG+                  K+F ++ STG + + + +D +         L     E      +D     I I DVND+ P F    Y  Q+ E + +   I   TA D D   N+  TY +   N  F+I  +  +   V    D   E    Y+  + A D G P  L  +  + I   + ND   VF    +Y   + E+A  G  V  + A D D     +V Y F      S   ++ F I  +TG +KL+  ++  ++A+     +L +   D GS           YAT+ + ++DVNN +P               + E         I+ V  +D D   N ++   L      +  S S+      +   + T  P+ VFDRE      V +  +DRG   L    + +V++ D+N+ SP+F++ +Y  +VS    +G
Sbjct:  531 AKQEYEVTVSEDNL-VDYSVVDVKAQS-FRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDL---TIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN--FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKP--EFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLY-----YTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVG 995          

HSP 5 Score: 68.1662 bits (165), Expect = 4.232e-11
Identity = 90/386 (23.32%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  503 YWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRT-----ASDPDVEPNNVCTYFMHGFNDTFNITF-----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF------GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK------GRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENST 1582
            Y   +I I+DVN+++P+F +      I++ ++  Y+    T     A+D D   N    Y ++         F     + +L        D ET+     T+ A D G  PL G    ++ V+DINDN P F +  Y+  +     VG  V  V A D D+    ++ Y        G+     +  +  ++  +GEI L + +  K   Q F  N+ A D G +P+   ++  V L  ++ Q+      +    K     D NV+ N+ ++   A   VS GD   N++V   LT        + S+  +      G +   +      D E  +++ + +  +D  T ++ + +   V+++DVN+  P+F    +T  + E  T
Sbjct:  848 YATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMK--TQKFIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRA---VSSGD-SRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMT 1225          

HSP 6 Score: 60.4622 bits (145), Expect = 7.851e-9
Identity = 72/287 (25.09%), Postives = 120/287 (41.81%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESY--YQIQISEAVQVG----YRISLRTASDPDVEPNN-----VCTYFMHGFNDTFNITFSNLLYLIVINALDYE--TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQV-RYRFGQVQDPSVLSYFYIST-------YTGEIKLQRILNCKNIAQ--DFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNA 1309
            + ++D+ND+ P F E    Y  +  E +         +  R   DP  E  N     V    ++G    F I   N   +  + +LD E  ++  +   + A D G+P   G   + I V D+NDN P F +  Y+  ++E A +G  V + +A D D      V  Y+  +  D     YFY++T         G +++++ L+ +++ Q   F L I  SDG    +   A V V L D N+  P I+         +  V+E+    +       +D D G  A
Sbjct: 1534 VNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLING-ESVFRID-QNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESD-----YFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAE---AAVHVALVDRNDHAPHIH------GATEHRVREDVPRGTSIGRYTATDRDAGDTA 1804          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 152.525 bits (384), Expect = 2.347e-54
Identity = 124/447 (27.74%), Postives = 203/447 (45.41%), Query Frame = 2
Query:  323 QPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV-----PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYF---MHGFNDTFN-ITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCK---NIAQDFS-----LNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE--NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +PK +++     +  + F+L+  TG++     +DRE +         R   +L +       PI+  I V+   DVND+ P+F E    I  SE+   G R+ L  A+D DV  N V   +       ++ F  +T +N       L+L     LD E++ +Y+  + A D G PP  G   + +++LD+NDN P+F   +Y V + E A+ G  V  V A D D G   ++ Y   + +       F ++  TG I     +NC    N+    S       + A D GS  + G   V V+L D N+  P+I+        K   V EN    +  A + V D D G+N      +  G E  +F+L  +      D++ ++ N V DRE    + + ++  D+GTP  TT   + + + DVN+  P F+K  Y+  +SE +  G
Sbjct:   89 KPKFSYRF---NEPPREFTLDPVTGEVKTNVVLDREGM---------RDHYDLVVLSSQPTYPIEVRIKVL---DVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETE-----HQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAA-----DLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTG 510          

HSP 2 Score: 81.2629 bits (199), Expect = 2.347e-54
Identity = 81/286 (28.32%), Postives = 128/286 (44.76%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQ-ARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEA-ITLTVLDINDNPPKW------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-TEGDDLVYIDAIIGDLRARQSIREG-----HYLIKLVANDNGNPNLSTEIKINLYISSK 2487
            F +D   G + T   LDRE  D +EL + A D G P  + A T + + I D ND  P   +  +  V   E+  P  +  +  A D D G NG+V F          LA  ++      F++D ++G LT  + LDRE +  Y + ++  DQG P   S  A + L V D+NDN P++      +       +I  K  + +++ ++   ASD D   NA I Y + + G+ L  +DA  G +  R           HY + + A D G      +  + + + SK
Sbjct:  542 FSMDPLTGLIVTTGPLDREIRDTVELSISARDGG-PNPKFAYTQLKVIILDENDEAPQ-FSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTF---------ALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSK 816          

HSP 3 Score: 130.183 bits (326), Expect = 9.818e-46
Identity = 142/500 (28.40%), Postives = 222/500 (44.40%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNI-DSNIFKIQPKSTFKLYD--DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVP--IDYWINVITIQ--DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM--HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG-----------SVPKVGYAT-------------------------VFVHLKDVNNQRPV-ININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPN----RV---FDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            Y V E++ +G+ +  L   D +        TF L D  DGK L    LE STGKLI+   +DRE           + + EL I V   + Y     TIQ  D ND+ P F ++ Y   I E  Q GY++    A D D+  N   +Y +     ND F++     + L +   LDYE   +Y   + A D G P L    T+  +VLD+NDN P+F    Y   + EN  +   V  V+A D+DSG  G + Y    +    V S F I +  G I+ +R L+ ++ +  ++L + A D             +  K+ Y +                         V + +KDVN++ PV I+ N          + EN  + +    +   D D G N  +D +L   A +  +  S  +     ++L P     RV    DRE+ S + + +   DRG P  +TE ++ ++I D N+ SP F  + Y+ +V+EN++IG
Sbjct: 1830 YNVSEDLQIGHTISTLRAHDPDTLG---SVTFLLMDGHDGKFL----LEPSTGKLILNDTLDRET----------KSKYELRIRVSDGVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGM-LTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEY---SITAGDVDSEFGIDS-NGTIRTRRNLDREHRST-YTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-------IMENVAINTVVIAVKAVDNDEGRNGYID-YLMKEARDEDMGQSDPLP----FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIG 2294          

HSP 4 Score: 74.7146 bits (182), Expect = 9.818e-46
Identity = 79/280 (28.21%), Postives = 129/280 (46.07%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP---MFLTQIQARDPDLGE-NGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYH-VTEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNG--NPNLSTEIKINLYIS 2481
            F I +  G +R A  L+ E+  +  L V A D         T  + I I D+NDN PT ++ P L  +  E T+P    ++  + A D D    N  VR++++             E  + +F I+  SG++ + K LDRE    Y L ++  D G P LT    + + V DINDN P +     H+   T +  L     ++  +A+D D   NA + ++ + E     +ID+  G++    ++ RE    Y + L+A D+    P  S+   +NL IS
Sbjct: 2326 FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYL-ARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLK-------------EGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHA---TVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASS---VNLTIS 2585          

HSP 5 Score: 106.301 bits (264), Expect = 4.775e-41
Identity = 120/437 (27.46%), Postives = 195/437 (44.62%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWIN---------VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLS--YFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYAT---VFVHLKDVNNQRPV-ININ-SLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN-FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKI----QDVNEFS-PRFKKQN-YTVNVSENSTIG 1588
            G     F+L+ +TG+L + +R+DRE             +I   I V  D  +           I + D ND+ P+F +S  ++ + E    G  +    ASD D   N+   + +   N  DTF+I + +  LYL     LDYE   +Y   + A DCG P L       + V+D NDN P+F        IKE   +   +  VTA D DSGL G+V Y   + Q+P +    +F I+T TG I   R ++ ++I   F L + A+D     +   +T   V V ++D+N+  PV +++N ++ P K   +   +  +M     +   D D   N  V   +  G +  FKL      +   I T  P   F +EV   +Q+ +  +D          E+ + I       +E S P+F++++  + +V EN  IG
Sbjct: 1320 GNEAGQFNLDSATGQLSLGRRLDRESQ-----------EIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLH--KPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISK-QEPQLPQGRHFGINTETGVIHTLREIDRESI-DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ----VHAKDADSSSNGLVTYEIVSGPQELFKLQ-----RNTGIITFTPGPQFKQEV--RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIG 1730          

HSP 6 Score: 83.1889 bits (204), Expect = 4.775e-41
Identity = 88/283 (31.10%), Postives = 133/283 (47.00%), Query Frame = 1
Query: 1639 AIPTRSKSKCLFFIDQYMGNLRTANILDREKG-DKIELIVLAID-QGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE--GDDLVYIDAIIG--DLRARQSIRE-GHYLIKLVANDNGNPNLSTEIKI 2466
            A  +R +   LF ID  +G L TA  LDRE G ++ E+ V AI   G+PR+      V +   D ND+PP  ++ P +     +  +   ++ ++A DPD    G+V F +    D +             F ++  +G L +  +LDRE    Y L I V D    Q T   A T+ V D NDNPP  F+   +S +I   +        I+A+  D D   NA ++Y V     +D+  ++   G   L AR    E  HY++ + A DNG P+LST I +
Sbjct: 1754 ATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVL--DKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGK-------------FLLEPSTGKLILNDTLDRETKSKYELRIRVSD--GVQYTEAYA-TIQVSDTNDNPP-LFEDTVYSFDIPENAQRGYQVGQIVAR--DADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITV 2013          

HSP 7 Score: 105.916 bits (263), Expect = 2.815e-38
Identity = 105/361 (29.09%), Postives = 160/361 (44.32%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKL--TTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            VI +   N   P+F+ + YQ+ + E   VG  I    A+D D  PN +  Y + G N+  + +       IVI   LDY+    Y   +   D G  PL     L I + D+NDN PVF+ KEY   I EN  VG  V    A D DS     + Y F  +       +F ++   G I      + +   + ++L I+A +  S  +  YA ++VH+  VN   P      L P    F+V E   + +    +  +D D G +  V  +L VG+ N K     T  G  IY     R  DRE  +   + ++  + G+ +   T E ++ + IQD N+  P F K  YT  +SE + +G
Sbjct: 3216 VIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAF--LPSGPDRHFFIMNQSNGTISSAVSFDYEE-RRIYTLQIKAKNPDSSME-SYANLYVHVLGVNEFYPQF----LQPVFH-FDVSETSAVGTRVGAVQATDKDSGEDGRV-YYLLVGSSNDKGFRIDTNTGL-IYVA---RHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVG 3561          

HSP 8 Score: 73.9442 bits (180), Expect = 2.815e-38
Identity = 68/175 (38.86%), Postives = 83/175 (47.43%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQ--VKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNP 2190
            F ID   G + TA+ LDRE+     L++ AID G P  QT + TV I + DVNDN PT   P  L   + ENE      +T I A DPDL  NG    Y           + I        S+D  SG +    S DRE        I V D GKP+  S   +T+TVLD NDNP
Sbjct: 3594 FKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLP-PQTGSATVHIELEDVNDNGPT-FTPEGLNGYISENEPAGTSIMTLI-ASDPDLPRNGGPFTY-----------QLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNP 3754          

HSP 9 Score: 97.4413 bits (241), Expect = 7.413e-37
Identity = 102/375 (27.20%), Postives = 154/375 (41.07%), Query Frame = 2
Query:  524 IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEAS--DGGSVPKVGYATVFVHLKDVNNQRP-----------VININSLGP----AKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I DVNDH P F  + Y+  + E  +V  R     A+D D+  N   +Y  + G  +     F +  YL V   LD E +  Y  T+   D G P       + I V+D NDN P F+   +   I ENA     V  +TAVD D G   ++ +    Q QD      F I T  G IK  R  + + + +  S N EAS  DG     +    + +     +N  P           V ++N   P    A     + E  +  +H   ++  D D G+N +V   L  G E  +  N  +  G+    L   R  DRE      + ++  D      L++   IT+ + D N+ +P F + +  V+V E S  G
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDG-YLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD------FTIDTRNGFIKTLRPFDREALVK-VSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQF-NLDSATGQ----LSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTG 1400          

HSP 10 Score: 78.1814 bits (191), Expect = 7.413e-37
Identity = 70/232 (30.17%), Postives = 110/232 (47.41%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP---QLTSIEAITLTVLDINDNPPKWFQ------PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG 2334
            F ID   G+L     LD E      L + A D G P S + T    + + D NDNPP  I P    V++ +E +P+   +  + A DPD G NG V + I + E       ++ + R   F I+  +G +   + +DRE ID++ L ++  D+ +P   QL++ + +T+ V DINDN P +        P   ST+  + + + Q        A D DS  N  +TY +  G
Sbjct: 1432 FHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTP-SLSTTVLYNVLVVDDNDNPP--IFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQE------PQLPQGRH--FGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ------VHAKDADSSSNGLVTYEIVSG 1646          

HSP 11 Score: 91.2781 bits (225), Expect = 3.533e-35
Identity = 111/443 (25.06%), Postives = 183/443 (41.31%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYW---INVITIQDVNDHQPKFA---ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRD--IYTLQPNRVFDREV-------------DSHFQVRML---------CSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G   + F ++  +G++  A+ +DRE+      T L       +       +   I  I I D+ND+ P FA   ES   I + E   VG  I L    D D   N+  +Y   +  N  F I   + +LYL     +  E        L+A D G PPL    +L++ + D+ND+ PVF    Y+  + E   V      + A D+D G  G++ Y   +     +   F      G + ++  L+ +     ++L +   D G   +     V +H+ D N+  P    ++       F++ EN    +    +   D DIG NAE+   L+   ++F      T+  R+  I TL+P   FDRE              D   +  M           SD G P+L  + ++ V + DVN+ +P F +  Y V +SE ++ G
Sbjct:  873 GDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQ--RPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVF----PDGYLFVRAPLD-REERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTF-----TFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDF------TIDTRNGFIKTLRP---FDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEG 1294          

HSP 12 Score: 78.1814 bits (191), Expect = 3.533e-35
Identity = 85/284 (29.93%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD---------DLVYIDAIIGDLRA--RQSIREGHYLIKLVANDNGNPN---LSTEIKINLYI 2478
            F +D   G L     LDRE  +   LIV+A D       ++  ++ I + D NDN P    +  ++ V E   T    L + +A D D G N  V F I               NR   F ID I+G+L ++K LD E I SY L I   D G P L++     + V+D NDNPP  F   A    I  K  +     I+   A DPDS  N  ++Y +++ +          +     +I  LR   R+SI    + + +VA D   P+   LSTE  + + +
Sbjct: 1326 FNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPT-GTELMRFRASDADQGVNSQVVFSISA------------GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPP-IFPSTAIVRQI--KEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDT--FRLTVVATDRAQPSERQLSTEKLVTVIV 1591          

HSP 13 Score: 125.176 bits (313), Expect = 2.126e-28
Identity = 138/484 (28.51%), Postives = 216/484 (44.63%), Query Frame = 2
Query:  260 EEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEE---STGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWIN-------------------VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND-----------TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG-SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS--DGDI-GVNAEVDCHLTVGAEN-FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++ID GN   N  I+ +I      S F +  +G +    +L+    ST  L +  R   ++    SF+ L+  Q++L    P  Y                       I I+DVND  P F  S  +  I E V +   +    A D D   N    Y M    D           + N T   L    V++ALD E + +Y   + A D G PP      L I +LD NDN PVF  K+Y   + ENA +G +V  V+A D+D G  G++RY      Q  D      F IS  TG +++ + LN + +++ +SL + A D     P    A + +++ D+N+ RP   ++S   A+    V EN    +   ++ V+  D D   +N++V   L  G  + F+++ S      DI  L+P    DRE  S + + ++  D G+P LT    + V++QD+N+  P F+ Q+Y   V EN   G
Sbjct: 2052 KDIDSGN---NGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFA--SFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFI-SANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLR---VVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD------FSISEDTGVVRVAKNLNYERLSR-YSLTVRAEDCALENPAGDTAELTINILDINDNRPTF-LDSPYLAR----VMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSG----DIALLKP---LDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSG 2507          

HSP 14 Score: 87.0409 bits (214), Expect = 4.155e-27
Identity = 98/376 (26.06%), Postives = 163/376 (43.35%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG---QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEV---------DCH-LTVGAENFKLSNSQTV--KGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I I D +++ PKF ++ Y   + +    G RI    A+D      N   Y +  FN    F++   +  ++ ++  +       Y+  + A D G+PP      + I V   N + P FS   Y+VI+ EN  VG  +  V A D D+G  G +RY      + QD      F +   TG I +Q+ L+  ++ Q++ LNI   D G  P    A + + L DVN+  PV N        K+++  + EN+ + +       +D D   NA +         D H   +   N  +S++ +   + R IYTLQ   +  +  DS  +              +   + V +  VNEF P+F +  +  +VSE S +G
Sbjct: 3112 INIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDG-WITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQD------FSVDERTGGIVIQQQLDY-DLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFN-------HKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQ---IKAKNPDSSME--------------SYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVG 3455          

HSP 15 Score: 55.4546 bits (132), Expect = 4.155e-27
Identity = 58/222 (26.13%), Postives = 88/222 (39.64%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPD-SRPNANITYHVTEG 2334
            F ID   G +  A  LDRE  +++ L V+A + G  R         I      ++PP  I             +   +T ++A D D+           R ++ +     I+ N  + F ID  +G ++    LDRE   +Y L I   D G P  T    + + + D+NDN P  F P   +  I+           +I  ASDPD  R     TY +  G
Sbjct: 3487 FRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDV-----------RTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPT-FTPEGLNGYISENEPAGTSIMTLI--ASDPDLPRNGGPFTYQLIGG 3694          

HSP 16 Score: 115.931 bits (289), Expect = 1.515e-25
Identity = 118/415 (28.43%), Postives = 187/415 (45.06%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY--FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMV--GEVVANVTAVDMDSG-LFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLS-NSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRG-TPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            FSL  + G+L +   +DRE       + TA DR +   +    +     +I I D ND+ P F    Y   ++E   +G  +   +A+D D   N    Y   +   N  F+I+    +  +  N L+YE    Y  T+ A DC +  P      L I++LDINDN P F    Y   + EN +   G  V  V A D D+  L  QVRY F +  D  +   F I+  +G+I L + L+ +    +++L + A D GS P  G   V V ++D+N+  PV  + S         V+EN    +H      +D D G+NA++  +L +G    +   +S+T +     TL      DRE  S + + ++  D   T    +   +T+ + DVN+  P+F    Y V V E  + G
Sbjct: 2221 FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQL-----LIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKN-LNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRY-FLKEGDSDL---FRINASSGDIALLKPLD-REQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSY-----HATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL-LGEHMHRFHIDSETGEISTATTL------DREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKG 2612          

HSP 17 Score: 84.3445 bits (207), Expect = 6.338e-25
Identity = 109/458 (23.80%), Postives = 193/458 (42.14%), Query Frame = 2
Query:  245 HYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT-FNITFSNLLYLIVINALDYETQ------INYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFS-QKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            H  V+E +  G  V           +  K  F L   G+ +  F ++  TG++  A  +DRE+   TS   L     + +I  P    +N+ I++ DVND+ PKF  + Y + + E +  G  +    A D D   N V  Y + G +   F+I   N    +V   L+ +T+      + Y   + A D G   L     L + +L   +  P F+        + E+   G+++  V+A     GL G++RY   G +   S      +   +G + + +      +   + + IEA+DG +        + +++ D N+  PV+          +  V E ++     A++  SD D G N  V   L     +F  +   T  G +IYT       DRE    +   +   D+G P +T    + + + D N+  P+F +  +++NV+EN+ IG
Sbjct: 2497 HATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL--GEHMHRFHIDSETGEISTATTLDREE---TSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDI---NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDS----LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVME-----QLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRL---QNDFDGTFEITESG-EIYT---RMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRL-FSLNVTENAEIG 2928          

HSP 18 Score: 50.8322 bits (120), Expect = 6.338e-25
Identity = 60/214 (28.04%), Postives = 101/214 (47.20%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPD-LGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSL---DREYIDS----YILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASD 2286
            F I+   GN+  A  LDRE+ D+  L V+A D G  R++T  T       D NDN P   +        E ++++ + + QI A D D  G N  + + +Q+               + +FSID  +G +   K++     +Y+ S    Y L ++  D GKP L S   + + ++D ++NPPK F+   +   +   +V  + QRI+   A+D
Sbjct: 2959 FRIEPQSGNITVAGHLDREQQDEYILKVVASD-GAWRAETPITITIQ---DQNDNAPEFEHSFYSFSFPELQQSIAL-VGQIIATDRDKQGPNSVISYSLQQ--------------PSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPK-FEQAEYLAPLPQDAV--RGQRIVRVHAND 3150          

HSP 19 Score: 111.309 bits (277), Expect = 4.104e-24
Identity = 100/344 (29.07%), Postives = 159/344 (46.22%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQR--IDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD-GGSVPKVGYATVFVHLKDVNNQRPVI----NINSLGPAKKDFNVK---ENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENF 1348
            G  L +F LEE+    I+     +DRE++   + T  A+D+     T    +     +I + DVNDH+P F +S Y   +SE    G  ++  TA+D D   N    Y +   N+    +   L  LIV    LD E +   + ++ A D G  P      L + +LD ND  P FSQ+E  V + E+A    +VA +TA D D G  G V +      +      F +   TG++  +R L+ + ++Q + +++ A D G   P+   ATV++++ DVN+  P       I SL     D  +K   E + ++ H   +  SD D G NA ++  L  G E  
Sbjct:  429 GNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHL-----IIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQ-YEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLH---VTASDKDDGDNALIEYRLESGGEGL 763          

HSP 20 Score: 110.153 bits (274), Expect = 9.088e-24
Identity = 95/356 (26.69%), Postives = 155/356 (43.54%), Query Frame = 2
Query:  515 VITIQDVNDHQPK-----FAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT--FNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRFKKQNY 1555
             + + D NDH P      F +      + E    G  ++     D D   N   +  +   N+   F +  +  L+++ +N  LD E    Y  T+VA D G P       L I V D+ND+ PVF + EY  ++ E A  G  VA++TA D D+G+  QV Y    +   + L +F +   TG I     L+ + I     L+I A DGG  PK  Y  + V + D N++ P          +++  + E+    +  A++  +D D G N  V   L    E  +L   Q         L   R  DRE  S +++ ++  D+G P   +    + + + DVN+  P+F  ++Y
Sbjct:  369 TVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHY---DILSGNELKWFSMDPLTGLIVTTGPLD-REIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAP-----QFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVE--RLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHY 713          

HSP 21 Score: 109.768 bits (273), Expect = 1.014e-23
Identity = 109/397 (27.46%), Postives = 183/397 (46.10%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTA-LDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISE---AVQVGYRISLRTASDPDVEP-NNVCTYFM-HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR-FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG-SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
            FS+ E TG + +A+ ++ E++   S T   + C +E       +  IN++   D+ND++P F +S Y  ++ E       GY +++  A D D  P N+   YF+  G +D F I  S+   + ++  LD E Q  Y  TLVA D G PPL G   + + V DINDN PVF  + Y   ++EN   G  V    A D D GL  ++R+   G+      +  F+I + TGEI     L+ +  +  + L + A D   + P+     + + + DVN+  P  +  +   A  +  + + + +    A+    D D G NA V  H T+   +    +  T  G     L+         D  + + +   D+G   L+++ E+TV ++    F P F
Sbjct: 2326 FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINIL---DINDNRPTFLDSPYLARVMENTVPPNGGYVLTV-NAYDADTPPLNSQVRYFLKEGDSDLFRINASSG-DIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGE-----HMHRFHIDSETGEISTATTLDREETSV-YHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPE-RISKGEFVFGARAL----DLDDGENAVV--HYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELF-PTF 2703          

HSP 22 Score: 97.8265 bits (242), Expect = 4.436e-20
Identity = 106/465 (22.80%), Postives = 191/465 (41.08%), Query Frame = 2
Query:  227 EFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWIN----VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVE-PNNVCTYFMHGFNDTFNI------TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +F R     V E  ++G+FV  + + S+   +   +           + F +E  +G + +A  +DREQ          + +  L +      W       ITIQD ND+ P+F  S+Y     E  Q    +    A+D D + PN+V +Y +   +  F+I       FS        +      +  Y  T++A D G PPL     + I+++D ++N P F Q EY   + ++A+ G+ +  V A D       ++ Y        ++ S F +  + G I L + +      + + L + A+D G  P+     V + +   N   P  ++NS         V EN+ + S    +  +D D G N  +   ++ G E    S  +   G  I      +  D ++   + + +   D G   L++   +T+ + DVN+  P F  + Y   + EN  +G
Sbjct: 2912 KFTRLFSLNVTENAEIGSFV--IRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQ----------QDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTF---NLSSIFSVGRHDGWITLVKPIQVPPNTR-YELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSY-----QVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVI-----QQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVG 3350          

HSP 23 Score: 95.1301 bits (235), Expect = 3.152e-19
Identity = 83/273 (30.40%), Postives = 130/273 (47.62%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSR-PNANITYHVTEGDDLVYIDAIIGDLRARQSIREGH----------YLIKLVANDNGNPNLSTEIKINLYI 2478
            G + T   LDRE+      +V A+DQG P   T T +V + + D NDNPP       L V EN E +  F+ ++ + D DLG N    +                EN  + F I+  SGN+T+   LDRE  D YIL ++  D      T    IT+T+ D NDN P++       +    +  +A   +II   A+D D + PN+ I+Y + +   +  ID   G++ +++++R  H          Y + ++A DNG P L +E  +N+ I
Sbjct: 2863 GEIYTRMRLDREEIGDYAFVVEAVDQGVPH-MTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAE-IGSFVIRVTSSDLDLGANANASY-------------SFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAET---PITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQII---ATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINI 3114          

HSP 24 Score: 95.1301 bits (235), Expect = 3.256e-19
Identity = 96/372 (25.81%), Postives = 166/372 (44.62%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKT---------TLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYK-----VIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGE--IKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            +TI DVND+ P F  S Y + ++E    G  +    ASD D+  N+  TY++      F +     + +     ++   Q N K+         T+ A D G P   G   + +++LD ND+ P+ S + +        + ENA+ G VVA V   D DSGL G+   R     +   L +F +        +++  +L+ + I + ++L + A D G+  +   A + + + DVN+  PV         K +++  + E     S  A I  +D D GVNA+V   +  G E  K  +   + G  I T  P    DRE+    ++ +   D G        ++ V I D N+ +P+F ++   V + E++
Sbjct:  258 VTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGV-ISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNE---LGHFRLEEAADLHIVRVNGVLDREEIGK-YNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFE-------KSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNE-LKWFSMDPLTGL-IVTTGP---LDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDA 612          

HSP 25 Score: 93.9745 bits (232), Expect = 7.639e-19
Identity = 101/350 (28.86%), Postives = 152/350 (43.43%), Query Frame = 2
Query:  548 PKFA-ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRP-VININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKL---SNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
            P FA  +     +SE V+ G  I+  +A+ P         Y + G    D+  +  ++ L  +  + LDYE    Y+  + A D   P L     + ++V D NDN PV  Q  Y   + E     +++A V A D DSG  G V YR     D      F I T +GEI  +  L+ + I  D++  +EA D G     G A+V +HL D N+  P    + SL       NV EN  + S    +  SD D+G NA      +    E F++   S + TV G            DRE    + ++++ SD        E  IT+ IQD N+ +P F+   Y+ +  E
Sbjct: 2701 PTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFD----GTFEI-TESGEIYTRMRLDREEIG-DYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSL-------NVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGH----------LDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPE 3024          

HSP 26 Score: 91.2781 bits (225), Expect = 4.537e-18
Identity = 100/376 (26.60%), Postives = 164/376 (43.62%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV----PIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSD 1462
            G++ + F ++   G L  A  +DRE   P  +      ++E+        P      V +T+ D ND  P+F ++ +   +SE +Q+G+ IS   A DPD    +V    M G +  F +  S    LI+ + LD ET+  Y+  +   D G+       T+ +S  D NDN P+F    Y   I ENA  G  V  + A D D G   Q+ Y  G V D      F ++  TG + L   L+ + + Q + L ++A D G        TV+ ++ D+N+  P+ +     P      V EN  + +    +   D D G N  ++  +T G     F + ++ T++ R        R  DRE  S + + +   D
Sbjct: 1759 GQVDRLFDIDAKLGILSTAAELDRE-AGPEEY------EVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL-GSVTFLLMDGHDGKFLLEPST-GKLILNDTLDRETKSKYELRIRVSD-GVQYTEAYATIQVS--DTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSY--GVVSD-WANDVFSLNPQTGMLTLTARLDYEEV-QHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFD-----PMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTR--------RNLDREHRSTYTLTVTARD 2105          

HSP 27 Score: 89.7373 bits (221), Expect = 1.530e-17
Identity = 131/509 (25.74%), Postives = 216/509 (42.44%), Query Frame = 2
Query:   50 DWLTLGLYVMDLLSIFLMLNQYQLFQIIFGDLLVNFHR-SSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIEL-TIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND--TFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQT----LAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ----VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNE 1525
            D  T G+ +   L  + ++ +Y L  I   DL   +H  SS A L + L  +     V N  ++  H  + E   VG FV   +      K  PK+    +     G    +F + +S G +  A   D E+        +   QI+       ++ + N+ + +  VN+  P+F +  +   +SE   VG R+    A+D D   +    Y + G ++   F I T + L+Y  V   LD ETQ     T++A + G   + GN T    + IS+ D ND  P F +  Y   I E A VG  V  V A+D D      VR +  Q    + + ++   F I   TGEI     L+ +  +  ++L I A D G  P+ G ATV + L+DVN+  P        P   +  + EN+   +    +  SD D+  N     +  +G ++     S     R+   ++    FDRE+    +  +   D G PK  ++  +T+ + D N+
Sbjct: 3280 DERTGGIVIQQQLD-YDLIQEYHL-NITVQDL--GYHPLSSVAMLTIILTDVNDNPPVFN--HKEYHCYIPENKPVGTFVFQAHAAD---KDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEE------RRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIY--VARHLDRETQNRVVLTVMAKNYGS--IRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKD------VRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETST-YNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFT-----PEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKH----KSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQND 3752          

HSP 28 Score: 85.1149 bits (209), Expect = 3.364e-16
Identity = 83/269 (30.86%), Postives = 129/269 (47.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMV--CDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRP-NANITYHVTEGD-DLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLS 2451
            F ++   G LR  + LDRE      L + A D+GEP  Q+  + + I I D NDN P V +P +    V EN     M L Q+ A D D G NG +R+ I            +  ++   FSI E +G + + K+L+ E +  Y L +    C    P   + E +T+ +LDINDN P +     +   +   +V      ++   A D D+ P N+ + Y + EGD DL  I+A  GD+   + +   ++  Y + LVA D G+P L+
Sbjct: 2221 FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEP-PQSTESQLLIRILDENDNSP-VFDPKQYSASVAENASIGAMVL-QVSATDVDEGANGRIRYSI------------VLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAE-LTINILDINDNRPTFLDS-PYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLT 2472          

HSP 29 Score: 85.1149 bits (209), Expect = 3.660e-16
Identity = 74/258 (28.68%), Postives = 119/258 (46.12%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-DLVYIDAIIGDLRARQSIREGH---YLIKLVAND 2430
            F ++   G L   + LDRE   K EL +   D      Q       I ++D NDNPP   +      + EN +     + QI ARD DLG+N  + + +            + +    +FS++  +G LT+   LD E +  YIL +   D G+P L++   +   VLD+NDN P  F P+++S+ +     +A +  ++   A D DS  N  I Y +T GD D  +     G +R R+++   H   Y + + A D
Sbjct: 1868 FLLEPSTGKLILNDTLDRETKSKYELRIRVSDG----VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQR-GYQVGQIVARDADLGQNAQLSYGV------------VSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAP-IFDPMSYSSEVFENVPIATE--VVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 30 Score: 84.7297 bits (208), Expect = 4.219e-16
Identity = 107/460 (23.26%), Postives = 201/460 (43.70%), Query Frame = 2
Query:  239 NIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQR-IDREQVCPTSFTALDRCQIELTIF-VPIDYWINVIT--IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPN-NVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI-GVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRV----FDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            N H+A+ E++  G  +  ++  S    +  K  + +   G +     ++ ++G L + Q  +D E       T L    IE      P    + +IT  + D ND+ P   +  Y  ++ E       I++  ASD D   N NV     + F+ TF IT S  +Y  +   LD E   +Y   + A D G+P + G  ++ + +LD NDN P F+ + + + + ENA +G  V  VT+ D+D G      Y F   ++P     F I   +G I +   L+ +    ++ L + ASDG    +     + + ++D N+  P    +        F+  E Q  ++    I  +D D  G N+ +   L   +  F +  +      ++++ +  R     + R  ++ + + +L +D G P L +E  + + I D +   P+F++  Y   + +++  G
Sbjct: 2708 NSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG-GIMGDSLRVDPNSGLLSVGQDGLDYE------LTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRM--RLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFS--ENPG--EKFRIEPQSGNITVAGHLD-REQQDEYILKVVASDGAWRAET---PITITIQDQNDNAPEFEHSFYS-----FSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATG----EVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRG 3140          

HSP 31 Score: 71.633 bits (174), Expect = 1.426e-15
Identity = 106/427 (24.82%), Postives = 171/427 (40.05%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI----FVPID-YWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY--FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVA--CDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP--KVGYATVFVHLKDVNNQRPVININSLGPAKKDF---NVKENQTLMSHFAIIWVSDGDIGV-NAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G   + FS++E TG ++I Q++D        +  +    + +T+    + P+    +  I + DVND+ P F    Y   I E   VG  +    A+D D   N +  Y     G +  F I   +   +    + DYE +  Y   + A   D  M        L + VL +N+ +P F Q  +   + E + VG  V  V A D DSG  G+V Y   G   D      F I T TG I + R L+ +       L + A + GS+       A V + ++D N+    I         K +    + E   + +    +   D D+   N +    +  G  N K S    V+  +I T       DRE  S + + +   D G P  T    + ++++DVN+  P F  +     +SEN   G
Sbjct: 3271 GNERQDFSVDERTGGIVIQQQLD--------YDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYA---NLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKG----FRIDTNTGLIYVARHLD-RETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFI---------KHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIING--NLKQSFKIDVQTGEISTAS---RLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAG 3667          

HSP 32 Score: 31.9574 bits (71), Expect = 1.426e-15
Identity = 22/64 (34.38%), Postives = 33/64 (51.56%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT 1845
             K K    +D+  G +R+    DRE    +E I+   D G+P+ Q +   + IT+ D NDNP T
Sbjct: 3694 GKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPK-QKSQHLLTITVLDQNDNPST 3756          

HSP 33 Score: 80.4925 bits (197), Expect = 1.025e-14
Identity = 77/297 (25.93%), Postives = 126/297 (42.42%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREK----------------------GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG-KPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIRE---GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID   G ++T    DRE                       G+ + L     D G PR Q       I   DVNDN P  +  P         +    +T +  +D D G NG V + + +             N    F++D  +G L++ + LDRE  + + L ++  D   K  L+S  +IT+ VLD NDN P++ Q  +  + + T     +  R    +ASD D   N+ + + ++ G+  D  +ID+I G L   + +       Y + + A+D G P+LST +  N+ +
Sbjct: 1199 FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVT-DVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAK------------GNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRF---RASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLV 1479          

HSP 34 Score: 78.9518 bits (193), Expect = 2.751e-14
Identity = 71/256 (27.73%), Postives = 112/256 (43.75%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-----IDAIIGDLRARQSI---REGHYLIKLVANDNGNP 2442
            +R   +LDRE+  K  L V+A+DQG P ++T T  + I + DVND+ P         V         F+  I A D D G N  V + I            +  N  K FS+D ++G +     LDRE  D+  L I   D G     +   + + +LD ND  P++ Q      N+T          + +  A+D D   N ++T+ +    + +Y     +DA+ G L  R+ +   +   Y I ++A D G P
Sbjct:  446 VRVNGVLDREEIGKYNLTVVAMDQGTP-ARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDI------------LSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQ---REQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP 685          

HSP 35 Score: 75.8702 bits (185), Expect = 2.285e-13
Identity = 65/194 (33.51%), Postives = 91/194 (46.91%), Query Frame = 1
Query: 1738 KIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            + EL+V A D+G P     T  V +   +  D P   +N  ++ V ENE      LT + A D D G NG +R+ I       G  E+ D      FS+DE +G + I + LD + I  Y L I V D G   L+S+  +T+ + D+NDNPP +     H      K V      +  A A+D DS  NA I Y
Sbjct: 3194 RYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILT-VGATDDDTGPNGMLRYSIS------GGNERQD------FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPV---GTFVFQAHAADKDSPKNAIIHY 3371          

HSP 36 Score: 74.7146 bits (182), Expect = 4.601e-13
Identity = 80/299 (26.76%), Postives = 140/299 (46.82%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG--KPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID-----AIIGDLRARQSIREGH----YLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQF 2529
            LF I+   G++     LDRE+  +  L ++A+D G P   T T  V + + D+NDN P   +      V+EN  +    LT  +A D D G N  +RF +        L E +       F ID  +G ++   +LDRE    Y L +M  D    +P+ +S+  +T++V D+NDN PK+    + + N+     +++ + +  A+A D D   NA + Y ++ G D  Y D      ++      ++  + H    Y I + A D G  +LS++ ++ + +     F T   +++  F
Sbjct: 2433 LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSP-PLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTP-RATDKDEGLNAKLRFNL--------LGEHMHR-----FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVN-LTISVSDVNDNIPKF---DSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTIS-GRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHF 2711          

HSP 37 Score: 73.1738 bits (178), Expect = 1.563e-12
Identity = 63/213 (29.58%), Postives = 98/213 (46.01%), Query Frame = 1
Query: 1822 DVNDNPPT----VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG-DDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNG 2436
            D NDN P     + N   L+    EE+ P  +  ++A D D G+NG V + +Q   D               F I E SG +     LDRE I  Y   +   DQG P +T   ++ L +LD NDNPPK+ +    S N+T  + +     +I   +SD D   NAN +Y  +E   +   I+   G++     +   ++  Y++K+VA+D  
Sbjct: 2802 DANDNAPVMEQLIYNAEVLE----EESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDG-------------TFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTR--LFSLNVTENAEIG--SFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA 2992          

HSP 38 Score: 69.3218 bits (168), Expect = 2.225e-11
Identity = 48/172 (27.91%), Postives = 83/172 (48.26%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD 2337
            DVND  P  I+  +  + EN   +   +  ++A D D G NG + + ++   D     E + ++    FS++   G L +  +LDRE   SY+L I   D+G+P  ++   + + +LD NDN P  F P  +S ++   + +     ++   A+D D   N  I Y +  GD
Sbjct: 2159 DVNDEVPVFISANETAIMENV-AINTVVIAVKAVDNDEGRNGYIDYLMKEARD-----EDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSP-VFDPKQYSASVAENASIG--AMVLQVSATDVDEGANGRIRYSIVLGD 2321          

HSP 39 Score: 64.6994 bits (156), Expect = 5.117e-10
Identity = 68/227 (29.96%), Postives = 98/227 (43.17%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREK-GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN-----LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHST-NITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F +D   G ++T  +LDRE   D  +L+VL+     P        V I + DVNDN P    P          T    L    A D D+GENG        V D+  +     +N+ ++ +    SG+     L    +LDRE   SY L I   D G P       + +T+LD+NDNPP +     HS  N++          ++   ASD D   N+ ITY++ E
Sbjct:  103 FTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYP------IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENG--------VTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIF----DHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAE 311          

HSP 40 Score: 62.003 bits (149), Expect = 3.433e-9
Identity = 65/282 (23.05%), Postives = 111/282 (39.36%), Query Frame = 2
Query:  764 YKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQP-------NRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            Y+  + A   G  P      + ++VLD ND+ P F    +   + E+  +G  ++ + A D D+   G V +      D      F +   TG++ L   L+ +     + L I  SDG    +  YAT+   + D N+  P+            F++ EN         I   D D+G NA++   +     N            D+++L P           D E   H+ + +   D G P L+T   +   + D+N+ +P F   +Y+  V EN  I 
Sbjct: 1789 YEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHD----GKFLLEPSTGKLILNDTLD-RETKSKYELRIRVSDGVQYTEA-YATI--QVSDTNDNPPLFEDTVYS-----FDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN------------DVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIA 2043          

HSP 41 Score: 57.7658 bits (138), Expect = 8.100e-8
Identity = 67/267 (25.09%), Postives = 112/267 (41.95%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYI----------------------DSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDL--VYIDAIIGDL----RARQSIREGHYLIKLVAND 2430
            LDRE+ D   L V   D G+P S+++   V I + D NDN P   N      + EN      F+ ++ A D D+G N  + F +               ++T+ F+ID  +G +   +  DRE +                      +  +L   V D G P+L     + + V D+NDN P++ +   H   +T     ++   I      D D   N ++ Y + +G++     +D+  G L    R  +  +E H+LI +VA D
Sbjct: 1111 LDREERDYYALTVSCRDAGQP-SRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPA-DTFVGKLTAVDRDIGRNAELSFTLS--------------SQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYH---VTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLI-VVAKD 1357          

HSP 42 Score: 53.5286 bits (127), Expect = 1.653e-6
Identity = 70/275 (25.45%), Postives = 116/275 (42.18%), Query Frame = 1
Query: 1696 NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLD---------REYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQPVAHSTNITTKSVLAQDQRIIIAQA-SDPDSRPNANITYHVTEGDDL----------VYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            +L T   LDRE     +L + A D G P  +     V +TI DVNDNPP + +     V  NE  LP   +  + A D DLG+N  + +Y+   E +              F+++  +G ++  + ++              S +  +   D G P+      +T+ +LD ND+ P   F+       + T    A +  ++ A A  D DS  N   +  +  G++L          ++I  + G L  R+ I  G Y + +VA D G P  +T
Sbjct:  221 HLETTGNLDRESRGSYQLNISARDGGSP-PRFGYLQVNVTILDVNDNPP-IFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ--------------FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLD-REEI--GKYNLTVVAMDQGTPARTT 476          

HSP 43 Score: 51.9878 bits (123), Expect = 3.936e-6
Identity = 71/300 (23.67%), Postives = 122/300 (40.67%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ----DQRIIIAQASDPDSRPNANITYHVTEGDDLVYID---AIIGDLRA----------------------RQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            F I    G L     +  E G  I + ++A D G     ++  ++ + I DVND+ P   +   +  + E  +    F   + A D DLG+NG + + I            I+ N  ++F +    G L +   LDRE  D Y L +   D G+P  +S+  + + V+D NDN P++       TN T    + +    D  +    A D D   NA +++ ++       ID     I  LR                       R S+   + L++   +DNG P L  ++K+ + ++
Sbjct:  992 FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGS-PPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFA-LAATDIDLGDNGRISYEI------------IEGNTERMFGVFP-DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQF-------TNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVT 1269          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 141.739 bits (356), Expect = 5.564e-51
Identity = 119/435 (27.36%), Postives = 197/435 (45.29%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM--HGFNDTFNIT-----------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNR-------VFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + GK L  F+++  +G LI++Q +D E  Q      TA D     L+  + I     ++ +QDVND+ P F +  Y + +SE+  +  +I    ASD D   N   TY +   G ++  N             F N  ++ +   LD ET+  Y+ T++A D G P       + + VLD NDN P F + +Y+  I+EN   G VV  VTA D+D G    +RY    +      S F +   TGEI  +  L+ + + + + L +EA D G+  +     V +H+ DVN+  P I      P +   +V+E Q   +    +   D D G NA +   +  G ++          G  ++++ P         V D E  S +++ +  SD G P   T   + V++ D+N+  P F   +    V E++ +G
Sbjct:  973 ESGKGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTI-----LVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN-----SSFQVHPVTGEISTREPLD-RELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI----ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDS---------DGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG 1381          

HSP 2 Score: 80.8777 bits (198), Expect = 5.564e-51
Identity = 81/285 (28.42%), Postives = 136/285 (47.72%), Query Frame = 1
Query: 1648 TRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRS-QXXXXXXXXXXXDVNDNPPT-VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGK---PQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ-RI--IIAQ--ASDPDSRPNANITYHVT--EGDDLVYIDAIIGDLRARQSI--------REGHYLIKLVANDNGNP 2442
            T+   +  F ID++ GNL  A +LDRE   +  L + A+D     + Q++  TV I + DVNDN P    +P  LQV E    +   +    A D D G NG +++ + R   +   ++   E    +F +D ++G L++   LD E +  Y+L +   DQ      +L +   + L +LD ND+ P +  P  +S+   T S+   D  RI  ++A   A D DS  N  +TY +T   G+    I++  G +   +S+        + G + + + A D+G P
Sbjct: 1418 TKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSE-ATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ---EQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP--NSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 3 Score: 140.969 bits (354), Expect = 2.941e-43
Identity = 127/465 (27.31%), Postives = 210/465 (45.16%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE---QVCPTSFTALDRCQIELTIFVPIDYW---INVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM--HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---------GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK-KQNYTVNVSENSTIG 1588
            Y VKE+I  G  VG++   S     +    + +Y  G    YFS+E ++G + IA+ +D E   QV            I+ T+  P  Y    +N I ++DVND+ P+F  S  +I + E+ ++G  +    A D D   +   TY +        F I  +   +LI+   LDYE+   +   + A D G+P L  N T+ + V D+NDN PVF + EY V + E+  +   +  V A D+D+G   ++ YR            +    V  +F I   +G I L+  L+ +     + L + A+D G+        V V + D N+  P         +K +F ++EN    S   ++  SD D+G NA +   L     +F++     V G +I T +P    DRE+   + + +   D+GTP  +    + + + DVN+ +P     Q   V+V E    G
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPDGYFSIETNSGNIRIAKPLDHEAKSQVL---------LNIQATLGEPPVYGHTQVN-IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLD-RETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP-----KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV---HPVTG-EISTREP---LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPG 1273          

HSP 4 Score: 55.8398 bits (133), Expect = 2.941e-43
Identity = 58/195 (29.74%), Postives = 83/195 (42.56%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQ--ARDPDLGENGTVRFYIQRVEDKR------GLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCD---QGKPQLTSIEAITLTVLDINDNPPKWFQ 2205
            S    LF ID   G +RT  +LD E+     L V A D G P  +     + + + D+NDN PT  +   +     +  L   +  I    R  D+  N     +    ED R       L + + E     F ID  SGNL + + LDRE    + L I   D      PQ ++I  + + V D+NDN P+W Q
Sbjct: 1302 SDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP-PRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESF----EDLRVTYTLNPLTKDLIE---AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAPEWPQ 1487          

HSP 5 Score: 107.457 bits (267), Expect = 5.011e-40
Identity = 93/359 (25.91%), Postives = 162/359 (45.13%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT----FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            + I DVND+ P+F +  Y   + E    G  +    A D D   N+  TY +    +T    F I     L +   + +D ET+   + T+VA D G+PPL    T+ +++ D+NDN P+F Q  Y V + EN  VG  +  V+A D D G+   V Y  G+      L+ F + + +GEI +   L+ +  +  +   + A+D G +     A + + L DVN+ RPV        + ++     +Q   +    +  +D D G   +V   +  G E   F++  S      +I+ ++P+ +  R    H  + +  +D G  +   +  + + I D  +  P F+K  Y   V E+
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGL-ITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSS-YEFPVLATDRGGLSTT--AMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTG----EIFVVRPDMLSVRTQPMHM-LNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKED 839          

HSP 6 Score: 78.5666 bits (192), Expect = 5.011e-40
Identity = 74/223 (33.18%), Postives = 110/223 (49.33%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNIT-TKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG 2334
            F I+   GN+R A  LD E   ++ L + A   GEP      T V I + DVNDN P    +  ++ V E+ E L   L    A D D G +G V + +            + E+   +F+ID  SG+L + + LD E    + L +   D G P L++   I + V D+NDNPP  F+   +S N++ ++S+ AQ   II   ASD D+  NA ITY + + 
Sbjct:  875 FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAE-LGAPLYAAHAHDKDSGSSGQVTYSL------------VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP-VFEKDEYSVNVSESRSINAQ---IIQVNASDLDTGNNARITYRIVDA 1078          

HSP 7 Score: 148.673 bits (374), Expect = 1.425e-35
Identity = 123/414 (29.71%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHG-FNDTFNITF----SNLLYL--IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVN-AEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +++ +TG++    ++DRE     S  A+      + + V         T++D ND+ P F ++   I+  E      + +L  A D D+EP N   Y  + G  ND F ++       +LYL   +   LD ET   Y   + A D G PPL G  T+ I++ D+NDN P+F+Q  Y   + ENA VG  V  V A D D+   G V Y   + Q       F I   TG I + + L+ +   +   L + A D G  P    A V + + DVN+ +P IN+  L        + E+       A I V D D     A V+  L  G  +F L    T +   IY +  +   DRE+ S++ + ++ +D+GTP L   + I ++I DVN+  P F++  Y  NV E +  G
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLV---------TVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLS-DDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPG 520          

HSP 8 Score: 130.954 bits (328), Expect = 3.497e-30
Identity = 119/416 (28.61%), Postives = 192/416 (46.15%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQ--IELTIFVPIDYWINVITIQDVNDHQPK----FAESYYQIQISEAVQVGYRISLRTASDPD--VEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKN--IAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            + F ++  TG + I + +D E  ++      A D  +  +E T FV        I + DVND+QP     F       +ISE+ Q G  ++  +  DPD   E  NV      G       T  N +YL++++  LD E   NY  ++VA D G PPL  ++++ + + D+NDN P F Q  Y   + E A  G  V  V A D D GL   + Y   +  + +   +F I   TG I  +  ++C+   + Q   L + A DGG  P    ATV V + DVN+  P+ + +       + +V EN+ +      +  SD D GVNA V+  +  G ++      ++  G      +     D E  S ++  +L +DRG   L+T   I +++ DVN+  P F  + Y V++ E+
Sbjct:  334 QMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFV-------SIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQ---LTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFY-----NVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE----LDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES 727          

HSP 9 Score: 106.686 bits (265), Expect = 1.078e-28
Identity = 117/414 (28.26%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  401 LIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF--SNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP----VFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQ--RILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF---NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN----FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            L I+  +DRE     S    ALD     L  F+ ++     ITIQDVND+QP F +S Y   + E   VG  +    ASD D + N +  Y ++         F        I IN ALD+ET+  ++  +VA D G  PL     ++I V D+NDN P    +F   +    I E+A  GE VA ++  D DS    +  Y    V       +F ++T    I L    +   + I  +++L++ A+D G+ P     ++F+ + DVN+  P          ++D    NV E     +    +   D D G+N+ +   L    E     F++ + QT     + T + +   D E +   Q+ ++  D G P L++   + V I DVN+  P F +  Y V+V+EN  +G
Sbjct:  238 LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN-----ITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF--------EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI-DPQT----GLITTRSH--IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVG 627          

HSP 10 Score: 41.2022 bits (95), Expect = 1.078e-28
Identity = 47/182 (25.82%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQV------KENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS--LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            F +    G +  A  LD E+    E  VLA D+G     + T  + + +TDVNDN P V  P + +V      K + +     +  + A DPD G  G V + I            +  N   IF ID  +G + + +   L       ++L I   D G  +  +   + L+++D    PP
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI------------VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP 825          

HSP 11 Score: 71.2478 bits (173), Expect = 3.119e-24
Identity = 79/270 (29.26%), Postives = 121/270 (44.81%), Query Frame = 1
Query: 1687 YMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWF--QPVAHSTNITTKSVLAQ----DQRIIIAQASDPDSRP-NANITYHVTEGDDLVYIDAIIGDLRARQSIRE------GHYLIKLVANDNGNPNLST 2454
            + G +RT  +LDRE  D  +L ++A D+G P+  T T T+ + I DVNDN PT   PP   V  +E T L   +T I A D D     T R          G    +D     IF++D  SG L + + LD E    Y L ++  D      T    +T+ V D NDN P +   QP A+   +   S +++    D  ++   A+D DS   N+ + Y +    +   +    G +    S  +      G Y ++++A D G P L +
Sbjct: 2376 FSGIVRTNIVLDREIRDIYKLKIIATDEGVPQ-MTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVDTYPALTYRL---------GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKS 2630          

HSP 12 Score: 61.6178 bits (148), Expect = 3.119e-24
Identity = 89/414 (21.50%), Postives = 163/414 (39.37%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIEL-TIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPV--FSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNN-QRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F+++  +G +    ++DRE     +F  L  D  + E+ +  VP+   INV+   D+ND++P F    Y  Q+   +Q G  +    A D D+  N    Y ++  N   +  F    +   L    +L  E+       +VA D G PP      + + + +     PV  F  + Y+V++KEN+  G  +  V A+  D G   +V++ FG   +  +LS   + + +GEI++ +                                 HL D +    P ++  S G A              H+        +   N        + + +F L+NS           QPN +         +V ++      P L +  E+ ++++D N+ SP+F ++ +   VSE +  G
Sbjct: 1999 FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPV--QINVL---DINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILS---LDSLSGEIRVNK--------------------------------PHLLDYDRFSTPSMSALSRGRAL-------------HYEEEIDESSEEDPNNSTRSQRALTSSSFALTNS-----------QPNEI---------RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG 2338          

HSP 13 Score: 108.227 bits (269), Expect = 2.958e-23
Identity = 110/419 (26.25%), Postives = 182/419 (43.44%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRT-----ASDPDVEPNNVCTYFMHGFNDT--FNITFS-NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            K L  F +  ++G++ IA  +D E+     F  L  DR  +  T  + +        + DVND++P F    Y++ + E+ +   + S        A+DPD       +Y +   N+   F I  S   ++++  + L   TQ  +   + A D G      +  + +S++D     P+F +  Y   +KE+   G VV +V A   D      VRY      DP    YF I T +G I++ + L+ +  +Q   LNI+A+  G  P  G+  V + ++DVN+  P    + +       +V E+  L +        D D G + +V   L V      L       G  I +       D E      + +  +D G P L+T   I V +QDVN+  P F+K  Y+VNVSE+ +I
Sbjct:  655 KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQ-------LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI-YSGDPD--GYFSIETNSGNIRIAKPLDHEAKSQVL-LNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMV-----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL-VKESGKGLFAIDARSGHLILSQH----LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI 1051          

HSP 14 Score: 101.679 bits (252), Expect = 2.707e-21
Identity = 94/373 (25.20%), Postives = 172/373 (46.11%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFND---TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG--QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININ------SLGPAKKDFNVKENQTLMSHFAIIWVSDGDI---GVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            VI ++D ND+ PKF++  +   +SE    G  ++   A D D   N    Y  + G +D        FS ++   ++  LD E +  YK  ++A D G+P + G  T+ + ++D+NDN P F      V + E   +G V+ +++A D+D+  +  + YR G     D   +S F +  Y+G++ L+R L+ + + Q++ L++ ASD     +     + V + D N+  PV          ++ PA  +     +++L   F ++ V+  D    G N++V   +    E F +  S  V   ++  LQP           + VR++  D G P L +   + V+  D      +F +  Y   +SE + +G
Sbjct: 2309 VIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEI----SESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPA----VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLG 2664          

HSP 15 Score: 90.5077 bits (223), Expect = 7.257e-18
Identity = 105/371 (28.30%), Postives = 162/371 (43.67%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAE-SYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEI----KLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLK--DVNNQRPVIN----INSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP--RFKKQNYTVNVSENSTIG 1588
            IT+ DVND+ P+F   S Y + + E  + G  I    ASD D  PN    Y + G N     +  +    +    LD E    Y   + A D G P    G+  + I V D NDN P F   +Y   ++E+A +G  V  ++AVD D G+  ++ Y             F I   +G I    KL R L        ++  + A+DGG   +V  ATV V +   D+N+ RP+      I  + PA     ++  QTL+   A+    D D+G NAE+   L   AEN  +S    +       L  ++    E      + ++  D+G P  ++   I + I +  + +P  RF+ + Y V + ENS  G
Sbjct: 1835 ITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDRELQAS-----YNFMVLATDGGRY-EVRSATVPVQINVLDINDNRPIFERYPYIGQV-PAL----IQPGQTLLKVQAL----DADLGANAEIVYSLN--AENSAVSAKFRIN-PSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSG 2182          

HSP 16 Score: 88.5817 bits (218), Expect = 2.669e-17
Identity = 88/299 (29.43%), Postives = 137/299 (45.82%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKI-FSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEA-ITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLV----YIDAIIGDLRARQSI--REGHYL-IKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVI 2541
            F ID   G L +A  LDRE+  +  L + A D+G+P+S+     + I + D NDN P           + +  L   + QI A D DLG N  + + +               N T+  F+ID  SG +T    LDRE   SY   ++  D G+ ++ S    + + VLDINDN P  F+   +   +   +++   Q ++  QA D D   NA I Y +   +  V     I+   G L A QS+    G  L +++VA D GNP  S+   I L I      + V+   ++ +RV++
Sbjct: 1895 FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA--------------NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQV--PALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVML 2175          

HSP 17 Score: 86.2705 bits (212), Expect = 1.395e-16
Identity = 70/210 (33.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESY-YQIQISEAVQVGYRISLRTASDPDVE--PNNVCTYFMHGFNDTFNITFSNLL-YLIVINALDYETQI-NYKTTLVACDCG-MPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQV-QDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG 1123
            +ITI D ND+ P F  S  Y+ +ISE   + Y I+   A D D E  PN+   Y +   ND    T   +   L V N LDY++   +Y+  + ACD     PLC  Q   + + D NDN P F   EY   + EN  VG  V    A D+D G FGQ+ Y  G    D S    F + + +G +    + + +   Q + + + ASD G
Sbjct: 2739 IITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQ-RQRYDMELLASDMG 2947          

HSP 18 Score: 82.4185 bits (202), Expect = 2.595e-15
Identity = 69/251 (27.49%), Postives = 113/251 (45.02%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNP 2442
            LDRE  D+ +L VLA D G P +   T  +   + D NDN P       + +++EN     + +  + A D DLGEN  +R+ +  +                 F +  ++G ++  + LDRE  + Y L +   DQG P  ++   + + V D+NDN P+   P      ++ +        ++  +A D D   NA+ITY + +G D     L  ID   G +R R  +       Y + + A+D GNP
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL-DANDNDPKFQKSKYEFRIEENLRRGSV-VGVVTASDLDLGENAAIRYSLLPINSS--------------FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP 1343          

HSP 19 Score: 79.337 bits (194), Expect = 2.015e-14
Identity = 101/433 (23.33%), Postives = 180/433 (41.57%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQI-QISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT-----FNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFG----------QVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD--GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK--GRDIYT--LQPNRVFDREVDSHFQVRMLCSDRG---TPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F +   TG++   + +DRE  ++      A D+     +  VP+      I + DVND+ P+ A+    +  + E    G  +    A D D   N   TY +    D+     F+I   S ++   V+  LD+E +  Y+  + A D G PP    + L + VLD+NDN P F+       ++E+A +G VV +++ ++  + +            +V Y    +    + + F I  ++G + + R+L+ + +  +F L I A D    + P+    TV + + DVN+  P    + +     D  V E   + +       +D D G N ++   L         S  Q +     D  T  L      D E    + + +   D+    T +L T   + ++I D N+ +P F        VS NS+ G
Sbjct: 1199 FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVR-----IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLD-REVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI-----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF--------VSPNSSGG 1610          

HSP 20 Score: 73.9442 bits (180), Expect = 8.343e-13
Identity = 57/177 (32.20%), Postives = 87/177 (49.15%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW 2199
            F +    G + T   LDRE  +  +L+V A DQG P  ++A   V I ++DVNDN P + +P +  V   EE  P   + +++A D D G+N ++ + I +  D  G           +FSID  SG +     LD E    Y L +   D G P   ++  + + VLD+NDN P +
Sbjct: 1199 FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTP-VRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHG---------LFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 21 Score: 73.1738 bits (178), Expect = 1.337e-12
Identity = 86/342 (25.15%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLL------------KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINAL----------DYETQINYKTTLVACDCG---MPPLCGNQTLAISVLDINDNHPVF------SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRIL--NCKNIAQD--FSLNIEASDGGSVPKVGYATVFVHL 1165
            + V+E+  +G+ VG+++       +   S  + ++D ++               F ++  +G L++A+ +DRE    + F    R         P    I V I + DVND+ P++ +    +Q+SEA  VG  I   TA+D D   N    Y +  +    N +    + L  +++L          D+E    Y   + A D        L  + T+ + +LD ND+ P F        K   + I +   +GEVVA++ AVD DSG  GQ+ Y   ++   +    F I++ TG I+L + L    +++ +   F+L I A D G  P+   +++ +HL
Sbjct: 1372 FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE--VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY---EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHL 1707          

HSP 22 Score: 73.1738 bits (178), Expect = 1.406e-12
Identity = 72/264 (27.27%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  767 KTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYIS-TYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI--GVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQ 1549
            +  LVA     P L     L I + D NDN P FSQK++   + E    G  VA V A D D+G   ++RY    + D +  + F I   ++G ++   +L+ + I   + L I A+D G     G AT+ V + DVN+ +P    N+L        V E   L +    I  +D D    +   +    TV  EN  +       G+ +      R  D E+   +++ ++ SD      T    +TV++ D N+ +P F  Q
Sbjct: 2289 RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY---HIVDGNHDNAFVIEPAFSGIVRTNIVLD-REIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVL----KRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQ 2535          

HSP 23 Score: 67.781 bits (164), Expect = 6.823e-11
Identity = 80/288 (27.78%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV---INPPKLQVKENEETLPM-FLTQIQARDPDLG-ENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDL----VYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +S  + +F ID   G +     LD E  +  EL+V+A D GE +    T  V I +TDVNDN PT+           K +E   P  F+ +I   DPD   E   V   +   +    L  +  +N   +         + ++  LDRE + +Y L ++  D+G P L + ++I L + D+NDNPP++ Q + H+       V      ++   A D D   N+ +TY + E  +       ID   G +  R  I    E    + +VA D G P LS+   + + I
Sbjct:  329 QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTR--DNSIYL---------VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHA---NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTI 601          

HSP 24 Score: 67.3958 bits (163), Expect = 8.214e-11
Identity = 69/269 (25.65%), Postives = 117/269 (43.49%), Query Frame = 1
Query: 1720 DREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTS-----------------------IEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIREGH--YLIKLVANDNGNP 2442
            D EKG +  LI+ A D G+P  + ++  + + +   ++NPP  +    +  + EN  +   F+ Q+ A+     EN  + + I       G+A         +F +D   G +T     DRE   SY+L + V D  +    S                       +  I +TV D+NDN P++     +  ++   S       ++   ASD D  PNA++ Y +T G+  +   ID+  G+L AR   RE H  Y +++ A+D G P
Sbjct: 1677 DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPS-GSFVLQVTAKSLHGAENANLSYEI-----PAGVA-------NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV---ASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQP 1929          

HSP 25 Score: 60.077 bits (144), Expect = 1.284e-8
Identity = 82/306 (26.80%), Postives = 129/306 (42.16%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV------INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYI--QRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP-----KWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV----TEGDDLVYIDAIIGDLRARQSI----REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINI---SDD 2523
            ID+  G +RT   LDRE      L+ + +     R       V +T+ D NDN PT       I  P+   +E + TL      + ARD DL    T R+ I    V D   L+      R  +  +D     L I   LDRE    Y L I   D G P L     + +T+ D+NDN P     ++F  V  +  + T         ++   ASD D+  N  + Y +    ++ + +  ID   G +   +++    +E H L+ +VA D+G   L T   +++ ++  +     IN+   SDD
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIR-------VLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL------LPARDLDLEPYNTQRYNIVSGNVNDAFRLSSH--RERDGVLYLD-----LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTS--------VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELV-VVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD 401          

HSP 26 Score: 59.3066 bits (142), Expect = 2.316e-8
Identity = 76/265 (28.68%), Postives = 117/265 (44.15%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT----VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG-DDLVYID--------AIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINL 2472
            LDRE      L V+A D+G P    A+ ++F+ ITDVNDNPP     + +   ++V +   ++     Q+ A D D G N  + +          LAE   E   + F ID  +G +T    +D E      L ++  D G P L+S   + +T+ D+NDN P + Q      N++        + I+   ASDPD   NA + Y + EG   L   +         I G+L      R   Y   ++A D G  + +  IK+ L
Sbjct:  462 LDREIVSNYTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSV----LQVLAHDRDEGLNSALTY---------SLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSF---YNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFE---RRSSYEFPVLATDRGGLSTTAMIKMQL 705          

HSP 27 Score: 58.9214 bits (141), Expect = 3.683e-8
Identity = 39/127 (30.71%), Postives = 56/127 (44.09%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW 2199
            D NDN P       +           F+ Q+ A D D G N  +R++I            +D N    F I+   SG +     LDRE  D Y L I+  D+G PQ+T    I + ++D+NDN P +
Sbjct: 2314 DENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI------------VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF 2428          

HSP 28 Score: 57.7658 bits (138), Expect = 7.220e-8
Identity = 84/379 (22.16%), Postives = 160/379 (42.22%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQ-----------------------TLAISVLDINDNHPVFSQKE-YKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKV--GYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE-NFKLSNSQ---TVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEE-EITVKIQDVNEFSPRFKKQNY 1555
            + +Q  +++ P+F ++ Y+  I E V  G  +   TA       N   +Y +     ND F++ +   + +      D E+Q +Y   +   D        +                        T+ I+V D+NDN P F     Y + + EN+  G V+  V A D+D G    + Y    +   ++ + F I + +GE+   R L+ +  ++ ++L I+ASD G  PK   G+  + + ++D N+  P   +     +K   +V+E+  L +    I   D D+GVNA +   L    +  F +       T  G+           DRE+ + +   +L +D G  ++ +    + + + D+N+  P F++  Y
Sbjct: 1707 LIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGI-ITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIY---SITGGNLGNKFSIDSSSGELS-ARPLDREQHSR-YTLQIQASDRGQ-PKSRQGHCNITIFVEDQNDNAPRFKL-----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY 2062          

HSP 29 Score: 56.6102 bits (135), Expect = 1.555e-7
Identity = 105/484 (21.69%), Postives = 190/484 (39.26%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKL----LKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKF----AESYYQI-----QISEAVQVGYRISLRTASDPDVEPNNV-CTYFMHGFNDTFNITFSNLLYLIVINALD--YETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLF---GQVRYRFGQVQDPSVLSYFYISTYTGEI-KLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI--GVNAEVDCHLTVGAE---------------NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            V E  ++G  +   +I +N     P  T++L  +  +    +  F+L+  +GKL++ +R+D E  Q       A D      T+          + + D ND+ P F      +Y+ I     +ISE++ V + +    A+D D E NN    Y +    + F++  SN +  + ++ L     +  +Y   ++A D G P L  +  L +   D       F Q +Y+  I E A +G VV  +    +D  L    G     F  +Q  +++    +     ++ KL+ +L+  +     S    +S           +V + + D N+  P+ + +    AK +  + E   L    A +   D D     N+EV   +T G +               N +L      K  ++          R  DSH Q R LCS          +   +++ D N+  P+F    Y   ++EN  +G
Sbjct: 2436 VSEATELGAVI--TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT--------VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSS---------GISVIITILDANDNFPIFDRS----AKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELII--------RACDSHHQ-RPLCS---------LQPFRLELHDENDNEPKFPLTEYVHFLAENEPVG 2878          

HSP 30 Score: 54.6842 bits (130), Expect = 5.941e-7
Identity = 69/277 (24.91%), Postives = 117/277 (42.24%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRC----QIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPD------------VEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISV-LDINDN-HPVFSQKEYKVIIKENAMV--GEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRIL--------NCKNIAQDFSLNIEASDG 1120
            F+++  TG L +  R+D +    +    +  C    Q  L    P       + + D ND++PKF  + Y   ++E   VG  +    ASD D              P++  ++ M   +    +  S  ++       DYE +  Y   L+A D G        ++A+ V ++  D   P F+++ Y+ ++     +  G VV  VTA D DSG  G+V Y   Q+  P   S+F ++  +G + ++R L        N     +D SL I AS G
Sbjct: 2803 FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFR-----LELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVF-------DYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVY---QLSAPH--SHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSG 3058          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 141.739 bits (356), Expect = 5.564e-51
Identity = 119/435 (27.36%), Postives = 197/435 (45.29%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM--HGFNDTFNIT-----------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNR-------VFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + GK L  F+++  +G LI++Q +D E  Q      TA D     L+  + I     ++ +QDVND+ P F +  Y + +SE+  +  +I    ASD D   N   TY +   G ++  N             F N  ++ +   LD ET+  Y+ T++A D G P       + + VLD NDN P F + +Y+  I+EN   G VV  VTA D+D G    +RY    +      S F +   TGEI  +  L+ + + + + L +EA D G+  +     V +H+ DVN+  P I      P +   +V+E Q   +    +   D D G NA +   +  G ++          G  ++++ P         V D E  S +++ +  SD G P   T   + V++ D+N+  P F   +    V E++ +G
Sbjct:  973 ESGKGL--FAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTI-----LVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN-----SSFQVHPVTGEISTREPLD-RELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEI----ADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDS---------DGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALG 1381          

HSP 2 Score: 80.8777 bits (198), Expect = 5.564e-51
Identity = 81/285 (28.42%), Postives = 136/285 (47.72%), Query Frame = 1
Query: 1648 TRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRS-QXXXXXXXXXXXDVNDNPPT-VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGK---PQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ-RI--IIAQ--ASDPDSRPNANITYHVT--EGDDLVYIDAIIGDLRARQSI--------REGHYLIKLVANDNGNP 2442
            T+   +  F ID++ GNL  A +LDRE   +  L + A+D     + Q++  TV I + DVNDN P    +P  LQV E    +   +    A D D G NG +++ + R   +   ++   E    +F +D ++G L++   LD E +  Y+L +   DQ      +L +   + L +LD ND+ P +  P  +S+   T S+   D  RI  ++A   A D DS  N  +TY +T   G+    I++  G +   +S+        + G + + + A D+G P
Sbjct: 1418 TKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSE-ATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQ---EQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSP--NSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP 1696          

HSP 3 Score: 140.969 bits (354), Expect = 2.941e-43
Identity = 127/465 (27.31%), Postives = 210/465 (45.16%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE---QVCPTSFTALDRCQIELTIFVPIDYW---INVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM--HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---------GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK-KQNYTVNVSENSTIG 1588
            Y VKE+I  G  VG++   S     +    + +Y  G    YFS+E ++G + IA+ +D E   QV            I+ T+  P  Y    +N I ++DVND+ P+F  S  +I + E+ ++G  +    A D D   +   TY +        F I  +   +LI+   LDYE+   +   + A D G+P L  N T+ + V D+NDN PVF + EY V + E+  +   +  V A D+D+G   ++ YR            +    V  +F I   +G I L+  L+ +     + L + A+D G+        V V + D N+  P         +K +F ++EN    S   ++  SD D+G NA +   L     +F++     V G +I T +P    DRE+   + + +   D+GTP  +    + + + DVN+ +P     Q   V+V E    G
Sbjct:  834 YYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS-GDPDGYFSIETNSGNIRIAKPLDHEAKSQVL---------LNIQATLGEPPVYGHTQVN-IEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAID-ARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLD-RETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDP-----KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV---HPVTG-EISTREP---LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPG 1273          

HSP 4 Score: 55.8398 bits (133), Expect = 2.941e-43
Identity = 58/195 (29.74%), Postives = 83/195 (42.56%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQ--ARDPDLGENGTVRFYIQRVEDKR------GLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCD---QGKPQLTSIEAITLTVLDINDNPPKWFQ 2205
            S    LF ID   G +RT  +LD E+     L V A D G P  +     + + + D+NDN PT  +   +     +  L   +  I    R  D+  N     +    ED R       L + + E     F ID  SGNL + + LDRE    + L I   D      PQ ++I  + + V D+NDN P+W Q
Sbjct: 1302 SDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP-PRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESF----EDLRVTYTLNPLTKDLIE---AAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAI-TVKIEVADVNDNAPEWPQ 1487          

HSP 5 Score: 107.457 bits (267), Expect = 5.011e-40
Identity = 93/359 (25.91%), Postives = 162/359 (45.13%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT----FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            + I DVND+ P+F +  Y   + E    G  +    A D D   N+  TY +    +T    F I     L +   + +D ET+   + T+VA D G+PPL    T+ +++ D+NDN P+F Q  Y V + EN  VG  +  V+A D D G+   V Y  G+      L+ F + + +GEI +   L+ +  +  +   + A+D G +     A + + L DVN+ RPV        + ++     +Q   +    +  +D D G   +V   +  G E   F++  S      +I+ ++P+ +  R    H  + +  +D G  +   +  + + I D  +  P F+K  Y   V E+
Sbjct:  492 LRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGL-ITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSS-YEFPVLATDRGGLSTT--AMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTG----EIFVVRPDMLSVRTQPMHM-LNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKED 839          

HSP 6 Score: 78.5666 bits (192), Expect = 5.011e-40
Identity = 74/223 (33.18%), Postives = 110/223 (49.33%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNIT-TKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG 2334
            F I+   GN+R A  LD E   ++ L + A   GEP      T V I + DVNDN P    +  ++ V E+ E L   L    A D D G +G V + +            + E+   +F+ID  SG+L + + LD E    + L +   D G P L++   I + V D+NDNPP  F+   +S N++ ++S+ AQ   II   ASD D+  NA ITY + + 
Sbjct:  875 FSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAE-LGAPLYAAHAHDKDSGSSGQVTYSL------------VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPP-VFEKDEYSVNVSESRSINAQ---IIQVNASDLDTGNNARITYRIVDA 1078          

HSP 7 Score: 148.673 bits (374), Expect = 1.425e-35
Identity = 123/414 (29.71%), Postives = 191/414 (46.14%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHG-FNDTFNITF----SNLLYL--IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVN-AEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +++ +TG++    ++DRE     S  A+      + + V         T++D ND+ P F ++   I+  E      + +L  A D D+EP N   Y  + G  ND F ++       +LYL   +   LD ET   Y   + A D G PPL G  T+ I++ D+NDN P+F+Q  Y   + ENA VG  V  V A D D+   G V Y   + Q       F I   TG I + + L+ +   +   L + A D G  P    A V + + DVN+ +P IN+  L        + E+       A I V D D     A V+  L  G  +F L    T +   IY +  +   DRE+ S++ + ++ +D+GTP L   + I ++I DVN+  P F++  Y  NV E +  G
Sbjct:  123 LAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIRVLV---------TVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS-DKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLS-DDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFAL----TTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPG 520          

HSP 8 Score: 130.954 bits (328), Expect = 3.497e-30
Identity = 119/416 (28.61%), Postives = 192/416 (46.15%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQ--IELTIFVPIDYWINVITIQDVNDHQPK----FAESYYQIQISEAVQVGYRISLRTASDPD--VEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKN--IAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            + F ++  TG + I + +D E  ++      A D  +  +E T FV        I + DVND+QP     F       +ISE+ Q G  ++  +  DPD   E  NV      G       T  N +YL++++  LD E   NY  ++VA D G PPL  ++++ + + D+NDN P F Q  Y   + E A  G  V  V A D D GL   + Y   +  + +   +F I   TG I  +  ++C+   + Q   L + A DGG  P    ATV V + DVN+  P+ + +       + +V EN+ +      +  SD D GVNA V+  +  G ++      ++  G      +     D E  S ++  +L +DRG   L+T   I +++ DVN+  P F  + Y V++ E+
Sbjct:  334 QMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFV-------SIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE-THAQWFQIDPQTGLITTRSHIDCETEPVPQ---LTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFY-----NVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGE----LDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRES 727          

HSP 9 Score: 106.686 bits (265), Expect = 1.078e-28
Identity = 117/414 (28.26%), Postives = 186/414 (44.93%), Query Frame = 2
Query:  401 LIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF--SNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP----VFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQ--RILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF---NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN----FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            L I+  +DRE     S    ALD     L  F+ ++     ITIQDVND+QP F +S Y   + E   VG  +    ASD D + N +  Y ++         F        I IN ALD+ET+  ++  +VA D G  PL     ++I V D+NDN P    +F   +    I E+A  GE VA ++  D DS    +  Y    V       +F ++T    I L    +   + I  +++L++ A+D G+ P     ++F+ + DVN+  P          ++D    NV E     +    +   D D G+N+ +   L    E     F++ + QT     + T + +   D E +   Q+ ++  D G P L++   + V I DVN+  P F +  Y V+V+EN  +G
Sbjct:  238 LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVN-----ITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEF--------EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQI-DPQT----GLITTRSH--IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVG 627          

HSP 10 Score: 41.2022 bits (95), Expect = 1.078e-28
Identity = 47/182 (25.82%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQV------KENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS--LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            F +    G +  A  LD E+    E  VLA D+G     + T  + + +TDVNDN P V  P + +V      K + +     +  + A DPD G  G V + I            +  N   IF ID  +G + + +   L       ++L I   D G  +  +   + L+++D    PP
Sbjct:  660 FEVRSASGEICIAGELDFERRSSYEFPVLATDRG---GLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRI------------VAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP 825          

HSP 11 Score: 71.2478 bits (173), Expect = 3.119e-24
Identity = 79/270 (29.26%), Postives = 121/270 (44.81%), Query Frame = 1
Query: 1687 YMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWF--QPVAHSTNITTKSVLAQ----DQRIIIAQASDPDSRP-NANITYHVTEGDDLVYIDAIIGDLRARQSIRE------GHYLIKLVANDNGNPNLST 2454
            + G +RT  +LDRE  D  +L ++A D+G P+  T T T+ + I DVNDN PT   PP   V  +E T L   +T I A D D     T R          G    +D     IF++D  SG L + + LD E    Y L ++  D      T    +T+ V D NDN P +   QP A+   +   S +++    D  ++   A+D DS   N+ + Y +    +   +    G +    S  +      G Y ++++A D G P L +
Sbjct: 2376 FSGIVRTNIVLDREIRDIYKLKIIATDEGVPQ-MTGTATIRVQIVDVNDNQPTF--PPNNLVTVSEATELGAVITSISANDVDTYPALTYRL---------GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKS 2630          

HSP 12 Score: 61.6178 bits (148), Expect = 3.119e-24
Identity = 89/414 (21.50%), Postives = 163/414 (39.37%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIEL-TIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPV--FSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNN-QRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F+++  +G +    ++DRE     +F  L  D  + E+ +  VP+   INV+   D+ND++P F    Y  Q+   +Q G  +    A D D+  N    Y ++  N   +  F    +   L    +L  E+       +VA D G PP      + + + +     PV  F  + Y+V++KEN+  G  +  V A+  D G   +V++ FG   +  +LS   + + +GEI++ +                                 HL D +    P ++  S G A              H+        +   N        + + +F L+NS           QPN +         +V ++      P L +  E+ ++++D N+ SP+F ++ +   VSE +  G
Sbjct: 1999 FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPV--QINVL---DINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILS---LDSLSGEIRVNK--------------------------------PHLLDYDRFSTPSMSALSRGRAL-------------HYEEEIDESSEEDPNNSTRSQRALTSSSFALTNS-----------QPNEI---------RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKG 2338          

HSP 13 Score: 108.227 bits (269), Expect = 2.958e-23
Identity = 110/419 (26.25%), Postives = 182/419 (43.44%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRT-----ASDPDVEPNNVCTYFMHGFNDT--FNITFS-NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            K L  F +  ++G++ IA  +D E+     F  L  DR  +  T  + +        + DVND++P F    Y++ + E+ +   + S        A+DPD       +Y +   N+   F I  S   ++++  + L   TQ  +   + A D G      +  + +S++D     P+F +  Y   +KE+   G VV +V A   D      VRY      DP    YF I T +G I++ + L+ +  +Q   LNI+A+  G  P  G+  V + ++DVN+  P    + +       +V E+  L +        D D G + +V   L V      L       G  I +       D E      + +  +D G P L+T   I V +QDVN+  P F+K  Y+VNVSE+ +I
Sbjct:  655 KHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQ-------LTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSI-YSGDPD--GYFSIETNSGNIRIAKPLDHEAKSQVL-LNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMV-----RISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL-VKESGKGLFAIDARSGHLILSQH----LDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSI 1051          

HSP 14 Score: 101.679 bits (252), Expect = 2.707e-21
Identity = 94/373 (25.20%), Postives = 172/373 (46.11%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFND---TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG--QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININ------SLGPAKKDFNVKENQTLMSHFAIIWVSDGDI---GVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            VI ++D ND+ PKF++  +   +SE    G  ++   A D D   N    Y  + G +D        FS ++   ++  LD E +  YK  ++A D G+P + G  T+ + ++D+NDN P F      V + E   +G V+ +++A D+D+  +  + YR G     D   +S F +  Y+G++ L+R L+ + + Q++ L++ ASD     +     + V + D N+  PV          ++ PA  +     +++L   F ++ V+  D    G N++V   +    E F +  S  V   ++  LQP           + VR++  D G P L +   + V+  D      +F +  Y   +SE + +G
Sbjct: 2309 VIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEI----SESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPA----VSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLG 2664          

HSP 15 Score: 90.5077 bits (223), Expect = 7.257e-18
Identity = 105/371 (28.30%), Postives = 162/371 (43.67%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAE-SYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEI----KLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLK--DVNNQRPVIN----INSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP--RFKKQNYTVNVSENSTIG 1588
            IT+ DVND+ P+F   S Y + + E  + G  I    ASD D  PN    Y + G N     +  +    +    LD E    Y   + A D G P    G+  + I V D NDN P F   +Y   ++E+A +G  V  ++AVD D G+  ++ Y             F I   +G I    KL R L        ++  + A+DGG   +V  ATV V +   D+N+ RP+      I  + PA     ++  QTL+   A+    D D+G NAE+   L   AEN  +S    +       L  ++    E      + ++  D+G P  ++   I + I +  + +P  RF+ + Y V + ENS  G
Sbjct: 1835 ITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN----ETQWQFAIDGQSGLITTVGKLDRELQAS-----YNFMVLATDGGRY-EVRSATVPVQINVLDINDNRPIFERYPYIGQV-PAL----IQPGQTLLKVQAL----DADLGANAEIVYSLN--AENSAVSAKFRIN-PSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSG 2182          

HSP 16 Score: 88.5817 bits (218), Expect = 2.669e-17
Identity = 88/299 (29.43%), Postives = 137/299 (45.82%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKI-FSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEA-ITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLV----YIDAIIGDLRARQSI--REGHYL-IKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVI 2541
            F ID   G L +A  LDRE+  +  L + A D+G+P+S+     + I + D NDN P           + +  L   + QI A D DLG N  + + +               N T+  F+ID  SG +T    LDRE   SY   ++  D G+ ++ S    + + VLDINDN P  F+   +   +   +++   Q ++  QA D D   NA I Y +   +  V     I+   G L A QS+    G  L +++VA D GNP  S+   I L I      + V+   ++ +RV++
Sbjct: 1895 FSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLA--------------NETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRP-IFERYPYIGQV--PALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVML 2175          

HSP 17 Score: 86.2705 bits (212), Expect = 1.395e-16
Identity = 70/210 (33.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESY-YQIQISEAVQVGYRISLRTASDPDVE--PNNVCTYFMHGFNDTFNITFSNLL-YLIVINALDYETQI-NYKTTLVACDCG-MPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQV-QDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG 1123
            +ITI D ND+ P F  S  Y+ +ISE   + Y I+   A D D E  PN+   Y +   ND    T   +   L V N LDY++   +Y+  + ACD     PLC  Q   + + D NDN P F   EY   + EN  VG  V    A D+D G FGQ+ Y  G    D S    F + + +G +    + + +   Q + + + ASD G
Sbjct: 2739 IITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQ-RQRYDMELLASDMG 2947          

HSP 18 Score: 82.4185 bits (202), Expect = 2.595e-15
Identity = 69/251 (27.49%), Postives = 113/251 (45.02%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNP 2442
            LDRE  D+ +L VLA D G P +   T  +   + D NDN P       + +++EN     + +  + A D DLGEN  +R+ +  +                 F +  ++G ++  + LDRE  + Y L +   DQG P  ++   + + V D+NDN P+   P      ++ +        ++  +A D D   NA+ITY + +G D     L  ID   G +R R  +       Y + + A+D GNP
Sbjct: 1111 LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL-DANDNDPKFQKSKYEFRIEENLRRGSV-VGVVTASDLDLGENAAIRYSLLPINSS--------------FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP--QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNP 1343          

HSP 19 Score: 79.337 bits (194), Expect = 2.015e-14
Identity = 101/433 (23.33%), Postives = 180/433 (41.57%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQI-QISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT-----FNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFG----------QVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD--GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK--GRDIYT--LQPNRVFDREVDSHFQVRMLCSDRG---TPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F +   TG++   + +DRE  ++      A D+     +  VP+      I + DVND+ P+ A+    +  + E    G  +    A D D   N   TY +    D+     F+I   S ++   V+  LD+E +  Y+  + A D G PP    + L + VLD+NDN P F+       ++E+A +G VV +++ ++  + +            +V Y    +    + + F I  ++G + + R+L+ + +  +F L I A D    + P+    TV + + DVN+  P    + +     D  V E   + +       +D D G N ++   L         S  Q +     D  T  L      D E    + + +   D+    T +L T   + ++I D N+ +P F        VS NS+ G
Sbjct: 1199 FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVR-----IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV--LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLD-REVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI-----DLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHF--------VSPNSSGG 1610          

HSP 20 Score: 73.9442 bits (180), Expect = 8.343e-13
Identity = 57/177 (32.20%), Postives = 87/177 (49.15%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW 2199
            F +    G + T   LDRE  +  +L+V A DQG P  ++A   V I ++DVNDN P + +P +  V   EE  P   + +++A D D G+N ++ + I +  D  G           +FSID  SG +     LD E    Y L +   D G P   ++  + + VLD+NDN P +
Sbjct: 1199 FQVHPVTGEISTREPLDRELRELYDLVVEARDQGTP-VRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHG---------LFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF 1365          

HSP 21 Score: 73.1738 bits (178), Expect = 1.337e-12
Identity = 86/342 (25.15%), Postives = 153/342 (44.74%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLL------------KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINAL----------DYETQINYKTTLVACDCG---MPPLCGNQTLAISVLDINDNHPVF------SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRIL--NCKNIAQD--FSLNIEASDGGSVPKVGYATVFVHL 1165
            + V+E+  +G+ VG+++       +   S  + ++D ++               F ++  +G L++A+ +DRE    + F    R         P    I V I + DVND+ P++ +    +Q+SEA  VG  I   TA+D D   N    Y +  +    N +    + L  +++L          D+E    Y   + A D        L  + T+ + +LD ND+ P F        K   + I +   +GEVVA++ AVD DSG  GQ+ Y   ++   +    F I++ TG I+L + L    +++ +   F+L I A D G  P+   +++ +HL
Sbjct: 1372 FRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE--VQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTY---EITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQ-PEPKKSSLNLHL 1707          

HSP 22 Score: 73.1738 bits (178), Expect = 1.406e-12
Identity = 72/264 (27.27%), Postives = 115/264 (43.56%), Query Frame = 2
Query:  767 KTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYIS-TYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI--GVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQ 1549
            +  LVA     P L     L I + D NDN P FSQK++   + E    G  VA V A D D+G   ++RY    + D +  + F I   ++G ++   +L+ + I   + L I A+D G     G AT+ V + DVN+ +P    N+L        V E   L +    I  +D D    +   +    TV  EN  +       G+ +      R  D E+   +++ ++ SD      T    +TV++ D N+ +P F  Q
Sbjct: 2289 RVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY---HIVDGNHDNAFVIEPAFSGIVRTNIVLD-REIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL------VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVL----KRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQ 2535          

HSP 23 Score: 67.781 bits (164), Expect = 6.823e-11
Identity = 80/288 (27.78%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV---INPPKLQVKENEETLPM-FLTQIQARDPDLG-ENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDL----VYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +S  + +F ID   G +     LD E  +  EL+V+A D GE +    T  V I +TDVNDN PT+           K +E   P  F+ +I   DPD   E   V   +   +    L  +  +N   +         + ++  LDRE + +Y L ++  D+G P L + ++I L + D+NDNPP++ Q + H+       V      ++   A D D   N+ +TY + E  +       ID   G +  R  I    E    + +VA D G P LS+   + + I
Sbjct:  329 QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGE-QPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTR--DNSIYL---------VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHA---NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTI 601          

HSP 24 Score: 67.3958 bits (163), Expect = 8.214e-11
Identity = 69/269 (25.65%), Postives = 117/269 (43.49%), Query Frame = 1
Query: 1720 DREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTS-----------------------IEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIREGH--YLIKLVANDNGNP 2442
            D EKG +  LI+ A D G+P  + ++  + + +   ++NPP  +    +  + EN  +   F+ Q+ A+     EN  + + I       G+A         +F +D   G +T     DRE   SY+L + V D  +    S                       +  I +TV D+NDN P++     +  ++   S       ++   ASD D  PNA++ Y +T G+  +   ID+  G+L AR   RE H  Y +++ A+D G P
Sbjct: 1677 DVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPS-GSFVLQVTAKSLHGAENANLSYEI-----PAGVA-------NDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVV---ASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQP 1929          

HSP 25 Score: 60.077 bits (144), Expect = 1.284e-8
Identity = 82/306 (26.80%), Postives = 129/306 (42.16%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV------INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYI--QRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP-----KWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV----TEGDDLVYIDAIIGDLRARQSI----REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINI---SDD 2523
            ID+  G +RT   LDRE      L+ + +     R       V +T+ D NDN PT       I  P+   +E + TL      + ARD DL    T R+ I    V D   L+      R  +  +D     L I   LDRE    Y L I   D G P L     + +T+ D+NDN P     ++F  V  +  + T         ++   ASD D+  N  + Y +    ++ + +  ID   G +   +++    +E H L+ +VA D+G   L T   +++ ++  +     IN+   SDD
Sbjct:  125 IDRATGEIRTKVKLDRETRASYSLVAIPLSGRNIR-------VLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL------LPARDLDLEPYNTQRYNIVSGNVNDAFRLSSH--RERDGVLYLD-----LQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTS--------VLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELV-VVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD 401          

HSP 26 Score: 59.3066 bits (142), Expect = 2.316e-8
Identity = 76/265 (28.68%), Postives = 117/265 (44.15%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT----VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG-DDLVYID--------AIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINL 2472
            LDRE      L V+A D+G P    A+ ++F+ ITDVNDNPP     + +   ++V +   ++     Q+ A D D G N  + +          LAE   E   + F ID  +G +T    +D E      L ++  D G P L+S   + +T+ D+NDN P + Q      N++        + I+   ASDPD   NA + Y + EG   L   +         I G+L      R   Y   ++A D G  + +  IK+ L
Sbjct:  462 LDREIVSNYTLSVVATDKGTP-PLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSV----LQVLAHDRDEGLNSALTY---------SLAET-PETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSF---YNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFE---RRSSYEFPVLATDRGGLSTTAMIKMQL 705          

HSP 27 Score: 58.9214 bits (141), Expect = 3.683e-8
Identity = 39/127 (30.71%), Postives = 56/127 (44.09%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW 2199
            D NDN P       +           F+ Q+ A D D G N  +R++I            +D N    F I+   SG +     LDRE  D Y L I+  D+G PQ+T    I + ++D+NDN P +
Sbjct: 2314 DENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI------------VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF 2428          

HSP 28 Score: 57.7658 bits (138), Expect = 7.220e-8
Identity = 84/379 (22.16%), Postives = 160/379 (42.22%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQ-----------------------TLAISVLDINDNHPVFSQKE-YKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKV--GYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE-NFKLSNSQ---TVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEE-EITVKIQDVNEFSPRFKKQNY 1555
            + +Q  +++ P+F ++ Y+  I E V  G  +   TA       N   +Y +     ND F++ +   + +      D E+Q +Y   +   D        +                        T+ I+V D+NDN P F     Y + + EN+  G V+  V A D+D G    + Y    +   ++ + F I + +GE+   R L+ +  ++ ++L I+ASD G  PK   G+  + + ++D N+  P   +     +K   +V+E+  L +    I   D D+GVNA +   L    +  F +       T  G+           DRE+ + +   +L +D G  ++ +    + + + D+N+  P F++  Y
Sbjct: 1707 LIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGI-ITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIY---SITGGNLGNKFSIDSSSGELS-ARPLDREQHSR-YTLQIQASDRGQ-PKSRQGHCNITIFVEDQNDNAPRFKL-----SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGK----------LDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY 2062          

HSP 29 Score: 56.6102 bits (135), Expect = 1.555e-7
Identity = 105/484 (21.69%), Postives = 190/484 (39.26%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKL----LKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKF----AESYYQI-----QISEAVQVGYRISLRTASDPDVEPNNV-CTYFMHGFNDTFNITFSNLLYLIVINALD--YETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLF---GQVRYRFGQVQDPSVLSYFYISTYTGEI-KLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI--GVNAEVDCHLTVGAE---------------NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            V E  ++G  +   +I +N     P  T++L  +  +    +  F+L+  +GKL++ +R+D E  Q       A D      T+          + + D ND+ P F      +Y+ I     +ISE++ V + +    A+D D E NN    Y +    + F++  SN +  + ++ L     +  +Y   ++A D G P L  +  L +   D       F Q +Y+  I E A +G VV  +    +D  L    G     F  +Q  +++    +     ++ KL+ +L+  +     S    +S           +V + + D N+  P+ + +    AK +  + E   L    A +   D D     N+EV   +T G +               N +L      K  ++          R  DSH Q R LCS          +   +++ D N+  P+F    Y   ++EN  +G
Sbjct: 2436 VSEATELGAVI--TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLT--------VRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSS---------GISVIITILDANDNFPIFDRS----AKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELII--------RACDSHHQ-RPLCS---------LQPFRLELHDENDNEPKFPLTEYVHFLAENEPVG 2878          

HSP 30 Score: 54.6842 bits (130), Expect = 5.941e-7
Identity = 69/277 (24.91%), Postives = 117/277 (42.24%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRC----QIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPD------------VEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISV-LDINDN-HPVFSQKEYKVIIKENAMV--GEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRIL--------NCKNIAQDFSLNIEASDG 1120
            F+++  TG L +  R+D +    +    +  C    Q  L    P       + + D ND++PKF  + Y   ++E   VG  +    ASD D              P++  ++ M   +    +  S  ++       DYE +  Y   L+A D G        ++A+ V ++  D   P F+++ Y+ ++     +  G VV  VTA D DSG  G+V Y   Q+  P   S+F ++  +G + ++R L        N     +D SL I AS G
Sbjct: 2803 FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFR-----LELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVF-------DYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVY---QLSAPH--SHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSG 3058          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 129.413 bits (324), Expect = 1.141e-40
Identity = 114/426 (26.76%), Postives = 195/426 (45.77%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQ--IELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGE--IKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKG---RDIYTLQP-------NRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G     FS++  +G + + + +D E V   S+  + R Q     +        +NVI   D ND+ P+F  S +Q  + E V VGY I    A D D   N   TY +   +D F +       ++  I  LD E Q  +   +VA D G+PP   + ++ I+V D+NDN P F+ K Y+  + E+   G  V  VTA D D     ++ Y   ++   +    F I++  G   I + + L+ K   + F L + A+D G   +   ATV +++ D NN  P+        A    +V E+  + +   ++  +D D+GVNA++   L          N +++ G    D +++ P       N   DRE  S + + +   D G P L+   ++ + + DVN+ +P FK   Y  ++ E++ +G
Sbjct:  626 GNTQSQFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVI---DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQ-EKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFEN-----APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----------NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVG 1023          

HSP 2 Score: 58.5362 bits (140), Expect = 1.141e-40
Identity = 53/177 (29.94%), Postives = 80/177 (45.20%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRG--LAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            F ID   G +RT   LDRE      L  +A+D+G P   ++T  V I + DVND+PPT  +    L V EN   +   + +I A DPD G N  V + I   +D     L  +    R ++ ++ E+            +Y  +   + +V     P L +   I + V D+NDN P
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENS-PVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL------------DYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 108.612 bits (270), Expect = 1.859e-40
Identity = 89/361 (24.65%), Postives = 167/361 (46.26%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYR---ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + D ND+ P+F+E  Y +Q+ E    G     ++   A+D D   N    Y + G N     +  ++   + ++  LDYE+  +Y+  + A D G P       L ++V+D NDN P F   +++  + EN  VG  +  V A D D G   ++ Y   +  D   L+   +   TG ++  + L+ +   + F+  + A DGG  PK   ++V + ++DVN+  P  N     P   + NV E+Q   +    +  +D D   ++ +   +T G    + + + +  GR + T+   +  D + +  F + +  +D G    T    + + I D N F+P F+   Y+ +V E++ +G
Sbjct:  569 VKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA---VDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-----PKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAIT-SQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVG 913          

HSP 4 Score: 78.9518 bits (193), Expect = 1.859e-40
Identity = 71/228 (31.14%), Postives = 104/228 (45.61%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYI--QRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQ---PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD 2340
            F I+   G + T   LDRE      L V A D G P S + TT V I +TDVNDN P   +P        +  +   + Q+ A DPD+G NG +++ +  + +ED               F ID  SG +   K LDRE +  + L  +  D+G P L+S   + + + D+ND+PP +      +    N    SV+ +        A DPD   NA + Y +  GDD
Sbjct:  950 FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS-------------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGE------IHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 5 Score: 92.4337 bits (228), Expect = 1.560e-30
Identity = 90/370 (24.32%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  527 QDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSY------FYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP---KVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQ---TLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +++ +  P F ++ Y   + E    G  ++   A DP+  P     Y M    D+ + +     S    +    +LD E    +   +VA D   PP  G  TL ++VLD ND+ P F  ++++  I+E A VG  V  + A D D G   ++ Y    V D + L+       F I + +G I  +  L+ +  +  + L + A+D  S     +   A+V V + D N+  P  +  +         V E+Q   T  +  A I  +D D G NA +  +  +G       +  ++ G D+  ++P    D E    +++ +   D G+P  +   ++ V + D N+ +PRF    +  +V EN  +G
Sbjct:  350 RELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLD-RETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY-----TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR-YAIIGGNTQSQFSIDSMSG-DVSLVKP---LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVG 705          

HSP 6 Score: 61.6178 bits (148), Expect = 1.560e-30
Identity = 80/280 (28.57%), Postives = 128/280 (45.71%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN--LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-------GDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLS--TEIKINL 2472
            +D   G ++T   LDRE+  +    V+A D G P  ++A+++V IT+ DVNDN P   NP   +    E+  P   +T + A DPD              ED R   E    N    F+I   +G   +TI +SLD +    ++L +   D G    T+   I +T  D N+  P  F+   +S ++   + +     +++  A+D D   NA ITY + E         D   I+   G +     + RE    YL+ + A D GNP+LS  T+++I +
Sbjct:  739 VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP-PKSASSSVVITVQDVNDNDP-AFNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPI-FENAPYSASVFEDAPVGTT--VLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 7 Score: 126.331 bits (316), Expect = 8.859e-29
Identity = 101/366 (27.60%), Postives = 166/366 (45.36%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVI-NALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-------VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            VIT+QDVND+ P F   YY+  + E    G  ++  TA+DPD +               F IT  N   LI I  +LDY+ +  +  T+ A D G        T+ I++ D N+  P+F    Y   + E+A VG  V  V+A D D G+  Q+ Y   +         DP     F I+  TG I     L+ +     + L + A DGG+        V + + DVN+  P        P  +  ++ E+  + +    +  SD D+G+N  +   L+    +  + +   V      T++ N+  DRE  + F +  +  D+G+P L++  E+ ++++DVN+  P F     T+ V ENS +G
Sbjct:  781 VITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-----FSINPQTGAIVTNAPLD-RETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK----SPLYQ-ASILEDALVGTSVIQVAASDPDVGLNGRIKYLLS----DRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVG 1129          

HSP 8 Score: 120.939 bits (302), Expect = 3.626e-27
Identity = 109/433 (25.17%), Postives = 182/433 (42.03%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN----------ALDYETQINYKTTLVACDCGMPP---LCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVG---EVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRD--IYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            D +    F ++  TG +  +  +DRE +    F    R       F P      + + + D NDH P F    ++  I E   VG  +    A+D D+  N    Y +    D   +     + +  I+          +LD ET  +Y   + A D             ++ + VLD NDN+P FS++ Y V + E+   G     VA++ A D D G    +RY    G  Q     S F I + +G++ L + L+ +++ + + L I A DGGS  +     + V++ D N+  P    +         +V EN  +  +   +   D D G NAE+   ++   +NF L+    V  R   + T++P    DRE    F  +++  D G P  +    + + +QDVN+  P F  + Y  NV E+   G
Sbjct:  400 DSRSQSLFKVDSRTGVVTTSASLDRELMDVHYF----RVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQFSIDSMSGDVSLVKPLDYESV-RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF-----QESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGWVQTIKP---LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPG 810          

HSP 9 Score: 110.538 bits (275), Expect = 5.592e-24
Identity = 107/353 (30.31%), Postives = 157/353 (44.48%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH-------GFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG--QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK 1543
            I I D N+  P F  + Y   + E   VG  + + +A+D DV  N   TY ++       G  D F+I        IV NA LD ET   Y  T+ A D G P L     + I V D+NDN P F    Y+  I E+A+VG  V  V A D D GL G+++Y      ++D S    F I   +G I+  + L+ +++A  F L   A D GS P      V + L+DVN+  P    +     K    V EN  + S    I   D D GVNA V  +  +G ++    +  T  G +   L      D E     F++ +  +   +P L  +  I + + DVN+ +P  +
Sbjct:  885 INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT--GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS----FVIDPTSGTIRTNKGLDRESVAV-FHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASD-----KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVH-YSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAA---SPPLRNDAHIEILVTDVNDNAPVLR 1221          

HSP 10 Score: 95.1301 bits (235), Expect = 2.884e-19
Identity = 84/274 (30.66%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXX--DVNDNPPT------VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNP 2442
            +F ID   G + T + LDRE  D   L+V A D    +S+  T T  + +   D NDN P        +  P+ Q    E+     +  I+A D D G N  +R+ I            I  N    FSID +SG++++ K LD E + SY L I   D G P  ++   + + V+D NDN P+++      T+   +SVL        II  QA D D   NA ITY ++E DD   + +D   G ++  + +    +G +  ++VA D G P
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT---VAHIRATDADQGNNAAIRYAI------------IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY------TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP 772          

HSP 11 Score: 72.4034 bits (176), Expect = 2.720e-12
Identity = 73/273 (26.74%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE-ETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINL 2472
            F ID   G++     LD E      L++ A D G P S++ TT + + + D NDN P        Q +E+  E +P+   + ++QA D D G N  + + I   +D   LA            +D  +G +   K LDRE    +   ++  D G P  ++  ++ +TV D+NDN P  F P  +  N+            + A   D DSR +  IT   T G   +      G +   QS+   +E  +L+ + A D+G  + +  + IN+
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTS---QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA------------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA-FNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 12 Score: 64.3142 bits (155), Expect = 6.647e-10
Identity = 68/260 (26.15%), Postives = 122/260 (46.92%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-----SNLLYLIVINALDYE-TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVI---IKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDG 1120
            F ++ ++G +   + +DRE V     TA+  D+    L+  V +      I ++DVND  P FA     + + E   VG  +    A DPD   N V  Y + G +D+   +      S    L+ +  LDYE T+  ++  + A     PPL  +  + I V D+NDN PV   ++++VI    +++   GE +  + A D D  +  ++ YR     + ++L    +++ +G + L   LN  N+ +  ++ +  SDG
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQ-----IRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL--RDFQVIFNNFRDHFPSGE-IGRIPAFDAD--VSDKLHYRILSGNNANLLR---LNSSSGGLVLSPQLN-TNVPKFATMEVSVSDG 1298          
BLAST of Protocadherin-9 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 129.413 bits (324), Expect = 1.209e-40
Identity = 114/426 (26.76%), Postives = 195/426 (45.77%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQ--IELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGE--IKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKG---RDIYTLQP-------NRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G     FS++  +G + + + +D E V   S+  + R Q     +        +NVI   D ND+ P+F  S +Q  + E V VGY I    A D D   N   TY +   +D F +       ++  I  LD E Q  +   +VA D G+PP   + ++ I+V D+NDN P F+ K Y+  + E+   G  V  VTA D D     ++ Y   ++   +    F I++  G   I + + L+ K   + F L + A+D G   +   ATV +++ D NN  P+        A    +V E+  + +   ++  +D D+GVNA++   L          N +++ G    D +++ P       N   DRE  S + + +   D G P L+   ++ + + DVN+ +P FK   Y  ++ E++ +G
Sbjct:  626 GNTQSQFSIDSMSGDVSLVKPLDYESV--RSYRLVIRAQDGGSPSRSNTTQLLVNVI---DANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED--SRLHY---EITTGNTRGRFAITSQNGRGLITIAQSLDYKQ-EKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFEN-----APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----------NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVG 1023          

HSP 2 Score: 58.5362 bits (140), Expect = 1.209e-40
Identity = 53/177 (29.94%), Postives = 80/177 (45.20%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRG--LAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            F ID   G +RT   LDRE      L  +A+D+G P   ++T  V I + DVND+PPT  +    L V EN   +   + +I A DPD G N  V + I   +D     L  +    R ++ ++ E+            +Y  +   + +V     P L +   I + V D+NDN P
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSP-PLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENS-PVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL------------DYESTRKRFELVVRAASPPLRNDAHIEILVTDVNDNAP 1218          

HSP 3 Score: 108.612 bits (270), Expect = 2.035e-40
Identity = 89/361 (24.65%), Postives = 167/361 (46.26%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYR---ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + D ND+ P+F+E  Y +Q+ E    G     ++   A+D D   N    Y + G N     +  ++   + ++  LDYE+  +Y+  + A D G P       L ++V+D NDN P F   +++  + EN  VG  +  V A D D G   ++ Y   +  D   L+   +   TG ++  + L+ +   + F+  + A DGG  PK   ++V + ++DVN+  P  N     P   + NV E+Q   +    +  +D D   ++ +   +T G    + + + +  GR + T+   +  D + +  F + +  +D G    T    + + I D N F+P F+   Y+ +V E++ +G
Sbjct:  569 VKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA---VDPRTGWVQTIKPLDREEQGR-FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFN-----PKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAIT-SQNGRGLITIA--QSLDYKQEKRFLLTVAATDSGGRSDTA--TVHINITDANNFAPIFENAPYSASVFEDAPVG 913          

HSP 4 Score: 78.5666 bits (192), Expect = 2.035e-40
Identity = 71/228 (31.14%), Postives = 104/228 (45.61%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYI--QRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQ---PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD 2340
            F I+   G + T   LDRE      L V A D G P S + TT V I +TDVNDN P   +P        +  +   + Q+ A DPD+G NG +++ +  + +ED               F ID  SG +   K LDRE +  + L  +  D+G P L+S   + + + D+ND+PP +      +    N    SV+ +        A DPD   NA + Y +  GDD
Sbjct:  950 FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP-SLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS-------------FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGE------IHAHDPDEGVNAVVHYSIIGGDD 1157          

HSP 5 Score: 92.4337 bits (228), Expect = 1.795e-30
Identity = 90/370 (24.32%), Postives = 161/370 (43.51%), Query Frame = 2
Query:  527 QDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSY------FYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP---KVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQ---TLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +++ +  P F ++ Y   + E    G  ++   A DP+  P     Y M    D+ + +     S    +    +LD E    +   +VA D   PP  G  TL ++VLD ND+ P F  ++++  I+E A VG  V  + A D D G   ++ Y    V D + L+       F I + +G I  +  L+ +  +  + L + A+D  S     +   A+V V + D N+  P  +  +         V E+Q   T  +  A I  +D D G NA +  +  +G       +  ++ G D+  ++P    D E    +++ +   D G+P  +   ++ V + D N+ +PRF    +  +V EN  +G
Sbjct:  350 RELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP---VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLD-RETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTY-----TVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR-YAIIGGNTQSQFSIDSMSG-DVSLVKP---LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVG 705          

HSP 6 Score: 61.2326 bits (147), Expect = 1.795e-30
Identity = 80/280 (28.57%), Postives = 128/280 (45.71%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN--LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-------GDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLS--TEIKINL 2472
            +D   G ++T   LDRE+  +    V+A D G P  ++A+++V IT+ DVNDN P   NP   +    E+  P   +T + A DPD              ED R   E    N    F+I   +G   +TI +SLD +    ++L +   D G    T+   I +T  D N+  P  F+   +S ++   + +     +++  A+D D   NA ITY + E         D   I+   G +     + RE    YL+ + A D GNP+LS  T+++I +
Sbjct:  739 VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP-PKSASSSVVITVQDVNDNDP-AFNPKYYEANVGEDQPPGTPVTTVTATDPD--------------EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAP-IFENAPYSASVFEDAPVGTT--VLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGV 997          

HSP 7 Score: 126.331 bits (316), Expect = 8.933e-29
Identity = 101/366 (27.60%), Postives = 166/366 (45.36%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVI-NALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-------VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            VIT+QDVND+ P F   YY+  + E    G  ++  TA+DPD +               F IT  N   LI I  +LDY+ +  +  T+ A D G        T+ I++ D N+  P+F    Y   + E+A VG  V  V+A D D G+  Q+ Y   +         DP     F I+  TG I     L+ +     + L + A DGG+        V + + DVN+  P        P  +  ++ E+  + +    +  SD D+G+N  +   L+    +  + +   V      T++ N+  DRE  + F +  +  D+G+P L++  E+ ++++DVN+  P F     T+ V ENS +G
Sbjct:  781 VITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP-----FSINPQTGAIVTNAPLD-RETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFK----SPLYQ-ASILEDALVGTSVIQVAASDPDVGLNGRIKYLLS----DRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVG 1129          

HSP 8 Score: 120.939 bits (302), Expect = 3.626e-27
Identity = 109/433 (25.17%), Postives = 182/433 (42.03%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN----------ALDYETQINYKTTLVACDCGMPP---LCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVG---EVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRD--IYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            D +    F ++  TG +  +  +DRE +    F    R       F P      + + + D NDH P F    ++  I E   VG  +    A+D D+  N    Y +    D   +     + +  I+          +LD ET  +Y   + A D             ++ + VLD NDN+P FS++ Y V + E+   G     VA++ A D D G    +RY    G  Q     S F I + +G++ L + L+ +++ + + L I A DGGS  +     + V++ D N+  P    +         +V EN  +  +   +   D D G NAE+   ++   +NF L+    V  R   + T++P    DRE    F  +++  D G P  +    + + +QDVN+  P F  + Y  NV E+   G
Sbjct:  400 DSRSQSLFKVDSRTGVVTTSASLDRELMDVHYF----RVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-----SQFSIDSMSGDVSLVKPLDYESV-RSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQF-----QESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA----VDPRTGWVQTIKP---LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPG 810          

HSP 9 Score: 110.538 bits (275), Expect = 5.932e-24
Identity = 107/353 (30.31%), Postives = 157/353 (44.48%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH-------GFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG--QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK 1543
            I I D N+  P F  + Y   + E   VG  + + +A+D DV  N   TY ++       G  D F+I        IV NA LD ET   Y  T+ A D G P L     + I V D+NDN P F    Y+  I E+A+VG  V  V A D D GL G+++Y      ++D S    F I   +G I+  + L+ +++A  F L   A D GS P      V + L+DVN+  P    +     K    V EN  + S    I   D D GVNA V  +  +G ++    +  T  G +   L      D E     F++ +  +   +P L  +  I + + DVN+ +P  +
Sbjct:  885 INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQT--GAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGS----FVIDPTSGTIRTNKGLDRESVAV-FHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASD-----KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVH-YSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAA---SPPLRNDAHIEILVTDVNDNAPVLR 1221          

HSP 10 Score: 95.1301 bits (235), Expect = 2.835e-19
Identity = 84/274 (30.66%), Postives = 127/274 (46.35%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXX--DVNDNPPT------VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNP 2442
            +F ID   G + T + LDRE  D   L+V A D    +S+  T T  + +   D NDN P        +  P+ Q    E+     +  I+A D D G N  +R+ I            I  N    FSID +SG++++ K LD E + SY L I   D G P  ++   + + V+D NDN P+++      T+   +SVL        II  QA D D   NA ITY ++E DD   + +D   G ++  + +    +G +  ++VA D G P
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT---VAHIRATDADQGNNAAIRYAI------------IGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFY------TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVP 772          

HSP 11 Score: 72.4034 bits (176), Expect = 2.861e-12
Identity = 73/273 (26.74%), Postives = 120/273 (43.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE-ETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINL 2472
            F ID   G++     LD E      L++ A D G P S++ TT + + + D NDN P        Q +E+  E +P+   + ++QA D D G N  + + I   +D   LA            +D  +G +   K LDRE    +   ++  D G P  ++  ++ +TV D+NDN P  F P  +  N+            + A   D DSR +  IT   T G   +      G +   QS+   +E  +L+ + A D+G  + +  + IN+
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTS---QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA------------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA-FNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINI 887          

HSP 12 Score: 64.3142 bits (155), Expect = 6.875e-10
Identity = 68/260 (26.15%), Postives = 122/260 (46.92%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-----SNLLYLIVINALDYE-TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVI---IKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDG 1120
            F ++ ++G +   + +DRE V     TA+  D+    L+  V +      I ++DVND  P FA     + + E   VG  +    A DPD   N V  Y + G +D+   +      S    L+ +  LDYE T+  ++  + A     PPL  +  + I V D+NDN PV   ++++VI    +++   GE +  + A D D  +  ++ YR     + ++L    +++ +G + L   LN  N+ +  ++ +  SDG
Sbjct: 1056 FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQ-----IRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVL--RDFQVIFNNFRDHFPSGE-IGRIPAFDAD--VSDKLHYRILSGNNANLLR---LNSSSGGLVLSPQLN-TNVPKFATMEVSVSDG 1298          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab2 (protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE-041118-2])

HSP 1 Score: 220.705 bits (561), Expect = 5.855e-65
Identity = 158/458 (34.50%), Postives = 237/458 (51.75%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL------LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y+V EE++ G  VGNL  D N+  +   +  F++   G   +YF L    G L + +RIDRE++C  S     +C +EL   V  P+  +   + I DVND+ P F  S   + ISE    G R +L +A D D   N+V +Y +   N+ F++   +         L++  ALD E Q   + TL A D G PP+ G   + ++V+D+NDN PVF +  YK  I EN+ +G  V  V+A D D GL G+V Y F    + + ++ F I+  TGEI ++  L+ +  A    + ++A D G  P+  +  V + + D+N+  P I+I SL        VKE+    +   +I V DGD G N  V   +   A+ F+L N  T K R  ++L  N   DREV S + V +  +D GTP L++   I V + DVN+ +PRF +    V V ENS IG
Sbjct:   33 IVYSVSEEVNTGTTVGNLAKDLNLNVQDLERRGFQIVS-GPNKQYFDLHARNGILFVRERIDREELCGRS----SKCALELEAIVSAPMSIYRFEVNILDVNDNAPTFRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVNSVKSYKLSA-NEHFSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVITVSAKDADEGLNGEVIYSFINHDNENSINAFLINPNTGEITVKGPLDYEENAA-IEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLV-----NEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRDSAQ-FRLEN--TYKNR--FSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIG 473          

HSP 2 Score: 48.9062 bits (115), Expect = 5.855e-65
Identity = 44/172 (25.58%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L +    + E+    E  V A D G P   ++  TV + + D NDN P ++ P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I+VCD G+P L++  +I   V++
Sbjct:  511 INSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVP-PLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHIS---EPKG---------NNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSATVSIDAVVVE 669          

HSP 3 Score: 108.227 bits (269), Expect = 2.190e-23
Identity = 107/392 (27.30%), Postives = 174/392 (44.39%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            +F  +D+   +  F +  +TG++ +   +D E+          R Q E     P      V I I D+ND+ P+ +      ++ E    G  + L T  D D   N V    +   +  F +  T+ N   L+V   LD E    Y  T+ A D G PPL     +A+ V D+NDN P F +    V +KEN+ +G V+  V+AVD D G   ++ Y   +  +   V S   I++ TG++   +  N + I + F   ++A+D G  P     TV V + D N+  P I    + LG    + N+  +       A I   D D G NA +  H++    N  F++  S      +I T +  R+ D ++ +H  V ++C D G P L+ 
Sbjct:  282 SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEI----RVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLVNEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRD-SAQFRLENTYKNRFSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEI-KTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKTHPLVILVC-DNGEPSLSA 659          

HSP 4 Score: 91.2781 bits (225), Expect = 4.220e-18
Identity = 87/280 (31.07%), Postives = 130/280 (46.43%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F I+   G +     LD E+   IE+ V A D+G+ PR+      + I   D+NDN P + I     +VKE+     M +  I  +D D G+NG VR  I+     R   E   +NR   FS       L +   LDRE    Y + I   D+G P L+S   I + V D+NDN P++ +PV    N+  K        +    A DPD   NA ITY + E         ++ I++  GDL + QS        +  K+ A D+G P LS+ + +N+++
Sbjct:  295 FLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEII--DLNDNTPEISIMSLVNEVKEDSAPGTM-VGLITVKDGDAGKNGVVRLQIRDSAQFR--LENTYKNR---FS-------LVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPV---INVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFV 556          

HSP 5 Score: 90.5077 bits (223), Expect = 7.933e-18
Identity = 76/264 (28.79%), Postives = 136/264 (51.52%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDRE   +  + + A D+G P   ++T+ + + ++DVNDN P    P   + VKEN + +   L  + A DPD+G+N  + + +     K G         T + +I+  +G+L   +S + E I ++   +   D G P L+S   + + VLD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV  DNG P+LS  + I+  +
Sbjct:  415 LDREVASEYNVTISAADEGTP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVGDNARITYSLLE-SSKSGPV-------TSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVC-DNGEPSLSATVSIDAVV 667          

HSP 6 Score: 53.9138 bits (128), Expect = 1.258e-6
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-------EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAII 2364
            DVNDN PT     KL +  +E+T P    T   A D D G N +V+ Y            K+  N    FS+D        +S  L + K+LDRE      L +   D GKP ++    I + V+D+NDN P + +P+ +   I   S +     +I   A D D   N  + Y     D+   I+A +
Sbjct:  127 DVNDNAPT-FRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVN-SVKSY------------KLSANEH--FSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPL-YKARIAENSAIGAS--VITVSAKDADEGLNGEVIYSFINHDNENSINAFL 296          

HSP 7 Score: 52.373 bits (124), Expect = 3.121e-6
Identity = 48/161 (29.81%), Postives = 77/161 (47.83%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPK 2196
            LDREK   I L + A+D G+P   + TT + + + DVNDN P    P  K ++ EN       +T + A+D D G NG V +               +EN    F I+  +G +T+   LD E   +  + +   D+G+    S   + + ++D+NDN P+
Sbjct:  202 LDREKQPVIRLTLTAVDGGKP-PMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVIT-VSAKDADEGLNGEVIY---------SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPE 351          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab2 (protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE-041118-2])

HSP 1 Score: 220.705 bits (561), Expect = 5.855e-65
Identity = 158/458 (34.50%), Postives = 237/458 (51.75%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL------LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y+V EE++ G  VGNL  D N+  +   +  F++   G   +YF L    G L + +RIDRE++C  S     +C +EL   V  P+  +   + I DVND+ P F  S   + ISE    G R +L +A D D   N+V +Y +   N+ F++   +         L++  ALD E Q   + TL A D G PP+ G   + ++V+D+NDN PVF +  YK  I EN+ +G  V  V+A D D GL G+V Y F    + + ++ F I+  TGEI ++  L+ +  A    + ++A D G  P+  +  V + + D+N+  P I+I SL        VKE+    +   +I V DGD G N  V   +   A+ F+L N  T K R  ++L  N   DREV S + V +  +D GTP L++   I V + DVN+ +PRF +    V V ENS IG
Sbjct:   33 IVYSVSEEVNTGTTVGNLAKDLNLNVQDLERRGFQIVS-GPNKQYFDLHARNGILFVRERIDREELCGRS----SKCALELEAIVSAPMSIYRFEVNILDVNDNAPTFRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVNSVKSYKLSA-NEHFSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVITVSAKDADEGLNGEVIYSFINHDNENSINAFLINPNTGEITVKGPLDYEENAA-IEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLV-----NEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRDSAQ-FRLEN--TYKNR--FSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIG 473          

HSP 2 Score: 48.9062 bits (115), Expect = 5.855e-65
Identity = 44/172 (25.58%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L +    + E+    E  V A D G P   ++  TV + + D NDN P ++ P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I+VCD G+P L++  +I   V++
Sbjct:  511 INSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVP-PLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHIS---EPKG---------NNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSATVSIDAVVVE 669          

HSP 3 Score: 108.227 bits (269), Expect = 2.190e-23
Identity = 107/392 (27.30%), Postives = 174/392 (44.39%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            +F  +D+   +  F +  +TG++ +   +D E+          R Q E     P      V I I D+ND+ P+ +      ++ E    G  + L T  D D   N V    +   +  F +  T+ N   L+V   LD E    Y  T+ A D G PPL     +A+ V D+NDN P F +    V +KEN+ +G V+  V+AVD D G   ++ Y   +  +   V S   I++ TG++   +  N + I + F   ++A+D G  P     TV V + D N+  P I    + LG    + N+  +       A I   D D G NA +  H++    N  F++  S      +I T +  R+ D ++ +H  V ++C D G P L+ 
Sbjct:  282 SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEI----RVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLVNEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRD-SAQFRLENTYKNRFSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEI-KTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKTHPLVILVC-DNGEPSLSA 659          

HSP 4 Score: 91.2781 bits (225), Expect = 4.220e-18
Identity = 87/280 (31.07%), Postives = 130/280 (46.43%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F I+   G +     LD E+   IE+ V A D+G+ PR+      + I   D+NDN P + I     +VKE+     M +  I  +D D G+NG VR  I+     R   E   +NR   FS       L +   LDRE    Y + I   D+G P L+S   I + V D+NDN P++ +PV    N+  K        +    A DPD   NA ITY + E         ++ I++  GDL + QS        +  K+ A D+G P LS+ + +N+++
Sbjct:  295 FLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEII--DLNDNTPEISIMSLVNEVKEDSAPGTM-VGLITVKDGDAGKNGVVRLQIRDSAQFR--LENTYKNR---FS-------LVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPV---INVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFV 556          

HSP 5 Score: 90.5077 bits (223), Expect = 7.933e-18
Identity = 76/264 (28.79%), Postives = 136/264 (51.52%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDRE   +  + + A D+G P   ++T+ + + ++DVNDN P    P   + VKEN + +   L  + A DPD+G+N  + + +     K G         T + +I+  +G+L   +S + E I ++   +   D G P L+S   + + VLD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV  DNG P+LS  + I+  +
Sbjct:  415 LDREVASEYNVTISAADEGTP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVGDNARITYSLLE-SSKSGPV-------TSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVC-DNGEPSLSATVSIDAVV 667          

HSP 6 Score: 53.9138 bits (128), Expect = 1.258e-6
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-------EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAII 2364
            DVNDN PT     KL +  +E+T P    T   A D D G N +V+ Y            K+  N    FS+D        +S  L + K+LDRE      L +   D GKP ++    I + V+D+NDN P + +P+ +   I   S +     +I   A D D   N  + Y     D+   I+A +
Sbjct:  127 DVNDNAPT-FRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVN-SVKSY------------KLSANEH--FSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPL-YKARIAENSAIGAS--VITVSAKDADEGLNGEVIYSFINHDNENSINAFL 296          

HSP 7 Score: 52.373 bits (124), Expect = 3.121e-6
Identity = 48/161 (29.81%), Postives = 77/161 (47.83%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPK 2196
            LDREK   I L + A+D G+P   + TT + + + DVNDN P    P  K ++ EN       +T + A+D D G NG V +               +EN    F I+  +G +T+   LD E   +  + +   D+G+    S   + + ++D+NDN P+
Sbjct:  202 LDREKQPVIRLTLTAVDGGKP-PMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVIT-VSAKDADEGLNGEVIY---------SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPE 351          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab2 (protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE-041118-2])

HSP 1 Score: 220.705 bits (561), Expect = 5.855e-65
Identity = 158/458 (34.50%), Postives = 237/458 (51.75%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL------LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y+V EE++ G  VGNL  D N+  +   +  F++   G   +YF L    G L + +RIDRE++C  S     +C +EL   V  P+  +   + I DVND+ P F  S   + ISE    G R +L +A D D   N+V +Y +   N+ F++   +         L++  ALD E Q   + TL A D G PP+ G   + ++V+D+NDN PVF +  YK  I EN+ +G  V  V+A D D GL G+V Y F    + + ++ F I+  TGEI ++  L+ +  A    + ++A D G  P+  +  V + + D+N+  P I+I SL        VKE+    +   +I V DGD G N  V   +   A+ F+L N  T K R  ++L  N   DREV S + V +  +D GTP L++   I V + DVN+ +PRF +    V V ENS IG
Sbjct:   33 IVYSVSEEVNTGTTVGNLAKDLNLNVQDLERRGFQIVS-GPNKQYFDLHARNGILFVRERIDREELCGRS----SKCALELEAIVSAPMSIYRFEVNILDVNDNAPTFRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVNSVKSYKLSA-NEHFSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVITVSAKDADEGLNGEVIYSFINHDNENSINAFLINPNTGEITVKGPLDYEENAA-IEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLV-----NEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRDSAQ-FRLEN--TYKNR--FSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIG 473          

HSP 2 Score: 48.9062 bits (115), Expect = 5.855e-65
Identity = 44/172 (25.58%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L +    + E+    E  V A D G P   ++  TV + + D NDN P ++ P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I+VCD G+P L++  +I   V++
Sbjct:  511 INSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVP-PLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHIS---EPKG---------NNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSATVSIDAVVVE 669          

HSP 3 Score: 108.227 bits (269), Expect = 2.190e-23
Identity = 107/392 (27.30%), Postives = 174/392 (44.39%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            +F  +D+   +  F +  +TG++ +   +D E+          R Q E     P      V I I D+ND+ P+ +      ++ E    G  + L T  D D   N V    +   +  F +  T+ N   L+V   LD E    Y  T+ A D G PPL     +A+ V D+NDN P F +    V +KEN+ +G V+  V+AVD D G   ++ Y   +  +   V S   I++ TG++   +  N + I + F   ++A+D G  P     TV V + D N+  P I    + LG    + N+  +       A I   D D G NA +  H++    N  F++  S      +I T +  R+ D ++ +H  V ++C D G P L+ 
Sbjct:  282 SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEI----RVQAEDKGQNPRASHCKVLIEIIDLNDNTPEISIMSLVNEVKEDSAPGTMVGLITVKDGDAGKNGVVRLQIRD-SAQFRLENTYKNRFSLVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEI-KTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKTHPLVILVC-DNGEPSLSA 659          

HSP 4 Score: 91.2781 bits (225), Expect = 4.220e-18
Identity = 87/280 (31.07%), Postives = 130/280 (46.43%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F I+   G +     LD E+   IE+ V A D+G+ PR+      + I   D+NDN P + I     +VKE+     M +  I  +D D G+NG VR  I+     R   E   +NR   FS       L +   LDRE    Y + I   D+G P L+S   I + V D+NDN P++ +PV    N+  K        +    A DPD   NA ITY + E         ++ I++  GDL + QS        +  K+ A D+G P LS+ + +N+++
Sbjct:  295 FLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEII--DLNDNTPEISIMSLVNEVKEDSAPGTM-VGLITVKDGDAGKNGVVRLQIRDSAQFR--LENTYKNR---FS-------LVVNGPLDREVASEYNVTISAADEGTPPLSSTSVIAVHVSDVNDNAPRFPEPV---INVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFV 556          

HSP 5 Score: 90.5077 bits (223), Expect = 7.933e-18
Identity = 76/264 (28.79%), Postives = 136/264 (51.52%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDRE   +  + + A D+G P   ++T+ + + ++DVNDN P    P   + VKEN + +   L  + A DPD+G+N  + + +     K G         T + +I+  +G+L   +S + E I ++   +   D G P L+S   + + VLD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV  DNG P+LS  + I+  +
Sbjct:  415 LDREVASEYNVTISAADEGTP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVGDNARITYSLLE-SSKSGPV-------TSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVC-DNGEPSLSATVSIDAVV 667          

HSP 6 Score: 53.9138 bits (128), Expect = 1.258e-6
Identity = 56/189 (29.63%), Postives = 82/189 (43.39%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-------EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAII 2364
            DVNDN PT     KL +  +E+T P    T   A D D G N +V+ Y            K+  N    FS+D        +S  L + K+LDRE      L +   D GKP ++    I + V+D+NDN P + +P+ +   I   S +     +I   A D D   N  + Y     D+   I+A +
Sbjct:  127 DVNDNAPT-FRTSKLFLNISEQTYPGQRFTLPSAFDLDAGVN-SVKSY------------KLSANEH--FSLDVQSAGDQSVSAELVLQKALDREKQPVIRLTLTAVDGGKPPMSGTTQIIVNVVDVNDNIPVFDKPL-YKARIAENSAIGAS--VITVSAKDADEGLNGEVIYSFINHDNENSINAFL 296          

HSP 7 Score: 52.373 bits (124), Expect = 3.121e-6
Identity = 48/161 (29.81%), Postives = 77/161 (47.83%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPK 2196
            LDREK   I L + A+D G+P   + TT + + + DVNDN P    P  K ++ EN       +T + A+D D G NG V +               +EN    F I+  +G +T+   LD E   +  + +   D+G+    S   + + ++D+NDN P+
Sbjct:  202 LDREKQPVIRLTLTAVDGGKP-PMSGTTQIIVNVVDVNDNIPVFDKPLYKARIAENSAIGASVIT-VSAKDADEGLNGEVIY---------SFINHDNENSINAFLINPNTGEITVKGPLDYEENAAIEIRVQAEDKGQNPRASHCKVLIEIIDLNDNTPE 351          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab11 (protocadherin 2 alpha b 11 [Source:ZFIN;Acc:ZDB-GENE-041118-10])

HSP 1 Score: 216.853 bits (551), Expect = 1.095e-63
Identity = 155/457 (33.92%), Postives = 239/457 (52.30%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNL--NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            Y V EE + G  VGNL  + + NI  ++ +  F +   G   +YF + + TG L + +RIDRE++C  +     +C + L   +  P++ +   + + D+ND+ P F  S   + ISE    G R  L+ A D DV  N++ +Y +   N+ F++        S    L++  ALD E Q   + TL A D G PP  G+  + ++VLDINDN PVFS+  YK  + ENA  G  V  V AVD+D G+ G++ Y      +   +  F I++ TGEI +Q+ ++ +       L I+A D G  PK  +  V V + DVN+  PVI++ SL        VKE+  + +   +I V+D D G N +V  ++  G+  FK+ NS     ++ YTL  N   DRE  S + V +  +D G+P L++   I V + DVN+ +PRF +    V V ENS IG
Sbjct:   31 YTVSEEANPGTTVGNLVKDFNLNIQDLEARG-FHIVR-GPNERYFDVNKKTGILHVKERIDREEICEQNI----KCSLPLEAMISSPLNVFRFEVNVVDINDNAPAFRTSVTHLNISELTFPGERFPLQGAFDADVGSNSLKSYKLSQ-NEHFSLDVQGGGDQSVSAELVLQKALDREKQAVIQLTLTAVDGGKPPKSGSIEIIVNVLDINDNTPVFSKSLYKSKVTENAARGTHVITVKAVDLDEGVNGEIIYSIINPNNDKNVDAFSINSVTGEITVQKDVDFEQ-RNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDNIPVISVTSLVST-----VKEDAPIGTMVGMITVTDNDAGKNGQVTLNIE-GSVPFKVQNSY----KNYYTLVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIG 469          

HSP 2 Score: 48.9062 bits (115), Expect = 1.095e-63
Identity = 44/172 (25.58%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L +    + E+    E  V A D G P   ++  TV + + D NDN P ++ P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I+VCD G+P L++  +I   V++
Sbjct:  507 INSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVP-PLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHIS---EPKG---------NNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSATVSIDAVVVE 665          

HSP 3 Score: 112.849 bits (281), Expect = 7.343e-25
Identity = 108/390 (27.69%), Postives = 176/390 (45.13%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI------FVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            K +  FS+   TG++ + + +D EQ          R  IEL I      + P      V + + DVND+ P  + +     + E   +G  + + T +D D   N   T  + G +  F +  ++ N   L+V   LD E    Y  T+ A D G PPL     +A+ V D+NDN P F +    V +KEN+ +G V+  V+AVD D G   ++ Y   +  +   V S   I++ TG++   +  N + I + F   ++A+D G  P     TV V + D N+  P I    + LG    + N+  +       A I   D D G NA +  H++    N  F++  S      +I T +  R+ D ++ +H  V ++C D G P L+ 
Sbjct:  286 KNVDAFSINSVTGEITVQKDVDFEQ----------RNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDNIPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNIEG-SVPFKVQNSYKNYYTLVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEI-KTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKTHPLVILVC-DNGEPSLSA 655          

HSP 4 Score: 92.4337 bits (228), Expect = 1.608e-18
Identity = 76/264 (28.79%), Postives = 137/264 (51.89%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDRE+  +  + + A D+G P   ++T+ + + ++DVNDN P    P   + VKEN + +   L  + A DPD+G+N  + + +     K G         T + +I+  +G+L   +S + E I ++   +   D G P L+S   + + VLD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV  DNG P+LS  + I+  +
Sbjct:  411 LDRERASEYNVTISAADEGSP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVGDNARITYSLLE-SSKSGPV-------TSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVC-DNGEPSLSATVSIDAVV 663          

HSP 5 Score: 83.9593 bits (206), Expect = 5.574e-16
Identity = 77/288 (26.74%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1645 PTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG-EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            P   K+   F I+   G +     +D E+ + IEL + A D+G  P++      V +   DVNDN P +     +   + +  +   +  I   D D G+NG V   I+       +  K+  +    ++       L +   LDRE    Y + I   D+G P L+S   I + V D+NDN P++ +PV    N+  K        +    A DPD   NA ITY + E         ++ I++  GDL + QS        +  K+ A D+G P LS+ + +N+++
Sbjct:  282 PNNDKNVDAFSINSVTGEITVQKDVDFEQRNAIELRIQAKDKGYNPKAAHCKVLVEVV--DVNDNIPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNIEG-----SVPFKVQNSYKNYYT-------LVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPV---INVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFV 552          

HSP 6 Score: 55.8398 bits (133), Expect = 2.592e-7
Identity = 71/269 (26.39%), Postives = 122/269 (45.35%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTK---IFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNI--TTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLV--------YIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDREK   I+L + A+D G+P  ++ +  + + + D+NDN P       K +V EN       +T ++A D D G NG + + I            I+ N  K    FSI+ ++G +T+ K +D E  ++  L I   D+G     +   + + V+D+NDN      PV   T++  T K        + +   +D D+  N  +T ++ EG            Y   ++     R+  R   Y + + A D G+P LS+   I +++S
Sbjct:  198 LDREKQAVIQLTLTAVDGGKP-PKSGSIEIIVNVLDINDNTPVFSKSLYKSKVTENAARGTHVIT-VKAVDLDEGVNGEIIYSI------------INPNNDKNVDAFSINSVTGEITVQKDVDFEQRNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDN-----IPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNI-EGSVPFKVQNSYKNYYTLVVNGPLDRE--RASEYNVTISAADEGSPPLSSTSVIAVHVS 444          
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Match: pcdh2ab9 (protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GENE-041118-8])

HSP 1 Score: 216.468 bits (550), Expect = 1.249e-63
Identity = 155/457 (33.92%), Postives = 239/457 (52.30%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNL--NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            Y V EE + G  VGNL  + + NI  ++ +  F +   G   +YF + + TG L + +RIDRE++C  +     +C + L   +  P++ +   + + D+ND+ P F  S   + ISE    G R  L+ A D DV  N++ +Y +   N+ F++        S    L++  ALD E Q   + TL A D G PP  G+  + ++VLDINDN PVFS+  YK  + ENA  G  V  V AVD+D G+ G++ Y      +   +  F I++ TGEI +Q+ ++ +       L I+A D G  PK  +  V V + DVN+  PVI++ SL        VKE+  + +   +I V+D D G N +V  ++  G+  FK+ NS     ++ YTL  N   DRE  S + V +  +D G+P L++   I V + DVN+ +PRF +    V V ENS IG
Sbjct:   31 YTVSEEANPGTTVGNLVKDFNLNIQDLEARG-FHIVR-GPNERYFDVNKKTGILHVKERIDREEICEQNI----KCSLPLEAMISSPLNVFRFEVNVVDINDNAPAFRTSVTHLNISELTFPGERFPLQGAFDADVGSNSLKSYKLSQ-NEHFSLDVQGGGDQSVSAELVLQKALDREKQAVIQLTLTAVDGGKPPKSGSIEIIVNVLDINDNTPVFSKSLYKSKVTENAARGTHVITVKAVDLDEGVNGEIIYSIINPNNDKNVDAFSINSVTGEITVQKDVDFEQ-RNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDNIPVISVTSLVST-----VKEDAPIGTMVGMITVTDNDAGKNGQVTLNIE-GSVPFKVQNSY----KNYYTLVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIG 469          

HSP 2 Score: 48.9062 bits (115), Expect = 1.249e-63
Identity = 44/172 (25.58%), Postives = 78/172 (45.35%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L +    + E+    E  V A D G P   ++  TV + + D NDN P ++ P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I+VCD G+P L++  +I   V++
Sbjct:  507 INSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVP-PLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHIS---EPKG---------NNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVCDNGEPSLSATVSIDAVVVE 665          

HSP 3 Score: 112.849 bits (281), Expect = 9.995e-25
Identity = 108/390 (27.69%), Postives = 176/390 (45.13%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI------FVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ-VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            K +  FS+   TG++ + + +D EQ          R  IEL I      + P      V + + DVND+ P  + +     + E   +G  + + T +D D   N   T  + G +  F +  ++ N   L+V   LD E    Y  T+ A D G PPL     +A+ V D+NDN P F +    V +KEN+ +G V+  V+AVD D G   ++ Y   +  +   V S   I++ TG++   +  N + I + F   ++A+D G  P     TV V + D N+  P I    + LG    + N+  +       A I   D D G NA +  H++    N  F++  S      +I T +  R+ D ++ +H  V ++C D G P L+ 
Sbjct:  286 KNVDAFSINSVTGEITVQKDVDFEQ----------RNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDNIPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNIEG-SVPFKVQNSYKNYYTLVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEI-KTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTE-NIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKTHPLVILVC-DNGEPSLSA 655          

HSP 4 Score: 92.4337 bits (228), Expect = 1.855e-18
Identity = 76/264 (28.79%), Postives = 137/264 (51.89%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDRE+  +  + + A D+G P   ++T+ + + ++DVNDN P    P   + VKEN + +   L  + A DPD+G+N  + + +     K G         T + +I+  +G+L   +S + E I ++   +   D G P L+S   + + VLD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV  DNG P+LS  + I+  +
Sbjct:  411 LDRERASEYNVTISAADEGSP-PLSSTSVIAVHVSDVNDNAPRFPEPVINVYVKENSQ-IGAVLHTVSAVDPDVGDNARITYSLLE-SSKSGPV-------TSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFVLDENDNSPAILAPYSELGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYHISEPKGNNLFRIGTSSGEIRTKRRMSDNDLKTHPLVILVC-DNGEPSLSATVSIDAVV 663          

HSP 5 Score: 84.3445 bits (207), Expect = 6.225e-16
Identity = 77/288 (26.74%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1645 PTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG-EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            P   K+   F I+   G +     +D E+ + IEL + A D+G  P++      V +   DVNDN P +     +   + +  +   +  I   D D G+NG V   I+       +  K+  +    ++       L +   LDRE    Y + I   D+G P L+S   I + V D+NDN P++ +PV    N+  K        +    A DPD   NA ITY + E         ++ I++  GDL + QS        +  K+ A D+G P LS+ + +N+++
Sbjct:  282 PNNDKNVDAFSINSVTGEITVQKDVDFEQRNAIELRIQAKDKGYNPKAAHCKVLVEVV--DVNDNIPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNIEG-----SVPFKVQNSYKNYYT-------LVVNGPLDRERASEYNVTISAADEGSPPLSSTSVIAVHVSDVNDNAPRFPEPV---INVYVKENSQIGAVLHTVSAVDPDVGDNARITYSLLESSKSGPVTSMININSDTGDLHSLQSFNYEEIKTFEFKVQATDSGVPPLSSNVTVNVFV 552          

HSP 6 Score: 56.225 bits (134), Expect = 2.223e-7
Identity = 71/269 (26.39%), Postives = 122/269 (45.35%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTK---IFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNI--TTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLV--------YIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDREK   I+L + A+D G+P  ++ +  + + + D+NDN P       K +V EN       +T ++A D D G NG + + I            I+ N  K    FSI+ ++G +T+ K +D E  ++  L I   D+G     +   + + V+D+NDN      PV   T++  T K        + +   +D D+  N  +T ++ EG            Y   ++     R+  R   Y + + A D G+P LS+   I +++S
Sbjct:  198 LDREKQAVIQLTLTAVDGGKP-PKSGSIEIIVNVLDINDNTPVFSKSLYKSKVTENAARGTHVIT-VKAVDLDEGVNGEIIYSI------------INPNNDKNVDAFSINSVTGEITVQKDVDFEQRNAIELRIQAKDKGYNPKAAHCKVLVEVVDVNDN-----IPVISVTSLVSTVKEDAPIGTMVGMITVTDNDAGKNGQVTLNI-EGSVPFKVQNSYKNYYTLVVNGPLDRE--RASEYNVTISAADEGSPPLSSTSVIAVHVS 444          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 2.220e-60
Identity = 132/456 (28.95%), Postives = 223/456 (48.90%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKS-TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTF------NITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + Y++ EE  +G  +GN+  D  +   +  S  F +    K  +Y ++    G L +A RIDRE +C           IE  +  P+ ++   + IQDVND+ P F++S ++I ISE   VG   +L +A DPD+  N++ +Y +   ND F      N        L++   LD E + +    L A D G P   G   + I V DINDN+P+F++  Y+V + EN  +G +V ++ A D D G   ++ Y F  + + +    F I+   G +++   L+ + +A ++ + +EA DGG +  V Y  + + + DVN+  P I I S         + E+  + +  A++ + D D G N EV     VG  +  L         + Y L  +   DRE  S + + +   D+G+P+LT  + I + + DVN+ +P F K +Y   + EN+  G
Sbjct:   34 LQYSIYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKK-QYLNVHLENGDLYVADRIDREALCGMQQNCF--LNIEAVMESPLHFYTINVEIQDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSA-NDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPE-NAQEVFAINPENGSVQITGKLDYE-VATNYEMTVEAKDGGGL--VSYCKLLIQVSDVNDNAPDILITSFSDI-----IPEDSRVGTVIALVNLDDLDSGENGEV-----VGQISESLPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSG 471          

HSP 2 Score: 73.1738 bits (178), Expect = 2.220e-60
Identity = 88/321 (27.41%), Postives = 146/321 (45.48%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQ-VKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKI-DENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHST---------NITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIREGHYL---IKLVANDNGNPNLSTEIKINLYISSKSTFSTVI-----------NISDDQFRVVIVIAMVT 2559
            I+   G L      D EK    E  + A D+G P+  T   T+ + +TDVNDN P       +  ++EN  +   F  ++ A D D+ ENG V + I        L + I D   +   SI+ +SG L   +S D E +  + + +M  D G P  ++   + + + D NDN PK   P   S          + +TK  L    +++   A D DS  NA ++YH+ +  D   + I    G++R  + ++E   L   I ++  DNG P LS+ + +NL ++    F  V+           + S+  F +VI IA+++
Sbjct:  510 INTVSGVLYAQRSFDYEKLR--EFYIQAEDKGSPQ-LTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFF-RVHATDSDINENGKVVYMI--------LTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLV--TKVV---AVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVVAEN--FQQVLPEITNQHIDTESSSNATFYLVISIALIS 811          

HSP 3 Score: 118.242 bits (295), Expect = 2.934e-26
Identity = 115/371 (31.00%), Postives = 175/371 (47.17%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND-------TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNC-KNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVDCH-LTVGAENFKLSNS---QTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I + D+ND+ P F +  Y++ +SE V +G+ +    A+D D   N   TY    FND        F I   N    I    LDYE   NY+ T+ A D G   L     L I V D+NDN P      +  II E++ VG V+A V   D+DSG  G+V    GQ+ +   L +  IS+     KL   ++  +    ++++ I+A D GS       T+ + L DVN+  PV +       K D+   ++EN    + F  +  +D DI  N +V    LT   E+  +S+     TV G     L   R FD E    F ++    D+G+P+LT  + I + + DVN+ +P F+K +Y   + EN+  G
Sbjct:  233 IVVTDINDNYPLFNKDTYRVTVSENVPIGFLVIDLHATDADEGSNAEITYL---FNDIPENAQEVFAINPENGSVQIT-GKLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEV---VGQISES--LPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFD-------KMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSG----VLYAQRSFDYEKLREFYIQ--AEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSG 579          

HSP 4 Score: 102.449 bits (254), Expect = 2.166e-21
Identity = 101/356 (28.37%), Postives = 156/356 (43.82%), Query Frame = 2
Query:  497 IDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNN-VCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVDCH-LTVGAENFKLSNS---QTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            + Y   +I + DVND+ P    + +   I E  +VG  I+L    D D   N  V              +  N   L+    LD E    Y  T+ A D G P L  ++T+ + + D+NDN PVF + +Y   I+EN   G     V A D D    G+V Y      ++D  + SY  I+T +G +  QR  + + + + +   I+A D GS       T+ + L DVN+  PV         K D+   ++EN    S F  +  +D DI  N +V    LT   E+  LS+     TV G     L   R FD E    F ++++  D G+P  +    + + I D N+ +P+
Sbjct:  331 VSYCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFY---IQAEDKGSPQLTNNKTIRLILTDVNDNAPVFE-------KMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSG----VLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPK 672          

HSP 5 Score: 91.2781 bits (225), Expect = 5.300e-18
Identity = 115/428 (26.87%), Postives = 186/428 (43.46%), Query Frame = 2
Query:  374 FSLEESTG---KLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG-------FNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-------IWVSDGDIGVNAEVDCH-LTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQ-VRMLCSDRGTPKLTTEEEITVKI-QDVNEFSPRFKKQNYTVNVSENST 1582
            F L  S+G   KL+ +  +DRE+    + T  A D+   +LT    I      + + DVND+ P F +  Y   I E    G       A+DPD+  N    Y +          +   +I T S +LY     + DYE    +   + A D G P L  N+T+ + + D+NDN PVF + +Y   I+EN   G     V A D D    G+V Y      ++D  + SY  I+T +G +  QR  + +++ ++F + + A D GS  +   ATV + + D N+  P I    L P+ +D         + HF+        +   D D G NA +  H L V   +F +    T + R    LQ       E D+  Q + ++  D G P L++   + + + ++  +  P    Q+     S N+T
Sbjct:  395 FHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIR-----LILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLY--AQRSFDYEKLREFY--IQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESL-REFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKI----LYPS-QDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQ-------ETDALRQRIVVMVKDNGYPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNAT 800          

HSP 6 Score: 67.0106 bits (162), Expect = 1.611e-10
Identity = 70/254 (27.56%), Postives = 107/254 (42.13%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM-------HGFNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP--VFSQKEYKV-----IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRIL 1066
            +D  +  Y S+   +G L   +  D E++      A D+   +LT    I      + + DVND+ P F +  Y   I E    G       A+D D+  N    Y +          +   +I T S +LY     + DYE+   +   ++A D G P    N T+ I + D NDN P  ++  ++ +       I   +  G +V  V AVD DSG    + Y   QV DP   S+  I   TGEI++ R L
Sbjct:  500 EDIPISSYVSINTVSGVLYAQRSFDYEKLREFYIQAEDKGSPQLTNNKTIR-----LILTDVNDNAPVFEKMDYVAYIQENNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLY--AQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDP---SFLIIGQNTGEIRITRDL 743          

HSP 7 Score: 58.9214 bits (141), Expect = 4.885e-8
Identity = 64/233 (27.47%), Postives = 106/233 (45.49%), Query Frame = 1
Query: 1630 RTIAIPTRSKSKCLFFIDQYM--GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE-ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            R   I +RSK +   +++ ++  G+L  A+ +DRE    ++       +    S     T+ + I DVNDN P+  +    ++  +E   +        A+DPDLG N +++ Y     D  G+ EK++ +  K          L + K+LDRE  +S +L +   D G P  T    I + V DINDN P + +    +  +T    +     +I   A+D D   NA ITY
Sbjct:   65 RKFHIVSRSKKQ---YLNVHLENGDLYVADRIDREALCGMQQNCFLNIEAVMESPLHFYTINVEIQDVNDNSPS-FSKSIFEISISELAVVGTHFALGSAKDPDLG-NNSIQSYKLSANDYFGMLEKVNTDGRKY-------PELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNK---DTYRVTVSENVPIGFLVIDLHATDADEGSNAEITY 282          

HSP 8 Score: 55.8398 bits (133), Expect = 4.018e-7
Identity = 76/286 (26.57%), Postives = 120/286 (41.96%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN---LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDL-----VYIDAIIGDLRARQS-----IREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            +F I+   G+++    LD E     E+ V A D G   S      + I ++DVNDN P ++      +   +  +   +  +   D D GENG V               +I E+    F +   SGN   L     LDRE    Y + I   D+G PQLT+ + I L + D+NDN P  F  + +   I   +            A+DPD   N  + Y +     +D+     V I+ + G L A++S     +RE +    + A D G+P L+    I L ++
Sbjct:  294 VFAINPENGSVQITGKLDYEVATNYEMTVEAKDGGGLVS---YCKLLIQVSDVNDNAPDILITSFSDIIPEDSRVGTVIALVNLDDLDSGENGEV-------------VGQISESLP--FHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAP-VFDKMDYVAYIQENN--PSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFY----IQAEDKGSPQLTNNKTIRLILT 554          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000027726.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:18387424:18390648:1 gene:ENSXETG00000012659.1 transcript:ENSXETT00000027726.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 200.675 bits (509), Expect = 1.066e-58
Identity = 147/460 (31.96%), Postives = 234/460 (50.87%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLL-KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-------FMHGFNDTFN-ITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +HY++ EE+  G+ +GNL  D  +  ++  +  KL    ++  KYF +    G L +A RIDRE +C     A + C +     +  P++ +   I I+D+ND+ P+F     +++ISE    G R  L+ A D DV  N++ TY       F+ G   + N  TF  L   I+  +LD ETQ N++  L A D G P   G   + I V D NDN PVF+Q+ YKV I EN  +   V +V + D D G+  Q+ Y F      +VL  F I+   GEIK +  ++ +   + + ++I+A DGG +  V +A V + + D N+  P I+I S+        + E+    +  A+I   D D G N EVDC + +G   FKL ++      + Y +      DRE  SH+ + +  +D+G+P L+  + I + + D+N+  P F+   Y   VSEN+  G
Sbjct:   27 LHYSIFEEMQKGSLIGNLANDLGL-NVKEIANRKLRIVSRVSEKYFKVNLGNGNLNVADRIDREALC----EAREECFLTFDAVIENPLNIFHVRIDIKDINDNSPRFIRQITELEISEHTSPGARFLLQNAEDLDVGMNSIVTYKLSANKHFVLGEKKSTNGRTFPEL---ILQTSLDRETQSNHELILTASDGGNPVQTGTTLIKIIVTDFNDNVPVFTQEVYKVNIHENIPINSTVLHVNSSDKDEGINAQITYSFSTAAT-NVLRMFTINPNNGEIKTKGNVDFEE-TKYYDISIQAEDGGGL--VAHAKVLIEIIDENDNVPEISITSITTP-----ISEDSASGTLVALIEAHDLDSGENGEVDCQI-IGVGPFKLLSTSG----NFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSYRKTIRLDVLDINDNPPVFQTSTYIAYVSENNQPG 464          

HSP 2 Score: 48.9062 bits (115), Expect = 1.066e-58
Identity = 43/173 (24.86%), Postives = 77/173 (44.51%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G +      D E+  + E+ ++A D G P S  ++  V I + D NDN PTV+ P P +      E +P        +T++ A D D G N  + ++             + ++ T  F ID+ +G +   +      +  + + ++V D G P L++   +TL V D
Sbjct:  503 INPVTGVIYAQRSFDYEEDREFEIQIMAKDNGSP-SMNSSAIVRICVVDQNDNSPTVLYPSPDVGGSAAYEMVPFSSEQGTLVTKVVAVDADSGHNAWLSYHF------------LQDSETSRFIIDQYTGEIRTSQVFQERDVLRHKVVVIVKDNGTPSLSATVTLTLVVAD 662          

HSP 3 Score: 97.4413 bits (241), Expect = 6.833e-20
Identity = 101/347 (29.11%), Postives = 159/347 (45.82%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI--TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL---GPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKG-RDIYT--LQPNRVF-DREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQD 1516
            +I I D ND+ P+ + +     ISE    G  ++L  A D D   N      + G    F +  T  N   ++  + LD E   +Y  T+ A D G PPL   +T+ + VLDINDN PVF    Y   + EN   G  + ++ A+D D+   G++ Y       ++ S  SY  I+  TG I  QR  + +   ++F + I A D GS      A V + + D N+  P +   S    G A  +      E  TL++    +   D D G NA +  H         L +S+T +   D YT  ++ ++VF +R+V  H +V ++  D GTP L+    +T+ + D
Sbjct:  330 LIEIIDENDNVPEISITSITTPISEDSASGTLVALIEAHDLDSGENGEVDCQIIGVG-PFKLLSTSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSYRKTIRLDVLDINDNPPVFQTSTYIAYVSENNQPGASIYSIQAIDKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEE-DREFEIQIMAKDNGSPSMNSSAIVRICVVDQNDNSPTVLYPSPDVGGSAAYEMVPFSSEQGTLVTKVVAV---DADSGHNAWLSYHF--------LQDSETSRFIIDQYTGEIRTSQVFQERDVLRH-KVVVIVKDNGTPSLSATVTLTLVVAD 662          

HSP 4 Score: 78.9518 bits (193), Expect = 2.875e-14
Identity = 81/307 (26.38%), Postives = 138/307 (44.95%), Query Frame = 1
Query: 1705 TANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQ-VKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDE-NRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDDL--VYIDAIIGDLRARQSIREGHYL---IKLVANDNGNPNLSTEIKINLYISSKSTFSTVI-----------NISDDQFRVVIVIAMVT 2559
            T + LDRE+     + + A D+G P   +   T+ + + D+NDNPP       +  V EN +     +  IQA D D  ENG + + I        +    +E + T   SI+ ++G +   +S D E    + + IM  D G P + S   + + V+D NDN P    P           ++  + +Q  ++ +  A D DS  NA ++YH  +  +     ID   G++R  Q  +E   L   + ++  DNG P+LS  + + L ++    F  VI           + S+ Q  +VI IA+++
Sbjct:  402 TTSTLDRERSSHYNITIQATDKGSP-PLSYRKTIRLDVLDINDNPPVFQTSTYIAYVSENNQP-GASIYSIQAIDKDTEENGKLFYSI--------ITSNTEEISSTSYISINPVTGVIYAQRSFDYEEDREFEIQIMAKDNGSPSMNSSAIVRICVVDQNDNSPTVLYPSPDVGGSAAYEMVPFSSEQGTLVTKVVAVDADSGHNAWLSYHFLQDSETSRFIIDQYTGEIRTSQVFQERDVLRHKVVVIVKDNGTPSLSATVTLTLVVADN--FQHVIPEISNQPMKSDSQSNMQIYLVIAIALIS 696          

HSP 5 Score: 61.6178 bits (148), Expect = 7.229e-9
Identity = 75/284 (26.41%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN---LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +F I+   G ++T   +D E+    ++ + A D G      A   V I I D NDN P + I      + E+  +    +  I+A D D GENG V   I  V                 F +   SGN   +    +LDRE    Y + I   D+G P L+  + I L VLDINDNPP  FQ   +   ++  +       I   QA D D+  N  + Y +   +         + I+ + G + A++S     +  + I+++A DNG+P++++   + + +
Sbjct:  287 MFTINPNNGEIKTKGNVDFEETKYYDISIQAEDGG---GLVAHAKVLIEIIDENDNVPEISITSITTPISEDSAS-GTLVALIEAHDLDSGENGEVDCQIIGVGP---------------FKLLSTSGNFYKIVTTSTLDRERSSHYNITIQATDKGSPPLSYRKTIRLDVLDINDNPP-VFQTSTYIAYVSENN--QPGASIYSIQAIDKDTEENGKLFYSIITSNTEEISSTSYISINPVTGVIYAQRSFDYEEDREFEIQIMAKDNGSPSMNSSAIVRICV 548          

HSP 6 Score: 51.2174 bits (121), Expect = 9.935e-6
Identity = 70/232 (30.17%), Postives = 99/232 (42.67%), Query Frame = 1
Query: 1630 RTIAIPTRSKSKCLFFIDQYMGNLRTANILDREK-GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            R + I +R   K  F ++   GNL  A+ +DRE   +  E   L  D     +      V I I D+NDN P  I    +L++ E+      FL Q  A D D+G N  V + +        L EK   N  + F        L +  SLDRE   ++ L +   D G P  T    I + V D NDN P + Q V +  NI     +  +  ++   +SD D   NA ITY
Sbjct:   58 RKLRIVSRVSEK-YFKVNLGNGNLNVADRIDREALCEAREECFLTFD-AVIENPLNIFHVRIDIKDINDNSPRFIRQITELEISEHTSPGARFLLQ-NAEDLDVGMNSIVTYKLS-ANKHFVLGEKKSTN-GRTFP------ELILQTSLDRETQSNHELILTASDGGNPVQTGTTLIKIIVTDFNDNVPVFTQEV-YKVNIHEN--IPINSTVLHVNSSDKDEGINAQITY 275          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh20 (protocadherin 20 [Source:NCBI gene;Acc:100101710])

HSP 1 Score: 159.458 bits (402), Expect = 2.228e-58
Identity = 132/457 (28.88%), Postives = 219/457 (47.92%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDS--NIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIA-QRIDREQVCPTSFTALDRCQIELTIFVPIDYW--INV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLR-TASDPDVEPNNVCTYFMHGFNDTF------NITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKD-FNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            Y ++E +  G  +G++  D   ++F   P  +F L   G   KY +L  STG+L  + + +DRE +CP S  A +   +   I +P +Y+  I V I I D+ND+ P F      I + E   V  RI +   A DPD   N V TY +  ++  F      N +     YLI++  LD ET+  Y+TT++A D G PPL G+ TL+I + D+NDN P F+  +    +  N+ +G  V  V A+D D G    + Y F +    +V  YF++    G IKL + ++   + Q   L I A+  G +P V   TVF+ +  +  + P +    +   +     +KE + + S  A   + D D     +V+C+L  G   F+LS  +       Y L+     D E+   + + ++   R   ++  ++ + V+I D N+ SP F +    + + EN
Sbjct:   45 YTLQEGLPKGVHIGSIGDDLQLDVFA-DPPLSFSLASKGLSEKYVNLNNSTGELCTSSEELDREALCPHSLVAQECVLLLDIIILPQEYFRLIKVKIAIIDINDNAPHFPVPQIYISVPENAPVNTRIVIEHPAYDPDGGTNGVQTYRLVDYHGVFTLDVEENESGERTPYLIIMGPLDRETKAEYETTIIAEDGGSPPLVGSATLSILISDVNDNCPQFNASQINATLYGNSTIGTQVVTVHAMDRDLGPNALITYAFSERVPQAVKEYFHLDELKGIIKLSKRIDGSTV-QQHKLTILANGPGCIPAV--ITVFISINKITFRPPELIPRYIANEENGVIYLKELEPVHSPLAFFTIKDPD--EKYQVNCYLE-GQGPFRLSAFKPYNNE--YLLETTDALDYELKQSYNIAVVALSRDGHQV--KKLLKVQILDENDNSPVFTESTVEITIEEN 490          

HSP 2 Score: 88.9669 bits (219), Expect = 2.228e-58
Identity = 88/285 (30.88%), Postives = 129/285 (45.26%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT----EGDDLVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPN-LSTEIKINLYISSKST 2493
            F +D   G L  + ILDRE+ +K    V A D G P S+ +  TV IT+ D NDN P  I+      V EN    P F  +  I   D D G+NG +   I               N + IF ID   G L    SLDRE   SY L++   D G P L+S   IT+ +LD+NDNPP    P ++ + +           +    A D D+  NA I Y +        +   ID I G++   +++     G Y + +  +D+G P  L + + +NL+++   T
Sbjct:  525 FTLDSVTGILSVSTILDREEKEKYRFTVKARDAGFP-SRESVATVHITVLDKNDNNPRFISKDFSFFVPEN---FPGFGEIGVISVTDADSGQNGWIALSIV--------------NGSDIFVIDNGKGLLRAKVSLDREQQSSYTLWVEAVDGGDPTLSSTAKITILLLDVNDNPPMVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAVIAYSIIGRRGPKPESFRIDPITGNITLEEALMINDCGLYRLLVKVSDHGYPEPLFSTVMVNLFVNDTVT 791          

HSP 3 Score: 111.694 bits (278), Expect = 2.838e-24
Identity = 108/401 (26.93%), Postives = 174/401 (43.39%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQ------IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG-FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQT---LAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            +YF L+E  G + +++RID   V     T L      +   + +   IN IT +      P+    Y        I + E   V   ++  T  DPD +    C     G F  +    ++N   L   +ALDYE + +Y   +VA         G+Q    L + +LD NDN PVF++   ++ I+EN      +A + A D DS   GQV Y  G    P   SYF + + TG + +  IL+ +   + +   ++A D G   +   ATV + + D N+  P           KDF+  V EN        +I V+D D G N  +   +  G++ F + N + +       L+     DRE  S + + +   D G P L++  +IT+ + DVN+  P
Sbjct:  312 EYFHLDELKGIIKLSKRIDGSTVQQHKLTILANGPGCIPAVITVFISINKITFR-----PPELIPRYIANEENGVIYLKELEPVHSPLAFFTIKDPDEKYQVNCYLEGQGPFRLSAFKPYNNEYLLETTDALDYELKQSYNIAVVALSRD-----GHQVKKLLKVQILDENDNSPVFTESTVEITIEENNEPNAFLAKLYATDADSNESGQVSYFLG----PDAPSYFTLDSVTGILSVSTILD-REEKEKYRFTVKARDAGFPSRESVATVHITVLDKNDNNPRF-------ISKDFSFFVPENFPGFGEIGVISVTDADSGQNGWIALSIVNGSDIFVIDNGKGL-------LRAKVSLDREQQSSYTLWVEAVDGGDPTLSSTAKITILLLDVNDNPP 683          

HSP 4 Score: 59.3066 bits (142), Expect = 1.613e-17
Identity = 55/161 (34.16%), Postives = 81/161 (50.31%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK----LQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQ 2136
            +F ID   G LR    LDRE+     L V A+D G+P + ++T  + I + DVNDNPP V+ P      L V  +  TLP   +T++ A D D G N  + + I     +RG        + + F ID I+GN+T+ ++L       Y L + V D G P+
Sbjct:  627 IFVIDNGKGLLRAKVSLDREQQSSYTLWVEAVDGGDP-TLSSTAKITILLLDVNDNPPMVLFPQSNMSYLLVLPS--TLPGSPVTEVYAVDKDTGMNAVIAYSII---GRRG-------PKPESFRIDPITGNITLEEALMINDCGLYRLLVKVSDHGYPE 774          

HSP 5 Score: 51.6026 bits (122), Expect = 1.613e-17
Identity = 97/418 (23.21%), Postives = 165/418 (39.47%), Query Frame = 2
Query:  386 ESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINAL-------DYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP-----VFSQKEYKVI-IKENAMVGEVVANVTAVDMDSG------LFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            E T  LII   +DRE      T+  A D     L     +      I I DVND+ P+F  S     +     +G ++    A D D+ PN + TY    F++          +L  +  +       D  T   +K T++A   G  P     T+ IS+  I    P       + +E  VI +KE   V   +A  T  D D        L GQ  +R    + P    Y   +T   + +L++  N   +A        + DG  V K+    + V + D N+  PV   +++     +  ++EN    +  A ++ +D D   + +V   L   A ++   +S T        L  + + DRE    ++  +   D G P   +   + + + D N+ +PRF  ++++  V EN
Sbjct:  210 ERTPYLIIMGPLDRETKAEYETTIIAEDGGSPPLVGSATLS-----ILISDVNDNCPQFNASQINATLYGNSTIGTQVVTVHAMDRDLGPNALITY---AFSERVPQAVKEYFHLDELKGIIKLSKRIDGSTVQQHKLTILANGPGCIPAV--ITVFISINKITFRPPELIPRYIANEENGVIYLKELEPVHSPLAFFTIKDPDEKYQVNCYLEGQGPFRLSAFK-PYNNEYLLETTDALDYELKQSYNIAVVAL-------SRDGHQVKKL----LKVQILDENDNSPVFTESTV-----EITIEENNEPNAFLAKLYATDADSNESGQVSYFLGPDAPSYFTLDSVT------GILSVSTILDREEKEKYRFTVKARDAGFPSRESVATVHITVLDKNDNNPRFISKDFSFFVPEN 594          

HSP 6 Score: 75.0998 bits (183), Expect = 5.933e-13
Identity = 63/226 (27.88%), Postives = 101/226 (44.69%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI 1195
            + I D ND+ P F ES  +I I E  +    ++   A+D D   +   +YF+     ++    S    L V   LD E +  Y+ T+ A D G P      T+ I+VLD NDN+P F  K++   + EN      +  ++  D DSG  G +        D      F I    G ++ +  L+ +     ++L +EA DGG       A + + L DVN+  P++
Sbjct:  466 VQILDENDNSPVFTESTVEITIEENNEPNAFLAKLYATDADSNESGQVSYFLGPDAPSYFTLDSVTGILSVSTILDREEKEKYRFTVKARDAGFPSRESVATVHITVLDKNDNNPRFISKDFSFFVPENFPGFGEIGVISVTDADSGQNGWIALSIVNGSD-----IFVIDNGKGLLRAKVSLD-REQQSSYTLWVEAVDGGDPTLSSTAKITILLLDVNDNPPMV 685          

HSP 7 Score: 73.559 bits (179), Expect = 1.780e-12
Identity = 83/300 (27.67%), Postives = 132/300 (44.00%), Query Frame = 2
Query:  371 YFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP--VFSQKEYK-VIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHL---KDVNNQRPVININSLGPAKKDFNVKENQ 1249
            YF+L+  TG L ++  +DRE+     FT   R       F   +    V IT+ D ND+ P+F    +   + E       I + + +D D   N      +   +D F I     L    + +LD E Q +Y   + A D G P L     + I +LD+NDN P  +F Q     +++  + + G  V  V AVD D+G+   + Y     + P   S F I   TG I L+  L   +    + L ++ SD G  P+  ++TV V+L     V N+     I +L   + D N++E +
Sbjct:  524 YFTLDSVTGILSVSTILDREEKEKYRFTVKARD----AGFPSRESVATVHITVLDKNDNNPRFISKDFSFFVPENFPGFGEIGVISVTDADSGQNGWIALSIVNGSDIFVIDNGKGLLRAKV-SLDREQQSSYTLWVEAVDGGDPTLSSTAKITILLLDVNDNPPMVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAVIAYSIIGRRGPKPES-FRIDPITGNITLEEALMINDCGL-YRLLVKVSDHG-YPEPLFSTVMVNLFVNDTVTNES---YIETLLKKEPDINIEEKE 812          

HSP 8 Score: 56.225 bits (134), Expect = 3.144e-7
Identity = 56/201 (27.86%), Postives = 87/201 (43.28%), Query Frame = 1
Query: 1822 DVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGL-AEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKL 2418
            D+NDN P    P   + V EN       + +  A DPD G NG   +   R+ D  G+    ++EN +      E +  L I   LDRE    Y   I+  D G P L     +++ + D+NDN P++     ++T     ++  Q   ++   A D D  PNA ITY  +E              R  Q+++E  +L +L
Sbjct:  144 DINDNAPHFPVPQIYISVPENAPVNTRIVIEHPAYDPDGGTNGVQTY---RLVDYHGVFTLDVEENESG-----ERTPYLIIMGPLDRETKAEYETTIIAEDGGSPPLVGSATLSILISDVNDNCPQFNASQINATLYGNSTIGTQ---VVTVHAMDRDLGPNALITYAFSE--------------RVPQAVKEYFHLDEL 319          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: ENSXETT00000039476.1 (protocadherin gamma-B2-like [Source:NCBI gene;Acc:105946881])

HSP 1 Score: 204.142 bits (518), Expect = 1.699e-57
Identity = 148/465 (31.83%), Postives = 234/465 (50.32%), Query Frame = 2
Query:  221 GNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLL-KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG-----FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSV-LSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +E +  +HY++ EE+   + + N+  D  +  ++  +  K +   ++  KYFS++   G L +  RIDRE +C     A   C +     V  P++ +   + IQD+ND+ PKF      + I+E+   G +++L+ A DPD+  N   TY +        N+  +        LI+   LD ETQ  ++  L A D G P   G   + + V D NDN PVF+Q  YK  I EN  +   V  V A D D GL  Q+ Y F +  + S+  S F IS   GEIK +R LN +   +++ L+I+A DGG    V ++ V + + D N+  P ++I S+        V E+    +  A+I VSD D   N EVDC + +G   F+L +S    GR  Y +      DRE    + + +L +DRG+P+L++ + I + I DVN+  P F+K  YT  + EN+  G
Sbjct:   12 ASELSGQLHYSIAEELKRDSVIANIAKDLQL-DVRDLTARKFHIVSRVSEKYFSVDLRNGNLYVKDRIDRETLC----GAATACILTFDAMVESPLNVFSVKVEIQDINDNPPKFFHDTITLDINESTPPGTQLALQNAEDPDIGINAELTYRLSDNQYFKLNEKTSTEEIKFPELILDKPLDRETQNIHELILTASDGGNPVRTGTALIRVIVTDANDNLPVFNQVVYKASISENTPINSTVLIVNATDKDEGLNAQITYSFSKSSENSLYTSMFSISPTNGEIKSKRTLNFEE-KRNYELSIQAKDGGGF--VAHSKVLIEIVDENDNAPEMSIASISTP-----VPEDSAPGTVIALIEVSDQDSEENGEVDCQI-IGTAPFQLVSS---SGR-FYRIITTGPLDREKVPWYNITILATDRGSPQLSSRKFIKLDISDVNDNPPVFRKSLYTTYLPENNLPG 458          

HSP 2 Score: 41.2022 bits (95), Expect = 1.699e-57
Identity = 55/201 (27.36%), Postives = 85/201 (42.29%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE-----ETLPM------FLTQIQARDPDLGENGTVRF-YIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVA--HSTNIT 2232
            F I+   G L      D E+  + ++ +LA D G P S  +  T+ I ITD NDN P ++ P      EN      E +P        +T++ A D D G N  + + +IQ +E                F+I + +G +        + I  + L +MV D G P L++   ++L V +        FQ V   HS  IT
Sbjct:  495 FSINIETGVLYAQRSFDYEQQKEFQMQILAKDNGSP-SLCSNATLIIHITDQNDNAPKILYPST----ENGDSTFFEMVPFASEQGTLITKVVAVDADSGHNSWLSYHFIQGLEPSH-------------FTISQHTGEIRTSHVFQEKDILKHKLVVMVKDNGNPYLSATVTLSLIVAE-------HFQQVVPKHSNQIT 670          

HSP 3 Score: 97.4413 bits (241), Expect = 5.458e-20
Identity = 94/336 (27.98%), Postives = 149/336 (44.35%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLY-LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN---------VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQ-TVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLT 1483
            +I I D ND+ P+ + +     + E    G  I+L   SD D E N      + G      ++ S   Y +I    LD E    Y  T++A D G P L   + + + + D+NDN PVF +  Y   + EN + G  +  V A D+DSG   ++ Y       +D  V SYF I+  TG +  QR  + +   ++F + I A D GS      AT+ +H+ D N+  P I    L P+ ++ +           E  TL++    +   D D G N+ +  H   G E    + SQ T + R  +  Q     ++++  H  V M+  D G P L+
Sbjct:  324 LIEIVDENDNAPEMSIASISTPVPEDSAPGTVIALIEVSDQDSEENGEVDCQIIGTAPFQLVSSSGRFYRIITTGPLDREKVPWYNITILATDRGSPQLSSRKFIKLDISDVNDNPPVFRKSLYTTYLPENNLPGASIYTVHATDVDSGDNAKLIYSISNANTEDFPVSSYFSINIETGVLYAQRSFDYEQ-QKEFQMQILAKDNGSPSLCSNATLIIHITDQNDNAPKI----LYPSTENGDSTFFEMVPFASEQGTLITKVVAV---DADSGHNSWLSYHFIQGLEPSHFTISQHTGEIRTSHVFQ-----EKDILKHKLVVMV-KDNGNPYLS 645          

HSP 4 Score: 83.5741 bits (205), Expect = 1.241e-15
Identity = 112/461 (24.30%), Postives = 192/461 (41.65%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTG-------KLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN------------ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLT-VGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            F+  I   + E    G  +   N +     I  + T++L D+    +YF L E T        +LI+ + +DRE   +     TA D      T        I VI + D ND+ P F +  Y+  ISE   +   + +  A+D D   N   TY       +F+ +  N LY  + +             L++E + NY+ ++ A D G      +  + I ++D NDN P  S       + E++  G V+A +   D DS   G+V  +       Q  S    FY    TG +  +++         +++ I A+D GS        + + + DVN+  PV    SL        + EN    +    +  +D D G NA++   ++    E+F +S+  ++   +   L   R FD E    FQ+++L  D G+P L +   + + I D N+ +P+
Sbjct:  122 FHDTITLDINESTPPGTQLALQNAEDPDIGINAELTYRLSDN----QYFKLNEKTSTEEIKFPELILDKPLDRETQNIHELILTASDGGNPVRTGTA----LIRVI-VTDANDNLPVFNQVVYKASISENTPINSTVLIVNATDKDEGLNAQITY-------SFSKSSENSLYTSMFSISPTNGEIKSKRTLNFEEKRNYELSIQAKDGGG--FVAHSKVLIEIVDENDNAPEMSIASISTPVPEDSAPGTVIALIEVSDQDSEENGEVDCQIIGTAPFQLVSSSGRFYRIITTGPLDREKV-------PWYNITILATDRGSPQLSSRKFIKLDISDVNDNPPVFR-KSLYTTY----LPENNLPGASIYTVHATDVDSGDNAKLIYSISNANTEDFPVSSYFSI-NIETGVLYAQRSFDYEQQKEFQMQILAKDNGSPSLCSNATLIIHITDQNDNAPK 551          

HSP 5 Score: 79.7221 bits (195), Expect = 1.686e-14
Identity = 79/270 (29.26%), Postives = 126/270 (46.67%), Query Frame = 1
Query: 1705 TANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDDLVY--IDAIIGDLRARQSIRE----GHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            T   LDREK     + +LA D+G P+  ++   + + I+DVNDNPP V           E  LP   +  + A D D G+N  + + I         A   D   +  FSI+  +G L   +S D E    + + I+  D G P L S   + + + D NDN PK   P   + + T   ++  A +Q  +I +  A D DS  N+ ++YH  +G +  +  I    G++R     +E     H L+ +V  DNGNP LS  + ++L ++
Sbjct:  396 TTGPLDREKVPWYNITILATDRGSPQ-LSSRKFIKLDISDVNDNPP-VFRKSLYTTYLPENNLPGASIYTVHATDVDSGDNAKLIYSISN-------ANTEDFPVSSYFSINIETGVLYAQRSFDYEQQKEFQMQILAKDNGSPSLCSNATLIIHITDQNDNAPKILYPSTENGDSTFFEMVPFASEQGTLITKVVAVDADSGHNSWLSYHFIQGLEPSHFTISQHTGEIRTSHVFQEKDILKHKLVVMV-KDNGNPYLSATVTLSLIVA 655          

HSP 6 Score: 62.3882 bits (150), Expect = 4.266e-9
Identity = 75/280 (26.79%), Postives = 125/280 (44.64%), Query Frame = 1
Query: 1630 RTIAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQ-ARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEIS-GNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD------LVYIDAIIGDLRARQSI---REGHYLIKLVANDNG 2436
            R   I +R   K  F +D   GNL   + +DRE         +        S     +V + I D+NDNPP   +   + +  NE T P     +Q A DPD+G N  + +   R+ D +    K++E      S +EI    L + K LDRE  + + L +   D G P  T    I + V D NDN P  F  V +  +I+  + +  +  ++I  A+D D   NA ITY  ++  +      +  I    G++++++++    + +Y + + A D G
Sbjct:   50 RKFHIVSRVSEK-YFSVDLRNGNLYVKDRIDRETLCGAATACILTFDAMVESPLNVFSVKVEIQDINDNPPKFFHD-TITLDINESTPPGTQLALQNAEDPDIGINAELTY---RLSDNQYF--KLNEKT----STEEIKFPELILDKPLDRETQNIHELILTASDGGNPVRTGTALIRVIVTDANDNLP-VFNQVVYKASISENTPI--NSTVLIVNATDKDEGLNAQITYSFSKSSENSLYTSMFSISPTNGEIKSKRTLNFEEKRNYELSIQAKDGG 315          

HSP 7 Score: 61.2326 bits (147), Expect = 1.026e-8
Identity = 75/287 (26.13%), Postives = 129/287 (44.95%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN---LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYISSK 2487
            +F I    G +++   L+ E+    EL + A D G      A + V I I D NDN P  ++   +     E++ P   +  I+  D D  ENG V   I                 T  F +   SG    +     LDRE +  Y + I+  D+G PQL+S + I L + D+NDNPP  F+   ++T +   ++      I    A+D DS  NA + Y ++  +           I+   G L A++S    ++  + ++++A DNG+P+L +   + ++I+ +
Sbjct:  281 MFSISPTNGEIKSKRTLNFEEKRNYELSIQAKDGG---GFVAHSKVLIEIVDENDNAPE-MSIASISTPVPEDSAPGTVIALIEVSDQDSEENGEVDCQIIG---------------TAPFQLVSSSGRFYRIITTGPLDREKVPWYNITILATDRGSPQLSSRKFIKLDISDVNDNPP-VFRKSLYTTYLPENNLPG--ASIYTVHATDVDSGDNAKLIYSISNANTEDFPVSSYFSINIETGVLYAQRSFDYEQQKEFQMQILAKDNGSPSLCSNATLIIHITDQ 545          
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Match: pcdh18 (protocadherin 18 [Source:NCBI gene;Acc:496568])

HSP 1 Score: 207.223 bits (526), Expect = 5.362e-57
Identity = 140/465 (30.11%), Postives = 234/465 (50.32%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNID-SNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +N+ Y + EE  +G  V  L+ D +++    P  +   F+    G      ++ E  G++ I  +IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+ +   I+ISE+  VG RI L +A DPDV  N++ TY +   N  F+I        +    L+VI  LD E Q +Y+  L A D G+P   G+  L IS+ D NDN PVF ++ Y V + EN+ +G ++ ++ A D D G  G+V Y F     P +   F I   +G++ L + ++ +   + + ++++A D G      +  + +++ DVN+ +P ININ +   K+   + E   L +  A++ V D D G+N E+   L  G   FKL  +      + Y +  N   DRE  S + + ++  DRG P L+T +   V+I D N+  PRF    Y + + EN++ G
Sbjct:   23 KNLKYRIYEEQMIGTVVARLSEDVADVLSKLPNPSSVRFRAMQRGSS-PLLTVREDNGEISIGAKIDREQLCQKN----SNCSIEFDVITLPTQHLQLFHIEVQVLDINDNAPQFSRALIPIEISESAAVGTRIPLDSAFDPDVGDNSLFTYSLSP-NAYFSIEVKTRTDGAKYAELVVIRELDRELQSSYELQLTAYDNGVPQRYGSSLLKISISDSNDNSPVFEKQSYVVQLPENSPLGTLLIDLNATDPDEGANGKVVYSFSSHVSPKITETFKIDPESGQLTLIKPVDYET-TKSYEIDVQAQDMGPNSIPAHCKIIINVVDVNDNKPEININLMSTGKEIAYISEGAPLDTFVALVRVQDKDSGLNGEIVVRLH-GHGQFKLQKTY----ENNYLILTNSTLDREKRSEYSLTVIAEDRGVPSLSTVKHFAVQIIDENDNPPRFPTNRYEIVIVENNSPG 475          

HSP 2 Score: 36.5798 bits (83), Expect = 5.362e-57
Identity = 51/176 (28.98%), Postives = 75/176 (42.61%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLD---REYIDSYILYIMVCDQGKPQLTSIEAITLTVLDI 2178
            ID   G L      D E+ ++I  +V A D G P+  T   TV +T+ D NDN P ++  P L     E T+P        +T I+A D D G N  +   I               N   IF +D  S  +    S+D    + +D   L+I V D+G P  T+   +   +LD+
Sbjct:  514 IDPSNGALYALRAFDHEEVNQIMFVVQARDGGVPQ-LTTNATVILTVVDENDNAPVIV-VPVLHNNTAEITIPKDAEIGYLVTTIKATDRDSGMNSELDCSISA------------GNEHNIFIMDPRSCEIYTNMSMDIFPNQLLD---LHITVQDRGNPPRTTKAHLRFNILDL 672          

HSP 3 Score: 109.768 bits (273), Expect = 1.283e-23
Identity = 115/427 (26.93%), Postives = 200/427 (46.84%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPK----FAESYYQIQ-ISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND-TFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGY-ATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE-NFKLSNSQTVKGRDIYTLQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQD---VNEFSPRFKKQNYTVNVS 1570
            +F  +   K+ + F ++  +G+L + + +D E     S+    + Q      +P    I +I + DVND++P+       +  +I  ISE   +   ++L    D D   N      +HG        T+ N  YLI+ N+ LD E +  Y  T++A D G+P L   +  A+ ++D NDN P F    Y+++I EN   G  + +V A D D    GQV Y   +  +Q  S+ +Y  I    G +   R  + + + Q     ++A DGG VP++   ATV + + D N+  PVI +  L     +  + ++  +      I  +D D G+N+E+DC ++ G E N  + + ++    +IYT     +F  + +D H  V+    DRG P  TT+  +   I D   + E +P    +  +++VS
Sbjct:  279 SFSSHVSPKITETFKIDPESGQLTLIKPVDYETT--KSYEIDVQAQDMGPNSIPAHCKI-IINVVDVNDNKPEININLMSTGKEIAYISEGAPLDTFVALVRVQDKDSGLNGEIVVRLHGHGQFKLQKTYENN-YLILTNSTLDREKRSEYSLTVIAEDRGVPSLSTVKHFAVQIIDENDNPPRFPTNRYEIVIVENNSPGAHITSVRATDPDQAENGQVTYTILESSIQSSSITTYVTIDPSNGALYALRAFDHEEVNQ-IMFVVQARDGG-VPQLTTNATVILTVVDENDNAPVIVVPVLHNNTAEITIPKDAEIGYLVTTIKATDRDSGMNSELDCSISAGNEHNIFIMDPRSC---EIYTNMSMDIFPNQLLDLHITVQ----DRGNPPRTTKAHLRFNILDLIEITEGTPEPYTKQSSMDVS 692          

HSP 4 Score: 84.7297 bits (208), Expect = 6.020e-16
Identity = 111/428 (25.93%), Postives = 180/428 (42.06%), Query Frame = 2
Query:  371 YFSLEEST-------GKLIIAQRIDREQVCPTSFTALDRCQIELTIF---VPIDYWINV--ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG-----FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP-----VFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVF-VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEV--------------DCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            YFS+E  T        +L++ + +DRE    +S+      +++LT +   VP  Y  ++  I+I D ND+ P F +  Y +Q+ E   +G  +    A+DPD   N    Y           +TF I   +   L +I  +DYET  +Y+  + A D G   +  +  + I+V+D+NDN P     + S  +    I E A +   VA V   D DSGL G++  R    GQ +    L   Y + Y   I     L+ +    ++SL + A D G VP +     F V + D N+  P    N     + +  + EN +  +H   +  +D D   N +V                ++T+   N  L           Y L   R FD E  +     +   D G P+LTT   + + + D N+ +P
Sbjct:  176 YFSIEVKTRTDGAKYAELVVIRELDRE--LQSSY------ELQLTAYDNGVPQRYGSSLLKISISDSNDNSPVFEKQSYVVQLPENSPLGTLLIDLNATDPDEGANGKVVYSFSSHVSPKITETFKIDPESG-QLTLIKPVDYETTKSYEIDVQAQDMGPNSIPAHCKIIINVVDVNDNKPEININLMSTGKEIAYISEGAPLDTFVALVRVQDKDSGLNGEIVVRLHGHGQFK----LQKTYENNYL--ILTNSTLD-REKRSEYSLTVIAEDRG-VPSLSTVKHFAVQIIDENDNPPRFPTN-----RYEIVIVENNSPGAHITSVRATDPDQAENGQVTYTILESSIQSSSITTYVTIDPSNGAL-----------YAL---RAFDHEEVNQIMFVVQARDGGVPQLTTNATVILTVVDENDNAP 567          

HSP 5 Score: 75.485 bits (184), Expect = 4.994e-13
Identity = 67/217 (30.88%), Postives = 105/217 (48.39%), Query Frame = 1
Query: 1705 TANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRI----IIAQASDPDSRPNANITYHVTEGDD 2340
            T + LDREK  +  L V+A D+G P S +      + I D NDNPP    N  ++ + EN  +    +T ++A DPD  ENG V + I         +     + T   +ID  +G L   ++ D E ++  +  +   D G PQLT+   + LTV+D NDN P    PV H  N T +  + +D  I       +A+D DS  N+ +   ++ G++
Sbjct:  413 TNSTLDREKRSEYSLTVIAEDRGVP-SLSTVKHFAVQIIDENDNPPRFPTNRYEIVIVENN-SPGAHITSVRATDPDQAENGQVTYTILE-------SSIQSSSITTYVTIDPSNGALYALRAFDHEEVNQIMFVVQARDGGVPQLTTNATVILTVVDENDNAPVIVVPVLH--NNTAEITIPKDAEIGYLVTTIKATDRDSGMNSELDCSISAGNE 618          

HSP 6 Score: 60.8474 bits (146), Expect = 1.243e-8
Identity = 73/260 (28.08%), Postives = 115/260 (44.23%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQPVAHSTNITTKSVLAQ-DQRIIIAQASDPDSRPNANITYHVT-----------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            LDRE     EL + A D G P+ +  ++ + I+I+D NDN P       + Q+ EN   L   L  + A DPD G NG V +           +  +    T+ F ID  SG LT+ K +D E   SY + +   D G   + +   I + V+D+NDN P+     ++    I   S  A  D  + + +  D DS  N  I   +            E + L+  ++ +   R ++S     Y + ++A D G P+LST
Sbjct:  199 LDRELQSSYELQLTAYDNGVPQ-RYGSSLLKISISDSNDNSPVFEKQSYVVQLPENS-PLGTLLIDLNATDPDEGANGKVVY---------SFSSHVSPKITETFKIDPESGQLTLIKPVDYETTKSYEIDVQAQDMGPNSIPAHCKIIINVVDVNDNKPEININLMSTGKEIAYISEGAPLDTFVALVRVQDKDSGLNGEIVVRLHGHGQFKLQKTYENNYLILTNSTLD--REKRS----EYSLTVIAEDRGVPSLST 441          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhgb5 (protocadherin gamma subfamily B, 5 [Source:MGI Symbol;Acc:MGI:1935196])

HSP 1 Score: 239.965 bits (611), Expect = 2.521e-65
Identity = 156/463 (33.69%), Postives = 244/463 (52.70%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH---GFNDTFNITFSNLLY--LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +  I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YFS+   +G+L+++ R+DREQ+C         C +E       P++++   + ++D+NDH P F  ++ ++QISE+ Q G R  L  A D D+  N++  Y +    GF+           Y  L++   LD E Q  Y+  L A D G PPL G   L I V D NDN PVF+Q+ YKV + EN   G  V  VTA D D G+  ++ Y F   GQV        F +++ +GEI  Q+ L+ + I +++S+ +EA DGG +  V   TV ++++D N+ RP I + SL        + EN    +  A+I + DGD G N EV+C L      FK+ +S     ++ Y L  +R  DRE+   + V +  +DRG P L++  ++T+ + DVN+ +P F + +Y V ++EN+  G
Sbjct:   29 LSEQIRYKIPEEMPTGSVVGNLAKDLG-FSVQELPTRKLRISSEK-PYFSVSSESGELLVSSRLDREQICGKKLV----CALEFEAVAENPLNFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEVAEDADIALNSLQNYKLSPSPGFSLVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQV--------FGLNSKSGEIITQKTLDFEEI-KEYSIVVEARDGGGL--VAQCTVEINIQDENDNRPEITVRSLLEM-----IPENAPPGTLIALIKIHDGDSGENGEVNCRLDDEVP-FKIISSS----KNSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPG 464          

HSP 2 Score: 110.153 bits (274), Expect = 6.583e-24
Identity = 121/454 (26.65%), Postives = 193/454 (42.51%), Query Frame = 2
Query:  203 QIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYD----DGKLLKYFSLEESTGKLIIAQRIDREQ--VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKL--QRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            ++QIS   +        V E+ D+      LN   N +K+ P   F L +    DG+  KY        +L++ + +DREQ        TALD     L+    +      I + D ND+ P F +  Y++++ E V  G  +   TA+D D   N+  +Y  H     F +  S    +I    LD+E    Y   + A D G   L    T+ I++ D NDN P  + +    +I ENA  G ++A +   D DSG  G+V  R         + +  IS+     KL   R L+ + +  ++++ I A+D G  P      V +H+ DVN+  P+ +      A     + EN    +  A +  SD D+G N  V   +     E   L +  TV  +        R FD E    FQ+ +   D G+P L+    + V + D N+ +PR
Sbjct:  139 ELQISESAQPGTRFILEVAEDADIA-----LNSLQN-YKLSPSPGFSLVNKEKQDGR--KY-------PELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELR-----IQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQVFGLN-SKSGEIITQKTLDFEEIKEYSIVVEARDGGG--LVAQCTVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDDE-----VPFKIISSSKNSYKLVTDRALD-RELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQ-----ASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFA-QRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPR 557          

HSP 3 Score: 96.6709 bits (239), Expect = 1.021e-19
Identity = 100/393 (25.45%), Postives = 167/393 (42.49%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHYA-VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS--NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL 1327
            L    +++IQ++  N+    FN+ ++   + E +  G  V  +        +  + ++  +  G++   F L   +G++I  + +D E++   S     R    L     ++     I IQD ND++P+         I E    G  I+L    D D   N      +      F I  S  N   L+   ALD E    Y  T+ A D G PPL  +  + + V D+NDN P+F Q  Y V I EN   G  +A V+A D D G  G V Y      ++  S+ SY  ++  +G +  QR  + + + + F L ++A D GS       ++ V + D N+  P +   +L P     F++        +     V+ D D G NA +  H+
Sbjct:  222 LSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQV---FGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGGGLVAQCTVE-----INIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDD-EVPFKIISSSKNSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQL-RSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHV 604          

HSP 4 Score: 93.2041 bits (230), Expect = 1.205e-18
Identity = 87/310 (28.06%), Postives = 141/310 (45.48%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDREQVCP---TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA----------LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP--VFSQKEYKV-----IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD-VNNQRPVININSLGP 1216
            DD    K  S  +++ KL+  + +DRE + P    + TA DR +  L+    +      + + DVND+ P F ++ Y + I+E    G  I+  +ASDPD+  N   +Y +       ++   +L   + +NA           D+E   +++ TL A D G P L  N ++ + V D NDN P  ++   E        ++   A  G +V  V AVD DSG    + Y   Q  DP +   F +   TGE++  R L  K+ A+   L +   DGG  P    AT+ +   D +    P ++ +SL P
Sbjct:  383 DDEVPFKIISSSKNSYKLVTDRALDRE-LTPEYNVTITATDRGKPPLSSSTKV-----TLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSII----ASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL---FSLGLRTGEVRTARALGEKDAARQ-RLLVGVRDGGQPPLSATATLLLVFADSLQEALPDLSDHSLPP 678          

HSP 5 Score: 75.8702 bits (185), Expect = 2.420e-13
Identity = 109/442 (24.66%), Postives = 179/442 (40.50%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIF-SIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR----IIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIRE---GHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVTXXXXXXXXXXXXXXXXKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTP 2964
            L T   LDRE   +  + + A D+G+P   +++T V + + DVNDN P       L            + Q+ A DPDLG NG V + I        +A  ++      + +++  SG +   ++ D E + S+ L +   D G P L++  ++ + V D NDN P+   P           ++ +  +    +    A D DS  NA ++YHV +  D  L  +    G++R  +++ E       + +   D G P LS    + L + + S    + ++SD           QF +V+ +A+V++  ++ + L I L             R +  SS   +     GFCS           PV    Y    + Y  N Y     K+E     CN  ++CS   + G       SSG  F  PL       S P   TP
Sbjct:  400 LVTDRALDRELTPEYNVTITATDRGKP-PLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSI--------IASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGEKDAARQRLLVGVRDGGQPPLSATATL-LLVFADSLQEALPDLSDHSLPPDPQAELQFYLVVALALVSVLFLLAVILAIAL-------------RLRHSSSPSVWNCFQPGFCSESK--------PVVFPNYSEGTLPYSYNLYGAHAGKTE-----CN-FLKCSEPLSSGQGLLCPESSGALF--PLCDSSEPTSHPEPLTP 802          

HSP 6 Score: 75.0998 bits (183), Expect = 4.467e-13
Identity = 76/290 (26.21%), Postives = 124/290 (42.76%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP---VAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYISSK 2487
            ++  +F ++   G + T   LD E+  +  ++V A D G   +Q           D NDN P +     L++          +  I+  D D GENG V   +             DE   KI S  + S  L   ++LDRE    Y + I   D+GKP L+S   +TL V D+NDN P + Q    V  + N    + +AQ        ASDPD   N +++Y +   D         V ++A  G + A+++        + + L A D+G+P LS  + + + +  +
Sbjct:  283 RAGQVFGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGGGLVAQCTVEINIQ---DENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLD------------DEVPFKIISSSKNSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQ------VSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDR 551          

HSP 7 Score: 53.5286 bits (127), Expect = 1.713e-6
Identity = 67/287 (23.34%), Postives = 123/287 (42.86%), Query Frame = 1
Query: 1642 IPTR----SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQS-----IREGHYLIKLVANDNGNPNLSTEIKINL 2472
            +PTR    S  K  F +    G L  ++ LDRE+    +L+     +    +      V + + D+ND+ P   +   +LQ+ E+ +    F+ ++ A D D+  N +++ Y         L  K  ++  K          L + K+LDRE  + Y L +   D G P L+    + + V D NDNPP + Q V     +     +     ++   A+D D   N+ I+Y       +  +++  G++  +++     I+E  Y I + A D G       ++IN+
Sbjct:   61 LPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCALEFEAVAENPLNFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEV-AEDADIALN-SLQNYKLSPSPGFSLVNKEKQDGRKY-------PELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEV---YKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFHRAGQVFGLNSKSGEIITQKTLDFEEIKE--YSIVVEARDGGGLVAQCTVEINI 333          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhb14 (protocadherin beta 14 [Source:MGI Symbol;Acc:MGI:2136749])

HSP 1 Score: 228.409 bits (581), Expect = 4.454e-62
Identity = 160/493 (32.45%), Postives = 257/493 (52.13%), Query Frame = 2
Query:  152 NFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNL--NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCH--------LTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENST 1582
            + H++ Q   + +++ + +    G+     I Y+V EE D G+ VGNL  ++  ++ ++  +    L    K L    LE+ +G L++ +++DRE++C ++   +   Q+ L    P+ +    I +QDVNDH P+F E    ++I E+   G    L+ A D DV  N V  Y +   N  F++   N         L++  ALD E Q   + TL A D G PP  G   + I VLDINDN P F+Q  Y+V ++EN+ VG +V  V+A D+D+G  G++ Y   Q  +  VL  F ++T TGEI+++++L+ + I Q + + IEASDGG +   G  TV +H+ DVN+  P + ++ L        + EN    +  AI  +SD D G N ++ C         L    ENF             YTL   R  DRE  + + + +  SD GTP+LTT+  ITV++ D+N+ +P F   +YT+ V EN++
Sbjct:    4 SLHKAPQKRQVTAIIFLLLLWEAGSA---TITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQL--LQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLK--SPVQFIQGEIQLQDVNDHAPEFMEDEILLKILESSLPGAVFPLKIAQDLDVGSNTVQNYTI-STNAHFHLLTRNHSDGRKYPELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDLDAGTHGELSYSLFQSSN-QVLQAFEVNTDTGEIRVRKLLDFEEI-QSYRMEIEASDGGGL--SGKCTVVIHVMDVNDNAPELTMSVL-----ISEIPENSP-ETIVAIFGISDPDSGDNGKMVCSVQDRLPFLLKPNEENF-------------YTLVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNS 465          

HSP 2 Score: 95.5153 bits (236), Expect = 1.953e-19
Identity = 114/453 (25.17%), Postives = 201/453 (44.37%), Query Frame = 2
Query:  254 VKEEIDVG-NFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPT--SFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQ----VRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP--RFKKQNYTVNVSE 1573
            + +++DVG N V N  I +N  F +  ++    + DG+  KY        +L++ + +DRE+      + TA+D      T    +     VI + D+ND+ P+FA+  Y++Q+ E   VG  +   +A D D   +   +Y +   ++     F   ++   + V   LD+E   +Y+  + A D G   L G  T+ I V+D+NDN P  +       I EN+    +VA     D DSG  G+    V+ R   +  P+  +++ + T       +R L+ ++ A+ +++ I  SD G+       T+ V + D+N+  P     S         V+EN +   H   I  +D D G NA +   L    +     NS      D   L   R  D E    F+  +  +D G+P L+++  + V + D N+ +P   +  QN +   +E
Sbjct:  156 IAQDLDVGSNTVQNYTISTNAHFHLLTRN----HSDGR--KY-------PELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQV-----VIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDLDAGTHGELSYSLFQSSNQVLQAFEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGG--LSGKCTVVIHVMDVNDNAPELTMSVLISEIPENS-PETIVAIFGISDPDSGDNGKMVCSVQDRLPFLLKPNEENFYTLVT-------ERALDRESRAE-YNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSY-----TMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTE 574          

HSP 3 Score: 64.3142 bits (155), Expect = 4.018e-19
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQA-RDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-------LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +R   +LD E+     + + A D G    +       +   DVNDN P +     + + E  E  P  +  I    DPD G+NG +   +  V+D+  L   +  N    ++       L   ++LDRE    Y + I V D G P+LT+   IT+ V DINDN P +      S  +  +   +    I    A+D DS  NA+ITY +    D       L+ I+A  G L A +++       +   + A D G+P LS++  + + +
Sbjct:  292 FEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGGLSGKCTVVIHVM---DVNDNAPELTM--SVLISEIPENSPETIVAIFGISDPDSGDNGKM---VCSVQDR--LPFLLKPNEENFYT-------LVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHT---SYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVV 551          

HSP 4 Score: 51.6026 bits (122), Expect = 4.018e-19
Identity = 35/144 (24.31%), Postives = 65/144 (45.14%), Query Frame = 2
Query: 1157 VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + L+DVN+  P    + +        + E+    + F +    D D+G N   +  ++  A +F L       GR    L  ++  DRE  +  ++ +   D G+P  T   ++ + + D+N+ +P F +  Y V V ENS +G
Sbjct:  121 IQLQDVNDHAPEFMEDEI-----LLKILESSLPGAVFPLKIAQDLDVGSNTVQNYTISTNA-HFHLLTRNHSDGRKYPELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVG 258          

HSP 5 Score: 75.8702 bits (185), Expect = 2.213e-13
Identity = 77/304 (25.33%), Postives = 132/304 (43.42%), Query Frame = 2
Query:  383 EESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV-----PIDYWINVITIQ--DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLY-------LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF------SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLG--PAKKD 1228
            EE+   L+  + +DRE           R +  +TI V     P     + IT+Q  D+ND+ P F  + Y + + E       I   +A+D D   N   TY +   +D   +  ++L+        L  + ALDYE    ++  + A D G P L     + + VLD NDN P        +      ++   A  G +V  V AVD DSG    + ++  +  +P +   F +  + GE++  R+L+ +++ +   L +   D G  P     T+ V L D  +Q P + +  +   PA++D
Sbjct:  397 EENFYTLVTERALDRES----------RAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDP-QLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGL---FSVWAHNGEVRTTRLLSERDVPK-HRLLLLVKDNGEPPHSASVTLHVLLVDGFSQ-PYLPLPEVARDPAQED 684          

HSP 6 Score: 66.2402 bits (160), Expect = 2.024e-10
Identity = 72/270 (26.67%), Postives = 127/270 (47.04%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHV--TEGDDLVYIDAIIGDLRARQSIRE----GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            L T   LDRE   +  + +   D G PR  T   T+ + ++D+NDN P   +    + V+EN     + +  I A D D G N  + + +    D + LA         + SI+  +G L   ++LD E + ++  ++   D G P L+S   + + VLD NDN P    P+ +++   T+ +  A +   ++ +  A D DS  NA +++ +  T    L  + A  G++R  + + E     H L+ LV  DNG P  S  + +++ +
Sbjct:  403 LVTERALDRESRAEYNITITVSDMGTPR-LTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNSP-ALHIGTISATDSDSGSNAHITYSLLPPHDPQ-LA------LNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGLFSVWAHNGEVRTTRLLSERDVPKHRLLLLV-KDNGEPPHSASVTLHVLL 662          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdh18 (protocadherin 18 [Source:MGI Symbol;Acc:MGI:1920423])

HSP 1 Score: 226.483 bits (576), Expect = 7.218e-61
Identity = 145/466 (31.12%), Postives = 243/466 (52.15%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNID-SNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN-VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +N+ Y + EE  VG+ +  L+ D +++    P  +   F+    G       + E+TG++ I  +IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+     I+ISE+  VG RI L +A DPDV  N++ TY +   ND FNI        +    LIV+  LD E + +Y+  L A D G+P   G+  L IS+ D NDN P F Q  Y + + EN+ VG ++ ++ A D D G  G++ Y F     P ++  F I +  G + L + ++ + I + + ++++A D G      +  + + + DVN+ +P I+IN + P K++ + V E   + +  AI+ V D D G+N E+ C L  G  +FKL  +      + Y +  N   DRE  S + + ++  D+GTP L++    TV+I D+N+  PRF++  Y   +SEN++ G
Sbjct:   28 KNLKYRIYEEQRVGSVIARLSEDVADVLLKLPNPSAVRFRAMPRGNS-PLLVVNENTGEISIGAKIDREQLCQKNLN----CSIEFDVLTLPTEHLQLFHIEVDVLDINDNSPQFSRPVIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSA-NDYFNIEVRTRTDGAKYAELIVVKELDRELKASYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQPSYTIQLLENSPVGTLLLDLNATDPDEGANGRIVYSFSSHVSPKIIETFKIDSEKGHLTLFKPVDYE-ITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEIICKLH-GHGHFKLQKTY----ENNYLILTNATLDREKRSEYSLTVIAEDKGTPSLSSVRHFTVQINDINDNPPRFQRSRYEFVISENNSPG 481          

HSP 2 Score: 109.383 bits (272), Expect = 9.914e-24
Identity = 107/384 (27.86%), Postives = 173/384 (45.05%), Query Frame = 2
Query:  458 LDRCQIELTIFVPIDYWIN-----------------------VITIQDVNDHQPKFA---ESYYQIQIS---EAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGY-ATVFVHLKDVNNQRPVININSLGPA----KKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTE 1489
            +D  +  LT+F P+DY I                        +I + DVND++P+ +    S  + ++S   E   +   +++    D D   N   +C    HG +     T+ N  YLI+ NA LD E +  Y  T++A D G P L   +   + + DINDN P F +  Y+ +I EN   G  +  VTA D D G  G V Y   +  V   S+ +Y  I    G I   RI + + ++Q  +  +EA DGGS  ++    TV + + D N+  PV+    +GPA      + ++ +      H   I V D D G NAE  C +  G  EN  + + ++    DI+T   N   +    + + + ++  D+G+P L T+
Sbjct:  299 IDSEKGHLTLFKPVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEIICKLHGHG-HFKLQKTYENN-YLILTNATLDREKRSEYSLTVIAEDKGTPSLSSVRHFTVQINDINDNPPRFQRSRYEFVISENNSPGAYITTVTATDPDLGENGHVTYTILESFVLGSSITTYVTIDPSNGAIYALRIFDHEEVSQ-ITFVVEARDGGSQKQLSSNTTVVLTIIDENDNVPVV----IGPAMHNNTAEISIPKGAESGFHVTRIRVVDRDSGANAEFSCSIVSGNEENIFIMDPRSC---DIHT---NVSMESIPSAEWALSVIIQDKGSPPLHTK 669          

HSP 3 Score: 78.9518 bits (193), Expect = 2.393e-14
Identity = 76/292 (26.03%), Postives = 130/292 (44.52%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG-KPQLTSIEAITLTVLDINDNPPKWFQPVAH--STNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLR---ARQSIREGHYLIKLVANDNGNPNLSTEIKINLYI-----SSKSTFSTVINISDDQFRVVIVIAM 2553
            LDREK  +  L V+A D+G P S ++     + I D+NDNPP         V     +   ++T + A DPDLGENG V + I    +   L   I    T   +ID  +G +   +  D E +      +   D G + QL+S   + LT++D NDN P    P  H  +  I+          +   +  D DS  NA  +  +  G  +++  +D    D+    + +SI    + + ++  D G+P L T++ +   +     S  ST  T ++ +     ++I+I++
Sbjct:  423 LDREKRSEYSLTVIAEDKGTP-SLSSVRHFTVQINDINDNPPRFQRSRYEFVISENNSPGAYITTVTATDPDLGENGHVTYTIL---ESFVLGSSI----TTYVTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSQKQLSSNTTVVLTIIDENDNVPVVIGPAMHNNTAEISIPKGAESGFHVTRIRVVDRDSGANAEFSCSIVSGNEENIFIMDPRSCDIHTNVSMESIPSAEWALSVIIQDKGSPPLHTKVLLRCMVFDYAESVTSTAMTSVSRASLDVSMIIIISL 706          

HSP 4 Score: 64.6994 bits (156), Expect = 6.871e-10
Identity = 69/227 (30.40%), Postives = 105/227 (46.26%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLA-EKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F ID   G+L     +D E     E+ V A D G P S  A   + I + DVNDN P +    ++P K +V    E  P+  F+  ++ +D D G NG +   I ++        +K  EN   I +            +LDRE    Y L ++  D+G P L+S+   T+ + DINDNPP+ FQ   +   I+  +  +    I    A+DPD   N ++TY + E
Sbjct:  297 FKIDSEKGHLTLFKPVDYEITKSYEIDVQAQDLG-PNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEVSYVFEGDPIDTFVAIVRVQDKDSGLNGEI---ICKLHGHGHFKLQKTYENNYLILT----------NATLDREKRSEYSLTVIAEDKGTPSLSSVRHFTVQINDINDNPPR-FQRSRYEFVISENN--SPGAYITTVTATDPDLGENGHVTYTILE 506          

HSP 5 Score: 51.9878 bits (123), Expect = 4.980e-6
Identity = 56/227 (24.67%), Postives = 95/227 (41.85%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREK------GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEET---LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            L  +++  G +     +DRE+         IE  VL +    P        + + + D+NDN P    P   +++ E+      +P+      A DPD+GEN ++  Y     D   +  +   +  K          L + K LDRE   SY L +   D G PQ +    + +++ D NDN P + QP +++  +   S +     ++   A+DPD   N  I Y
Sbjct:   76 LLVVNENTGEISIGAKIDREQLCQKNLNCSIEFDVLTL----PTEHLQLFHIEVDVLDINDNSPQFSRPVIPIEISESAAVGTRIPLD----SAFDPDVGEN-SLHTYSLSANDYFNIEVRTRTDGAKY-------AELIVVKELDRELKASYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQP-SYTIQLLENSPVG--TLLLDLNATDPDEGANGRIVY 283          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhgb4 (protocadherin gamma subfamily B, 4 [Source:MGI Symbol;Acc:MGI:1935173])

HSP 1 Score: 225.713 bits (574), Expect = 1.121e-60
Identity = 150/461 (32.54%), Postives = 239/461 (51.84%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +  I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YFS+   +G+L+++ R+DREQ+C         C +E       P++++   + ++D+NDH PKFA + +++QISE+ + G R  L +A D D+  N++  Y +   ND F++        S    +I+  ALD E Q  Y  TL A D G PPL     + + V D NDN PVFSQ  Y+V + EN   G  V  V A D D G+  ++ + F +      ++ F + + TGEI     L+ + + +++SL +EA DGG +  +   TV + + D N+  P +   SL     D  + E+    ++ A++   D D G N EV C L  GA  FK+  S      + Y L  + V DRE +  + + +  +D+G P L++   +T+ I DVN+ +P F K +Y V+V+EN+  G
Sbjct:   29 LSEQIRYKIPEEMPTGSVVGNLAKDLG-FSVQELPTRKLRISSEK-PYFSVSSESGELLVSSRLDREQICGKKLM----CALEFEAVAENPLNFYHLSVELEDINDHTPKFAHTSFELQISESSKPGTRFILGSAHDADIGTNSLQNYQLSP-NDHFSLVNKEKSDGSKYPEMILKTALDREKQKLYHLTLTALDFGHPPLNSTAQIQVLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSFSEA---GQVTQFNLDSNTGEITTLHTLDFEEV-KEYSLVLEAKDGGGM--IAQCTVEIEVLDENDNVPEVLFQSL----PDL-IMEDAEPGTYIALLKTRDKDSGRNGEVICKLEGGAP-FKILTSSG----NTYKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYLVHVAENNPPG 466          

HSP 2 Score: 97.8265 bits (242), Expect = 3.555e-20
Identity = 107/402 (26.62%), Postives = 181/402 (45.02%), Query Frame = 2
Query:  371 YFSL---EESTG----KLIIAQRIDREQ--VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH--GFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI-NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            +FSL   E+S G    ++I+   +DRE+  +   + TALD     L     I      + + D ND+ P F++  Y++ + E V  G  +    A+D D   N+  T+     G    FN+  SN   +  ++ LD+E    Y   L A D G   +    T+ I VLD NDN P    +    +I E+A  G  +A +   D DSG  G+V     +++  +       S  T ++    +L+ +    ++++ I A+D G  P    ++V +H+ DVN+  PV   ++ L       +V EN    +  A +  SD D+G N +V  ++     E   L +  T+  +    L   R FD E    FQ+ +   D G+P L+    + + + D N+ +PR
Sbjct:  177 HFSLVNKEKSDGSKYPEMILKTALDREKQKLYHLTLTALDFGHPPLNSTAQIQ-----VLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSFSEAGQVTQFNLD-SNTGEITTLHTLDFEEVKEYSLVLEAKDGGG--MIAQCTVEIEVLDENDNVPEVLFQSLPDLIMEDAEPGTYIALLKTRDKDSGRNGEV---ICKLEGGAPFKILTSSGNTYKLVTDGVLD-REQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYL------VHVAENNPPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQS-GVLFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPR 559          

HSP 3 Score: 94.3597 bits (233), Expect = 4.654e-19
Identity = 100/400 (25.00%), Postives = 175/400 (43.75%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHY-AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--------ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL 1327
            L S  QIQ+ ++  N+    F+++I+  ++ E +  G  V  +        +  + TF   + G++ + F+L+ +TG++     +D E+V   S           + +C +E+ +              D ND+ P+         I E  + G  I+L    D D   N      + G      +T S   Y +V +  LD E    Y  T+ A D G PPL  + ++ + + D+NDN PVF++  Y V + EN   G  +A V+A D D G  GQV Y      ++  S+ SY  I+  +G +  QR  + + + + F L ++A D GS       ++ + + D N+  P +   +L P     F++        +     V+ D D G NA +  H+
Sbjct:  222 LNSTAQIQVLVTDANDNPPVFSQDIYRVSLPENVYPGTTVLRVVATDQDEGVNSEITFSFSEAGQVTQ-FNLDSNTGEITTLHTLDFEEVKEYSLVLEAKDGGGMIAQCTVEIEVL-------------DENDNVPEVLFQSLPDLIMEDAEPGTYIALLKTRDKDSGRNGEVICKLEGGAPFKILTSSGNTYKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAPVFTKVSYLVHVAENNPPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQSGVLFAQRAFDHEQL-RSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMVPRSAEPGYLVTKVVAVDADSGHNAWLSYHV 606          

HSP 4 Score: 89.7373 bits (221), Expect = 1.371e-17
Identity = 88/308 (28.57%), Postives = 146/308 (47.40%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKID-ENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR----IIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI--REGHYLIKLVA-NDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVT 2559
            L T  +LDRE+  +  + + A D+G+P   +++++V + I DVNDN P       L  V EN       + Q+ A DPDLG NG V +YI        +A  ++ E+     +I+  SG L   ++ D E + S+ L +   D G P L++  ++ L V D NDN P+   P           ++ +       +    A D DS  NA ++YHV +  D  L  +    G++R  +++  R+      LVA  D G P LS    ++L I + S    + ++SDD          QF +V+ +A+++
Sbjct:  402 LVTDGVLDREQNPEYNITIRATDKGDP-PLSSSSSVTLHIGDVNDNAPVFTKVSYLVHVAENNPP-GASIAQVSASDPDLGANGQVTYYI--------IASDLEPESLWSYVTINAQSGVLFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMVPRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDRDSARQRLLVAVRDGGQPPLSATATLHL-IFADSLQEVLPDLSDDPLPPDPQSELQFYLVVALALIS 698          

HSP 5 Score: 89.3521 bits (220), Expect = 1.709e-17
Identity = 82/293 (27.99%), Postives = 130/293 (44.37%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA----------LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP--VFSQKEYKV-----IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD 1171
            + G   K  +   +T KL+    +DREQ    + T  A D+    L+    +      + I DVND+ P F +  Y + ++E    G  I+  +ASDPD+  N   TY++   +    +   +L   + INA           D+E   +++ TL A D G P L  N ++ + V D NDN P  ++   E        ++  +A  G +V  V AVD DSG    + Y   Q  DP +   F +   TGE++  R L  ++ A+   L +   DGG  P    AT+ +   D
Sbjct:  385 EGGAPFKILTSSGNTYKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSV-----TLHIGDVNDNAPVFTKVSYLVHVAENNPPGASIAQVSASDPDLGANGQVTYYIIASD----LEPESLWSYVTINAQSGVLFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDRNDNAPRVLYPTLEPDGSALFDMVPRSAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL---FSLGLRTGEVRTARALGDRDSARQ-RLLVAVRDGGQPPLSATATLHLIFAD 664          

HSP 6 Score: 74.7146 bits (182), Expect = 5.166e-13
Identity = 80/287 (27.87%), Postives = 127/287 (44.25%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN---LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYISSK 2487
            F +D   G + T + LD E+  +  L++ A D G   +Q       +   D NDN P V+  + P L +++ E     ++  ++ RD D G NG V   I ++E                F I   SGN   L     LDRE    Y + I   D+G P L+S  ++TL + D+NDN P  F  V++  ++   +       I    ASDPD   N  +TY++   D         V I+A  G L A+++        + + L A D+G+P LS  + + L +  +
Sbjct:  290 FNLDSNTGEITTLHTLDFEEVKEYSLVLEAKDGGGMIAQCTVEIEVL---DENDNVPEVLFQSLPDLIMEDAEPG--TYIALLKTRDKDSGRNGEV---ICKLEGG------------APFKILTSSGNTYKLVTDGVLDREQNPEYNITIRATDKGDPPLSSSSSVTLHIGDVNDNAP-VFTKVSYLVHVAENN--PPGASIAQVSASDPDLGANGQVTYYIIASDLEPESLWSYVTINAQSGVLFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRLLVGDR 553          
BLAST of Protocadherin-9 vs. Ensembl Mouse
Match: Pcdhac2 (protocadherin alpha subfamily C, 2 [Source:MGI Symbol;Acc:MGI:1891443])

HSP 1 Score: 202.216 bits (513), Expect = 2.328e-60
Identity = 137/460 (29.78%), Postives = 225/460 (48.91%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLN--IDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL-GPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + Y+V EE   G  VGN+   +   + ++ P      +      +Y  L+ + G L + +RIDRE +C        RC + L +    P+      + I D+ND+ P+F    YQ+Q+SE+V  G R  + +A DPDV  N+V TY +   ++ F +        S +L L++   LD E    +   L A D G+P   G   +A+ VLD NDN P F Q  Y+V ++E+A  G +V  + A D D G  G++RY             F I   TGE+++   L+ +  +  + + ++A+D G VP  G+  V V + DVN+  P + +  L  P      V E+  L +  A++ V+D D G N +V   L      F+L+        + YTL  +   DRE  + + + +  +D G P LT++  + V+I D+N+  P F K +Y++ + EN+  G
Sbjct:   43 LRYSVPEEQSPGALVGNVARALGLELRRLGPGCLRINHLGAPSPRYLELDLTNGALFVNERIDREALC----EQRPRCLLSLEVLAHNPVAVSAIEVEILDINDNSPRFPRPDYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSP-SEHFELDLKPLQENSKVLELVLRKGLDREQTALHYLVLTAVDGGIPARSGTAQIAVRVLDTNDNSPAFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEE-SSSYQIYVQATDRGPVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSP------VPEDVALNTVVALLSVNDQDSGSNRKVSLGLEASLP-FRLNGFG-----NSYTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLKDSYSIYIEENNLPG 484          

HSP 2 Score: 51.9878 bits (123), Expect = 2.328e-60
Identity = 44/172 (25.58%), Postives = 82/172 (47.67%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            I+   G+L   N  D EK  +  + V A D+G P   ++T T  + + DVND+ P ++ P         E +P        +T++ A D D G+N  + +++    D            + +F ++  +G + I + +  E   ++ L ++V D G+P L++  AIT+ V+D
Sbjct:  523 INSASGSLYAVNSFDYEKFREFFVTVEAQDKGRP-PLSSTVTANVYVVDVNDHAPHILYPTSTNTSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLVPTSD------------SDLFKVELHTGEIRITRKIGDESGTTFNLTVVVRDNGEPPLSATVAITVAVVD 681          

HSP 3 Score: 101.679 bits (252), Expect = 3.070e-21
Identity = 102/407 (25.06%), Postives = 177/407 (43.49%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHL--TVGAENFKLSNSQTVKGRDIYT--LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQD 1516
            +   Y   +  + FS++ +TG++ ++  +D E+         A DR  + +     +     ++ I DVND+ P+   +     + E V +   ++L + +D D   N   +  +          F N   L+V   LD E    Y  T+ A D G+PPL   +TL + + DINDN P F +  Y + I+EN + G ++  V A D D     +V Y     ++Q   V SY  I++ +G +      + +   ++F + +EA D G  P     T  V++ DVN+  P I    L P   + +        +  A   V+     D D G NA +  HL  T  ++ FK+         +++T  ++  R    E  + F + ++  D G P L+    ITV + D
Sbjct:  294 SLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKV-----LVDIIDVNDNAPEVVLTDLYSPVPEDVALNTVVALLSVNDQDSGSNRKVSLGLEASLPFRLNGFGNSYTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLKDSYSIYIEENNLPGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSYVSINSASGSLYAVNSFDYEKF-REFFVTVEAQDKGRPPLSSTVTANVYVVDVNDHAPHI----LYPTSTNTSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLVPTSDSDLFKV---------ELHTGEIRITRKIGDESGTTFNLTVVVRDNGEPPLSATVAITVAVVD 681          

HSP 4 Score: 90.5077 bits (223), Expect = 6.959e-18
Identity = 110/458 (24.02%), Postives = 188/458 (41.05%), Query Frame = 2
Query:  203 QIQISVGNEFNRNIHYAVKEEIDVG-NFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGF-NDTFNITFS---NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYF---YISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHL------TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            Q+Q+S         H    ++ DVG N V         +++ P   F+L      LK         +L++ + +DREQ   T+   L    ++  I          + + D ND+ P F +S Y++Q+ E    G  +    ASDPD   N    Y +  + +D     FS       + V   LDYE   +Y+  + A D G  P+ G+  + + ++D+NDN P     +    + E+  +  VVA ++  D DSG   +V     +   P  L+ F   Y    +G +  +R+         +++ + A+DGG  P     T+ V + D+N+  P    +S         ++EN         +  +D D   NAEV   L       +   ++   NS +     +Y +     FD E    F V +   D+G P L++     V + DVN+ +P
Sbjct:  153 QLQVSESVAPGARFHIESAQDPDVGANSV-------QTYELSPSEHFELD-----LKPLQENSKVLELVLRKGLDREQ---TALHYLVLTAVDGGIPARSGTAQIAVRVLDTNDNSPAFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSPVPEDVALNTVVALLSVNDQDSGSNRKVSLGL-EASLPFRLNGFGNSYTLVVSGPLDRERVAA-------YNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLKDSY-----SIYIEENNLPGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSYVSINSAS---GSLYAVN---SFDYEKFREFFVTVEAQDKGRPPLSSTVTANVYVVDVNDHAP 576          

HSP 5 Score: 82.8037 bits (203), Expect = 1.752e-15
Identity = 80/291 (27.49%), Postives = 125/291 (42.96%), Query Frame = 1
Query: 1648 TRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS--LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQS-----IREGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            T  + + LF ID   G +R +  LD E+    ++ V A D+G P        V + I DVNDN P V+          +  L   +  +   D D G N  V           GL   +       F ++    + T+  S  LDRE + +Y + +   D G P LTS   + + + DINDNPP + +    S +I  +        +   QA+DPD + NA +TY + + +         V I++  G L A  S      RE  + + + A D G P LS+ +  N+Y+
Sbjct:  299 TSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRG-PVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSPVPEDVALNTVVALLSVNDQDSGSNRKVSL---------GLEASLP------FRLNGFGNSYTLVVSGPLDRERVAAYNITVTATDGGVPPLTSQRTLQVEISDINDNPPSFLK---DSYSIYIEENNLPGVLLCTVQATDPDQKENAEVTYSLLDREIQGLPVTSYVSINSASGSLYAVNSFDYEKFRE--FFVTVEAQDKGRPPLSSTVTANVYV 568          

HSP 6 Score: 82.8037 bits (203), Expect = 1.957e-15
Identity = 78/269 (29.00%), Postives = 125/269 (46.47%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV---LAQDQRIIIAQASDPDSRPNANITYHV--TEGDDLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            L  +  LDRE+     + V A D G P   T+  T+ + I+D+NDNPP+ +      +   E  LP + L  +QA DPD  EN  V + +   E  +GL        T   SI+  SG+L    S D E    + + +   D+G+P L+S     + V+D+ND+ P    P + +T+   + V         +    A D DS  NA + YH+  T   DL  ++   G++R  + I +     + + +V  DNG P LS  + I + +
Sbjct:  420 LVVSGPLDRERVAAYNITVTATDGGVP-PLTSQRTLQVEISDINDNPPSFLKD-SYSIYIEENNLPGVLLCTVQATDPDQKENAEVTYSLLDRE-IQGLP------VTSYVSINSASGSLYAVNSFDYEKFREFFVTVEAQDKGRPPLSSTVTANVYVVDVNDHAPHILYPTSTNTSAAIEMVPRTAPAGYLVTKVIAMDSDSGQNAWLFYHLVPTSDSDLFKVELHTGEIRITRKIGDESGTTFNLTVVVRDNGEPPLSATVAITVAV 679          

HSP 7 Score: 68.9366 bits (167), Expect = 2.967e-11
Identity = 66/268 (24.63%), Postives = 118/268 (44.03%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPK-----WFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-------GDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDRE+     L++ A+D G P +++ T  + + + D NDN P   +    +V+  E+  P   + ++ A DPD G NG +R+          L+    +   ++FSID  +G + +  +LD E   SY +Y+   D+G   +     + + ++D+NDN P+      + PV     + T         + +   +D DS  N  ++  +         G    Y   + G L      R   Y I + A D G P L+++  + + IS
Sbjct:  214 LDREQTALHYLVLTAVDGGIP-ARSGTAQIAVRVLDTNDNSP-AFDQSTYRVQLREDAPPGTLVVKLNASDPDEGSNGELRY---------SLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKVLVDIIDVNDNAPEVVLTDLYSPVPEDVALNTV--------VALLSVNDQDSGSNRKVSLGLEASLPFRLNGFGNSYTLVVSGPLDRE---RVAAYNITVTATDGGVPPLTSQRTLQVEIS 459          

HSP 8 Score: 60.4622 bits (145), Expect = 1.401e-8
Identity = 61/249 (24.50%), Postives = 102/249 (40.96%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQ-ARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT-----EGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVI 2541
            D+NDN P    P   Q++ +E   P     I+ A+DPD+G N    + +   E      + + EN +K+         L + K LDRE    + L +   D G P  +    I + VLD NDN P + Q    +  +  +        ++   ASDPD   N  + Y ++         L  ID   G++R   ++       Y I + A D G   ++   K+            +I+++D+   VV+
Sbjct:  139 DINDNSPRFPRP-DYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPSEHFELDLKPLQEN-SKVL-------ELVLRKGLDREQTALHYLVLTAVDGGIPARSGTAQIAVRVLDTNDNSPAFDQ---STYRVQLREDAPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDRERQLFSIDVTTGEVRVSGTLDYEESSSYQIYVQATDRGPVPMAGHCKV---------LVDIIDVNDNAPEVVL 366          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9HCL0|PCD18_HUMAN (Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3)

HSP 1 Score: 226.098 bits (575), Expect = 4.128e-66
Identity = 147/468 (31.41%), Postives = 242/468 (51.71%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSN--IFKIQPKST--FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN-VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
              +N+ Y + EE  VG+ +  L+ D    + K+   ST  F+    G       + E  G++ I   IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+ S   I+ISE+  VG RI L +A DPDV  N++ TY +   ND FNI        +    LIV+  LD E + +Y+  L A D G+P   G+  L IS+ D NDN P F Q+ Y + + EN+ VG ++ ++ A D D G  G++ Y F     P ++  F I +  G + L + ++ + I + + ++++A D G      +  + + + DVN+ +P ININ + P K++ + + E   + +  A++ V D D G+N E+ C L  G  +FKL  +      + Y +  N   DRE  S + + ++  DRGTP L+T +  TV+I D+N+  P F++  Y   +SEN++ G
Sbjct:   26 LGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPNPSTVRFRAMQRGNS-PLLVVNEDNGEISIGATIDREQLCQKNLN----CSIEFDVITLPTEHLQLFHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSA-NDFFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKIDSERGHLTLFKQVDYE-ITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLH-GHGHFKLQKTY----ENNYLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPG 481          

HSP 2 Score: 50.0618 bits (118), Expect = 4.128e-66
Identity = 51/160 (31.87%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQL 2139
            ID   G +    I D E+  +I  +V A D G P+   + TTV +TI D NDN P VI  P L+    E T+P        +T+I+A D D G N  +   I            +  N   IF ID  S ++    S+D      + L +++ D+G PQL
Sbjct:  520 IDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIG-PALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAI------------VAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQL 666          

HSP 3 Score: 115.546 bits (288), Expect = 1.134e-24
Identity = 117/415 (28.19%), Postives = 188/415 (45.30%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE------------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPK-----FAESYYQIQ-ISEAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK--VGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTE 1489
            +F  +   K+++ F ++   G L + +++D E             + P S  A   C+I             +I + DVND++P+      +    +I  I E   +   ++L    D D   N   VC    HG +     T+ N  YLI+ NA LD E +  Y  T++A D G P L   +   + + DINDN P F +  Y+ +I EN   G  +  VTA D D G  GQV Y   +  +   S+ +Y  I    G I   RI + + ++Q  +  +EA DGGS PK  V   TV + + D N+  PV+    +GPA +    +  + +      H   I   D D GVNAE+ C +  G  EN  + + ++    DI+T   N   D    + +++ ++  D+G P+L T+
Sbjct:  284 SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPA--HCKI-------------IIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHG-HFKLQKTYENN-YLILTNATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ-ITFVVEARDGGS-PKQLVSNTTVVLTIIDENDNVPVV----IGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSC---DIHT---NVSMDSVPYTEWELSVIIQDKGNPQLHTK 669          

HSP 4 Score: 81.2629 bits (199), Expect = 4.232e-14
Identity = 81/292 (27.74%), Postives = 128/292 (43.84%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPKWFQPVA--HSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSIREGHYL---IKLVANDNGNPNLSTEIKINLYI-----SSKSTFSTVINISDDQFRVVIVIAM 2553
            LDREK  +  L V+A D+G P S +      + I D+NDNPP         V     +   ++T + A DPDLGENG V + I    +   L   I    T   +ID  +G +   +  D E +      +   D G P QL S   + LT++D NDN P    P    ++  IT          +   +A D DS  NA ++  +  G  +++  ID    D+    S+    Y    + ++  D GNP L T++ +   I     S  ST  T ++ +     ++I+I++
Sbjct:  423 LDREKRSEYSLTVIAEDRGTP-SLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSPGAYITTVTATDPDLGENGQVTYTIL---ESFILGSSI----TTYVTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEITIPKGAESGFHVTRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQDKGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISL 706          

HSP 5 Score: 62.003 bits (149), Expect = 3.260e-8
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F ID   G+L     +D E     E+ V A D G P S  A   + I + DVNDN P +    ++P K ++    E  P+  F+  ++ +D D G NG +   +      +   +K  EN   I +            +LDRE    Y L ++  D+G P L++++  T+ + DINDNPP  FQ   +   I+  +  +    I    A+DPD   N  +TY + E
Sbjct:  297 FKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLG-PNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFK--LQKTYENNYLILT----------NATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPH-FQRSRYEFVISENN--SPGAYITTVTATDPDLGENGQVTYTILE 506          

HSP 6 Score: 58.5362 bits (140), Expect = 3.747e-7
Identity = 67/261 (25.67%), Postives = 113/261 (43.30%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVT-----------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            LDRE     EL + A D G P+ ++ ++ + I+I+D NDN P        +Q+ EN     + L  + A DPD G NG + +           +  +     + F ID   G+LT++K +D E   SY + +   D G   + +   I + V+D+NDN P+    +          +      D  + + +  D DS  N  I   +            E + L+  +A +   R ++S     Y + ++A D G P+LST
Sbjct:  204 LDRELKSSYELQLTASDMGVPQ-RSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLL-DLNATDPDEGANGKIVY---------SFSSHVSPKIMETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATLD--REKRS----EYSLTVIAEDRGTPSLST 447          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|A7MB46|PCD18_BOVIN (Protocadherin-18 OS=Bos taurus OX=9913 GN=PCDH18 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 9.491e-65
Identity = 145/468 (30.98%), Postives = 243/468 (51.92%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSN--IFKIQPKST--FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ----DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN-VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
              +N+ Y + EE  VG+ +  L+ D    + K+   ST  F+    G       + E  G++ I  +IDREQ+C  +      C IE  +       + +  I+    D+ND+ P+F+ S   I+ISE+  VG RI L +A DPDV  N++ TY +   ND FNI        +    LIV+  LD E + +Y+  L A D G+P   G+  L IS+ D NDN P F Q+ Y + + EN+ VG ++ ++ A D D G  G++ Y F     P ++  F I +  G + L + ++ + I + + ++++A D G      +  + + + DVN+ +P I+IN + P K++ + + E   + +  A++ V D D G+N E+ C L  G  +FKL  +      + Y +  N   DRE  S + + ++  D+GTP L+T +  TV+I D+N+  P F++  Y   +SEN++ G
Sbjct:   26 LGKNLKYRIYEEQRVGSVIARLSEDVADVLVKLPNPSTVRFRAMQRGNT-PLLVVNEDNGEISIGAKIDREQLCQKNLN----CSIEFDVITLPTEHLQLFHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSA-NDFFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIIETFKIDSERGHLTLFKQVDYE-ITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLH-GHGHFKLQKTY----ENNYLILTNATLDREKRSEYSLTVIAEDKGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFAISENNSPG 481          

HSP 2 Score: 47.3654 bits (111), Expect = 9.491e-65
Identity = 49/160 (30.63%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQL 2139
            ID   G +    I D E+  +I  +V A D G P+   + TTV +TI D NDN P VI  P L+    E ++P        +T+I+A D D G N  +   I            +  N   IF ID  S ++    S++      + L +++ D+G PQL
Sbjct:  520 IDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIG-PALRNNTAEISIPKGAESGFHVTRIRAIDRDSGVNAELSCSI------------VAGNEENIFVIDPRSCDIHTNVSMESVPYTEWELSVVIQDKGNPQL 666          

HSP 3 Score: 112.079 bits (279), Expect = 1.380e-23
Identity = 117/415 (28.19%), Postives = 190/415 (45.78%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE------------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFA---ESYYQIQIS---EAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQ--VQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK--VGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTE 1489
            +F  +   K+++ F ++   G L + +++D E             + P S  A   C+I             +I + DVND++P+ +    S  + +IS   E   +   ++L    D D   N   VC    HG +     T+ N  YLI+ NA LD E +  Y  T++A D G P L   +   + + DINDN P F +  Y+  I EN   G  +  VTA D D G  GQV Y   +  +   S+ +Y  I    G I   RI + + ++Q  +  +EA DGGS PK  V   TV + + D N+  PV+    +GPA +    + ++ +      H   I   D D GVNAE+ C +  G  EN  + + ++    DI+T   N   +    + +++ ++  D+G P+L T+
Sbjct:  284 SFSSHVSPKIIETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPA--HCKI-------------IIKVVDVNDNKPEISINLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHG-HFKLQKTYENN-YLILTNATLDREKRSEYSLTVIAEDKGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFAISENNSPGAYITTVTATDPDLGENGQVTYTILESFILGSSITTYDTIDPSNGAIYALRIFDHEEVSQ-ITFVVEARDGGS-PKQLVSNTTVVLTIIDENDNVPVV----IGPALRNNTAEISIPKGAESGFHVTRIRAIDRDSGVNAELSCSIVAGNEENIFVIDPRSC---DIHT---NVSMESVPYTEWELSVVIQDKGNPQLHTK 669          

HSP 4 Score: 80.1073 bits (196), Expect = 1.032e-13
Identity = 81/293 (27.65%), Postives = 133/293 (45.39%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPKWFQPVA--HSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLR---ARQSIREGHYLIKLVANDNGNPNLSTEIKINLYI-----SSKSTFSTVINISDDQFRVVIVIAM 2553
            LDREK  +  L V+A D+G P S +      + I D+NDNPP      + +   +E   P  ++T + A DPDLGENG V + I    +   L   I    T   +ID  +G +   +  D E +      +   D G P QL S   + LT++D NDN P    P    ++  I+          +   +A D DS  NA ++  +  G++  +  ID    D+    + +S+    + + +V  D GNP L T++ +   I     S  ST  T ++ +     ++I+I++
Sbjct:  423 LDREKRSEYSLTVIAEDKGTP-SLSTVKHFTVQINDINDNPPH-FQRSRYEFAISENNSPGAYITTVTATDPDLGENGQVTYTIL---ESFILGSSI----TTYDTIDPSNGAIYALRIFDHEEVSQITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEISIPKGAESGFHVTRIRAIDRDSGVNAELSCSIVAGNEENIFVIDPRSCDIHTNVSMESVPYTEWELSVVIQDKGNPQLHTKVLLKCVIFEYAESVTSTAMTSVSQAPLDVSMIIIISL 706          

HSP 5 Score: 62.3882 bits (150), Expect = 2.151e-8
Identity = 66/226 (29.20%), Postives = 103/226 (45.58%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            F ID   G+L     +D E     E+ V A D G P S  A   + I + DVNDN P +    ++P K ++    E  P+  F+  ++ +D D G NG +   +      +   +K  EN   I +            +LDRE    Y L ++  D+G P L++++  T+ + DINDNPP  FQ   +   I+  +  +    I    A+DPD   N  +TY + E
Sbjct:  297 FKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLG-PNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFK--LQKTYENNYLILT----------NATLDREKRSEYSLTVIAEDKGTPSLSTVKHFTVQINDINDNPPH-FQRSRYEFAISENN--SPGAYITTVTATDPDLGENGQVTYTILE 506          

HSP 6 Score: 58.9214 bits (141), Expect = 2.930e-7
Identity = 67/261 (25.67%), Postives = 113/261 (43.30%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ---DQRIIIAQASDPDSRPNANITYHVT-----------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            LDRE     EL + A D G P+ ++ ++ + I+I+D NDN P        +Q+ EN     + L  + A DPD G NG + +           +  +     + F ID   G+LT++K +D E   SY + +   D G   + +   I + V+D+NDN P+    +          +      D  + + +  D DS  N  I   +            E + L+  +A +   R ++S     Y + ++A D G P+LST
Sbjct:  204 LDRELKSSYELQLTASDMGVPQ-RSGSSILKISISDSNDNSPAFEQQSYIIQLLENSPVGTLLL-DLNATDPDEGANGKIVY---------SFSSHVSPKIIETFKIDSERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEISINLMSPGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTNATLD--REKRS----EYSLTVIAEDKGTPSLST 447          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q6PB90|PCDBE_MOUSE (Protocadherin beta-14 OS=Mus musculus OX=10090 GN=Pcdhb14 PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 3.115e-61
Identity = 160/493 (32.45%), Postives = 257/493 (52.13%), Query Frame = 2
Query:  152 NFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNL--NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCH--------LTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENST 1582
            + H++ Q   + +++ + +    G+     I Y+V EE D G+ VGNL  ++  ++ ++  +    L    K L    LE+ +G L++ +++DRE++C ++   +   Q+ L    P+ +    I +QDVNDH P+F E    ++I E+   G    L+ A D DV  N V  Y +   N  F++   N         L++  ALD E Q   + TL A D G PP  G   + I VLDINDN P F+Q  Y+V ++EN+ VG +V  V+A D+D+G  G++ Y   Q  +  VL  F ++T TGEI+++++L+ + I Q + + IEASDGG +   G  TV +H+ DVN+  P + ++ L        + EN    +  AI  +SD D G N ++ C         L    ENF             YTL   R  DRE  + + + +  SD GTP+LTT+  ITV++ D+N+ +P F   +YT+ V EN++
Sbjct:    4 SLHKAPQKRQVTAIIFLLLLWEAGSA---TITYSVLEETDRGSLVGNLAKDLGLSLRELITRGAQILSKGNKQL--LQLEQKSGNLLLKEKLDREELCGSTNPCILHFQVLLK--SPVQFIQGEIQLQDVNDHAPEFMEDEILLKILESSLPGAVFPLKIAQDLDVGSNTVQNYTI-STNAHFHLLTRNHSDGRKYPELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDLDAGTHGELSYSLFQSSN-QVLQAFEVNTDTGEIRVRKLLDFEEI-QSYRMEIEASDGGGL--SGKCTVVIHVMDVNDNAPELTMSVL-----ISEIPENSP-ETIVAIFGISDPDSGDNGKMVCSVQDRLPFLLKPNEENF-------------YTLVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNS 465          

HSP 2 Score: 95.5153 bits (236), Expect = 1.366e-18
Identity = 114/453 (25.17%), Postives = 201/453 (44.37%), Query Frame = 2
Query:  254 VKEEIDVG-NFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPT--SFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQ----VRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP--RFKKQNYTVNVSE 1573
            + +++DVG N V N  I +N  F +  ++    + DG+  KY        +L++ + +DRE+      + TA+D      T    +     VI + D+ND+ P+FA+  Y++Q+ E   VG  +   +A D D   +   +Y +   ++     F   ++   + V   LD+E   +Y+  + A D G   L G  T+ I V+D+NDN P  +       I EN+    +VA     D DSG  G+    V+ R   +  P+  +++ + T       +R L+ ++ A+ +++ I  SD G+       T+ V + D+N+  P     S         V+EN +   H   I  +D D G NA +   L    +     NS      D   L   R  D E    F+  +  +D G+P L+++  + V + D N+ +P   +  QN +   +E
Sbjct:  156 IAQDLDVGSNTVQNYTISTNAHFHLLTRN----HSDGR--KY-------PELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQV-----VIVVLDINDNAPEFAQGLYEVQVQENSPVGSLVLTVSARDLDAGTHGELSYSLFQSSNQVLQAFEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGG--LSGKCTVVIHVMDVNDNAPELTMSVLISEIPENS-PETIVAIFGISDPDSGDNGKMVCSVQDRLPFLLKPNEENFYTLVT-------ERALDRESRAE-YNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSY-----TMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTE 574          

HSP 3 Score: 64.3142 bits (155), Expect = 2.452e-18
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQA-RDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-------LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +R   +LD E+     + + A D G    +       +   DVNDN P +     + + E  E  P  +  I    DPD G+NG +   +  V+D+  L   +  N    ++       L   ++LDRE    Y + I V D G P+LT+   IT+ V DINDN P +      S  +  +   +    I    A+D DS  NA+ITY +    D       L+ I+A  G L A +++       +   + A D G+P LS++  + + +
Sbjct:  292 FEVNTDTGEIRVRKLLDFEEIQSYRMEIEASDGGGLSGKCTVVIHVM---DVNDNAPELTM--SVLISEIPENSPETIVAIFGISDPDSGDNGKM---VCSVQDR--LPFLLKPNEENFYT-------LVTERALDRESRAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHT---SYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDPQLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVV 551          

HSP 4 Score: 51.6026 bits (122), Expect = 2.452e-18
Identity = 35/144 (24.31%), Postives = 65/144 (45.14%), Query Frame = 2
Query: 1157 VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + L+DVN+  P    + +        + E+    + F +    D D+G N   +  ++  A +F L       GR    L  ++  DRE  +  ++ +   D G+P  T   ++ + + D+N+ +P F +  Y V V ENS +G
Sbjct:  121 IQLQDVNDHAPEFMEDEI-----LLKILESSLPGAVFPLKIAQDLDVGSNTVQNYTISTNA-HFHLLTRNHSDGRKYPELVLDKALDREEQAQIRLTLTAMDSGSPPKTGTTQVVIVVLDINDNAPEFAQGLYEVQVQENSPVG 258          

HSP 5 Score: 75.8702 bits (185), Expect = 1.548e-12
Identity = 77/304 (25.33%), Postives = 132/304 (43.42%), Query Frame = 2
Query:  383 EESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV-----PIDYWINVITIQ--DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLY-------LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF------SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLG--PAKKD 1228
            EE+   L+  + +DRE           R +  +TI V     P     + IT+Q  D+ND+ P F  + Y + + E       I   +A+D D   N   TY +   +D   +  ++L+        L  + ALDYE    ++  + A D G P L     + + VLD NDN P        +      ++   A  G +V  V AVD DSG    + ++  +  +P +   F +  + GE++  R+L+ +++ +   L +   D G  P     T+ V L D  +Q P + +  +   PA++D
Sbjct:  397 EENFYTLVTERALDRES----------RAEYNITITVSDMGTPRLTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNSPALHIGTISATDSDSGSNAHITYSLLPPHDP-QLALNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGL---FSVWAHNGEVRTTRLLSERDVPK-HRLLLLVKDNGEPPHSASVTLHVLLVDGFSQ-PYLPLPEVARDPAQED 684          

HSP 6 Score: 66.2402 bits (160), Expect = 1.416e-9
Identity = 72/270 (26.67%), Postives = 127/270 (47.04%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHV--TEGDDLVYIDAIIGDLRARQSIRE----GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            L T   LDRE   +  + +   D G PR  T   T+ + ++D+NDN P   +    + V+EN     + +  I A D D G N  + + +    D + LA         + SI+  +G L   ++LD E + ++  ++   D G P L+S   + + VLD NDN P    P+ +++   T+ +  A +   ++ +  A D DS  NA +++ +  T    L  + A  G++R  + + E     H L+ LV  DNG P  S  + +++ +
Sbjct:  403 LVTERALDRESRAEYNITITVSDMGTPR-LTTQHTITVQVSDINDNAPAFTHTSYTMFVRENNSP-ALHIGTISATDSDSGSNAHITYSLLPPHDPQ-LA------LNSLISINADNGQLFALRALDYEALQAFEFHVGATDGGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKTTEPGLFSVWAHNGEVRTTRLLSERDVPKHRLLLLV-KDNGEPPHSASVTLHVLL 662          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q9UN71|PCDGG_HUMAN (Protocadherin gamma-B4 OS=Homo sapiens OX=9606 GN=PCDHGB4 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 4.084e-61
Identity = 150/457 (32.82%), Postives = 241/457 (52.74%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YF++   +G+L+++ R+DRE++C         C +E       P++++   + I+D+NDH PKF ++ +++QISE+ Q G R  L +A D D+  N +  Y +   +D F++        S    +++   LD E Q +Y  TL A D G PPL     + + V D NDN PVFSQ  Y+V + EN   G  V  VTA D D G+  ++ + F +    S ++ F +++ TGEI +   L+ + + +++S+ +EA DGG +  +   TV V + D N+  P +   SL        + E+  L +H A++ V D D   N EV C L  G   FK+  S     R+ Y L  + V DRE +  + + +  +DRG P L++   IT+ I DVN+ +P F + +Y V+V+EN+  G
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLG-FSVQELPTRKLRVSSEK-PYFTVSAESGELLVSSRLDREEICGKK----PACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILGSAHDADIGSNTLQNYQLSP-SDHFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFSFSEA---SQITQFDLNSNTGEITVLNTLDFEEV-KEYSIVLEARDGGGM--IAQCTVEVEVIDENDNAPEVIFQSLPNL-----IMEDAELGTHIALLKVRDKDSRHNGEVTCKLE-GDVPFKILTSS----RNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPG 466          

HSP 2 Score: 103.219 bits (256), Expect = 5.936e-21
Identity = 104/405 (25.68%), Postives = 175/405 (43.21%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHY-AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR--------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY--RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHLTVGAE 1342
            L S  QI + ++  N+    F+++++  ++ E +  G  V  +        +  + TF  + +   +  F L  +TG++ +   +D E+V   S     R        C +E+ +              D ND+ P+         I E  ++G  I+L    D D   N   T  + G      +T S   Y +V +A LD E    Y  T+ A D G PPL  + ++ + + D+NDN PVFSQ  Y V + EN   G  ++ V A D D G  GQV Y      ++   + SY  IS  +G +  QR  + + + + F L ++A D GS       ++ V + D N+  P +   +LGP     F++  +     +     V+ D D G NA +  H+   +E
Sbjct:  222 LSSTAQIHVLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFS-FSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI-------------DENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQL-RAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASE 611          

HSP 3 Score: 102.449 bits (254), Expect = 1.018e-20
Identity = 106/404 (26.24%), Postives = 184/404 (45.54%), Query Frame = 2
Query:  371 YFSL---EESTG----KLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVD-CHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            +FSL   E+S G    ++++   +DRE+      + TALD     L+    I      + + D ND+ P F++  Y++ +SE V  G  +   TA+D D   N   T+    F++   IT     SN   + V+N LD+E    Y   L A D G   +    T+ + V+D NDN P    +    +I E+A +G  +A +   D DS   G+V  +  G V           S  T ++    +L+ +    ++++ + A+D G  P    +++ +H+ DVN+  PV + +S        +V EN    +  + +  SD D+G N +V  C +    E  +LS+  ++           R FD E    F++ +   D+G+P L+    + V + D N+ +PR
Sbjct:  177 HFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIH-----VLVTDANDNAPVFSQDVYRVSLSENVYPGTTVLQVTATDQDEGVNAEITF---SFSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGG--MIAQCTVEVEVIDENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVP----FKILTSSRNTYKLVTDAVLD-REQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSY-----IVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFA-QRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPR 559          

HSP 4 Score: 92.4337 bits (228), Expect = 1.322e-17
Identity = 89/322 (27.64%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYL-------IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDN-----HPVFSQKEYKV--IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD 1171
            + E+ ++G  +  L +     +   + T KL  D    K  +   +T KL+    +DREQ      + TA DR +  L+    I      + I DVND+ P F++S Y + ++E    G  IS   ASDPD+ PN   +Y +   +D      S+ + +           A D+E    ++ TL A D G P L  N +L + V D NDN     +P        +  ++   A  G +V  V AVD DSG    + Y   Q  +P +   F +   TGE++  R L  ++  +   L +   DGG  P    AT+ +   D
Sbjct:  354 IMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPF-KILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSI-----TLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMA-SDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL---FSLGLRTGEVRTARALGDRDAVRQ-RLLVAVRDGGQPPLSATATLHLVFAD 664          

HSP 5 Score: 79.7221 bits (195), Expect = 9.495e-14
Identity = 84/308 (27.27%), Postives = 151/308 (49.03%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVE-DKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI--REGHYLIKLVA-NDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVT 2559
            L T  +LDRE+  +  + V A D+G+P   ++++++ + I DVNDN P V +     V   E   P   ++Q++A DPDLG NG V + I   + ++R L+  +        SI   SG +   ++ D E + ++ L +   DQG P L++  ++ + V D NDN P+   P           ++  A +   ++ +  A D DS  NA ++YHV +  +  L  +    G++R  +++  R+      LVA  D G P LS    ++L + + S    + +I+D           QF +V+ +A+++
Sbjct:  402 LVTDAVLDREQNPEYNITVTATDRGKP-PLSSSSSITLHIGDVNDNAP-VFSQSSYIVHVAENNPPGASISQVRASDPDLGPNGQVSYCIMASDLEQRELSSYV--------SISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPHAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAVRQRLLVAVRDGGQPPLSATATLHL-VFADSLQEVLPDITDRPDPSDLQAELQFYLVVALALIS 698          

HSP 6 Score: 66.6254 bits (161), Expect = 1.126e-9
Identity = 75/284 (26.41%), Postives = 124/284 (43.66%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP--VAH-STNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +   N LD E+  +  +++ A D G   +Q       I   D NDN P VI  + P L +++ E  L   +  ++ RD D   NG V   ++             +   KI +    +  L     LDRE    Y + +   D+GKP L+S  +ITL + D+NDN P + Q   + H + N    + ++Q       +ASDPD  PN  ++Y +   D         V I A  G + A+++        + + L A D G+P LS  + + + +
Sbjct:  290 FDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI---DENDNAPEVIFQSLPNLIMEDAE--LGTHIALLKVRDKDSRHNGEVTCKLE------------GDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTATDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQ------VRASDPDLGPNGQVSYCIMASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLV 550          
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Match: sp|Q5DRA8|PCDGG_PANTR (Protocadherin gamma-B4 OS=Pan troglodytes OX=9598 GN=PCDHGB4 PE=3 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.191e-60
Identity = 150/457 (32.82%), Postives = 240/457 (52.52%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y + EE+  G+ VGNL  D   F +Q   T KL    +   YF++   +G+L+++ R+DRE++C         C +E       P++++   + I+D+NDH PKF ++ +++QISE+ Q G R  L +A D D+  N +  Y +   +D F++        S    +++   LD E Q +Y  TL A D G PPL     + + V D NDN PVFSQ  Y+V + EN   G  V  VTA D D G+  ++ + F +    S ++ F +++ TGEI +   L+ + + +++S+ +EA DGG +  +   TV V + D N+  P +   SL        + E+  L +H A++ V D D   N EV C L  G   FK+  S     R+ Y L  + V DRE +  + + +   DRG P L++   IT+ I DVN+ +P F + +Y V+V+EN+  G
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLG-FSVQELPTRKLRVSSEK-PYFTVSAESGELLVSSRLDREEICGKKPA----CALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILGSAHDADIGSNTLQNYQLSP-SDHFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIHVLVTDANDNAPVFSQDIYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFSFSEA---SQITQFDLNSNTGEITVLNTLDFEEV-KEYSIVLEARDGGGM--IAQCTVEVEVIDENDNAPEVIFQSLPNL-----IMEDAELGTHIALLKVRDKDSRHNGEVTCKLE-GDVPFKILTSS----RNTYKLVTDAVLDREQNPEYNITVTARDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPG 466          

HSP 2 Score: 103.219 bits (256), Expect = 5.936e-21
Identity = 105/405 (25.93%), Postives = 175/405 (43.21%), Query Frame = 2
Query:  182 LVSLMQIQIQISVGNE----FNRNIHY-AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR--------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHLTVGAE 1342
            L S  QI + ++  N+    F+++I+  ++ E +  G  V  +        +  + TF  + +   +  F L  +TG++ +   +D E+V   S     R        C +E+ +              D ND+ P+         I E  ++G  I+L    D D   N   T  + G      +T S   Y +V +A LD E    Y  T+ A D G PPL  + ++ + + D+NDN PVFSQ  Y V + EN   G  ++ V+A D D G  GQV Y      ++   + SY  IS  +G +  QR  + + + + F L ++A D GS       ++ V + D N+  P +   +LGP     F++        +     V+ D D G NA +  H+   +E
Sbjct:  222 LSSTAQIHVLVTDANDNAPVFSQDIYRVSLSENVYPGTTVLQVTATDQDEGVNAEITFS-FSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI-------------DENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTARDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVSASDPDLGPNGQVSYCIIASDLEQRELSSYVSISAESGVVFAQRAFDHEQL-RAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASE 611          

HSP 3 Score: 101.293 bits (251), Expect = 2.675e-20
Identity = 106/404 (26.24%), Postives = 183/404 (45.30%), Query Frame = 2
Query:  371 YFSL---EESTG----KLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVD-CHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR 1537
            +FSL   E+S G    ++++   +DRE+      + TALD     L+    I      + + D ND+ P F++  Y++ +SE V  G  +   TA+D D   N   T+    F++   IT     SN   + V+N LD+E    Y   L A D G   +    T+ + V+D NDN P    +    +I E+A +G  +A +   D DS   G+V  +  G V           S  T ++    +L+ +    ++++ + A D G  P    +++ +H+ DVN+  PV + +S        +V EN    +  + +  SD D+G N +V  C +    E  +LS+  ++           R FD E    F++ +   D+G+P L+    + V + D N+ +PR
Sbjct:  177 HFSLINKEKSDGSKYPEMVLKTPLDREKQKSYHLTLTALDFGAPPLSSTAQIH-----VLVTDANDNAPVFSQDIYRVSLSENVYPGTTVLQVTATDQDEGVNAEITF---SFSEASQITQFDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGG--MIAQCTVEVEVIDENDNAPEVIFQSLPNLIMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVP----FKILTSSRNTYKLVTDAVLD-REQNPEYNITVTARDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSY-----IVHVAENNPPGASISQVSASDPDLGPNGQVSYCIIASDLEQRELSSYVSISAESGVVFA-QRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPR 559          

HSP 4 Score: 92.4337 bits (228), Expect = 1.368e-17
Identity = 89/322 (27.64%), Postives = 141/322 (43.79%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYL-------IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDN-----HPVFSQKEYKV--IIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKD 1171
            + E+ ++G  +  L +     +   + T KL  D    K  +   +T KL+    +DREQ      + TA DR +  L+    I      + I DVND+ P F++S Y + ++E    G  IS  +ASDPD+ PN   +Y +   +D      S+ + +           A D+E    ++ TL A D G P L  N +L + V D NDN     +P        +  ++   A  G +V  V AVD DSG    + Y   Q  +P +   F +   TGE++  R L  ++  +   L +   DGG  P    AT+ +   D
Sbjct:  354 IMEDAELGTHIALLKVRDKDSRHNGEVTCKLEGDVPF-KILTSSRNTYKLVTDAVLDREQNPEYNITVTARDRGKPPLSSSSSI-----TLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQVSASDPDLGPNGQVSYCIIA-SDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGL---FSLGLRTGEVRTARALGDRDAVRQ-RLLVAVRDGGQPPLSATATLHLVFAD 664          

HSP 5 Score: 78.1814 bits (191), Expect = 2.999e-13
Identity = 83/308 (26.95%), Postives = 149/308 (48.38%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIF-SIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL--AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI--REGHYLIKLVA-NDNGNPNLSTEIKINLYISSKSTFSTVINISDD----------QFRVVIVIAMVT 2559
            L T  +LDRE+  +  + V A D+G+P   ++++++ + I DVNDN P V +     V   E   P   ++Q+ A DPDLG NG V + I        +A  +++     + SI   SG +   ++ D E + ++ L +   DQG P L++  ++ + V D NDN P+   P           ++  A +   ++ +  A D DS  NA ++YHV +  +  L  +    G++R  +++  R+      LVA  D G P LS    ++L + + S    + +I+D           QF +V+ +A+++
Sbjct:  402 LVTDAVLDREQNPEYNITVTARDRGKP-PLSSSSSITLHIGDVNDNAP-VFSQSSYIVHVAENNPPGASISQVSASDPDLGPNGQVSYCI--------IASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVDDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAVRQRLLVAVRDGGQPPLSATATLHL-VFADSLQEVLPDITDRPDPSDLEAELQFYLVVALALIS 698          

HSP 6 Score: 65.0846 bits (157), Expect = 3.401e-9
Identity = 75/284 (26.41%), Postives = 123/284 (43.31%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP--VAH-STNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYI 2478
            F ++   G +   N LD E+  +  +++ A D G   +Q       I   D NDN P VI  + P L +++ E  L   +  ++ RD D   NG V   ++             +   KI +    +  L     LDRE    Y + +   D+GKP L+S  +ITL + D+NDN P + Q   + H + N    + ++Q        ASDPD  PN  ++Y +   D         V I A  G + A+++        + + L A D G+P LS  + + + +
Sbjct:  290 FDLNSNTGEITVLNTLDFEEVKEYSIVLEARDGGGMIAQCTVEVEVI---DENDNAPEVIFQSLPNLIMEDAE--LGTHIALLKVRDKDSRHNGEVTCKLE------------GDVPFKILTSSRNTYKLVTDAVLDREQNPEYNITVTARDRGKPPLSSSSSITLHIGDVNDNAPVFSQSSYIVHVAENNPPGASISQ------VSASDPDLGPNGQVSYCIIASDLEQRELSSYVSISAESGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLV 550          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A4S2LP53 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_007339 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.985e-103
Identity = 193/509 (37.92%), Postives = 277/509 (54.42%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTS------FTALD-------------------RCQIELTIFVPIDYWINVI-TIQDVNDHQPKF----AES----YYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDT-FNITFSN--LLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLG-PAKK----------DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK--KQNYTVNVSENSTIG 1588
            + + Y + EE +VG+F+GNL +D+    + P S    F+LYDD K   YF +E  +GKL +A RIDRE +CP          A D                   +C++ L++FV  +YWINVI TI D+ND+QP F    AES     Y + +SE+VQ G+ I L  A D D   N V +Y + G  FN   F +++S    L LIV++ LD E + NY   +VACD G P P CG Q L I V D+NDN PVF +  Y+VI+ E  + G  V  V A D DSG  G VRY+ GQ    +VL +F +   +G +  ++ ++ K+ A  F + + A DGGSVP +G + V + + DVN+  P I +  +  P K+             V ENQ + ++  +I V D DIG N+ V+C L      F L ++ + KGR++Y+L  N+ FDRE   D    V++ CSD+G P   TE+ I ++I DVNEFSP F   ++NY + + E    G
Sbjct:   33 KELSYTINEEAEVGSFIGNLKLDAERKFLIPYSQLTHFELYDDSKQ-NYFRIEPDSGKLFVAARIDRETICPQPELLSGRLAAQDHRMWAPALGSEEYGQSDSKKCELHLSLFVAQEYWINVIITIHDINDNQPYFPIGLAESTKPNVYVVNVSESVQSGHEIPLIGARDSDSGINTVQSYTLRGDEFNPALFAVSYSPPFTLNLIVLDELDAERKANYTGEIVACDGGQPSPKCGVQPLFIHVTDVNDNKPVFEKHVYEVIVNETVLNGSTVLTVHASDADSGSHGSVRYQIGQPVGQAVLDHFGLDASSGRLYTKKPIDAKDTAL-FVIPVLAKDGGSVPLIGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEGTMWVYENQPVGTNLGLIIVGDEDIGDNSLVECKLQEREYRFYLEHANSAKGREMYSLSTNQSFDRESLPDGSTSVQVTCSDKGNPTQKTEKSIAIQILDVNEFSPEFPADRRNYNIQIEEGQNPG 539          

HSP 2 Score: 102.834 bits (255), Expect = 2.985e-103
Identity = 101/336 (30.06%), Postives = 141/336 (41.96%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG--EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKI---FSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLT-SIEAITLTVLDINDNPPKW---------------------------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT--------EGDD---LVYIDA------------------IIG-DLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            + LF ID   G + T  ILDRE   KI   V A  +   E         V +T+TD+NDN PT++    L++ EN       + Q+ A D D G NGTVR+ +  V         + EN   +   F I++ SG L   +SLDRE    Y L+++  D G P+   + + I + VLD NDN P+W                              V     + T + L + QR+    A+D DS  NAN+T+H+         EGDD   L+Y                     IIG  LR       G   I L  +DNGNP L    ++ + IS
Sbjct:  565 QSLFHIDPQSGRVTTRKILDRESTPKIRFTVHATGKNILEGDVNATVANVTVTLTDINDNEPTLVENEVLKIVENRPGFSDLVGQLIAIDKDAGLNGTVRYKLLSV---------LTENNNPVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIVVDVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSSRNANLTFHLVTTYFTPEMEGDDTQRLMYQSGKATTMPNYFMVSSTSGELIIGPGLRGAGLSEPGLAEIYLRVSDNGNPPLEKTARLFVRIS 891          

HSP 3 Score: 73.9442 bits (180), Expect = 2.164e-9
Identity = 107/432 (24.77%), Postives = 185/432 (42.82%), Query Frame = 2
Query:  362 LLKYFSLEESTGKLIIAQRIDREQ----VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQP------------------KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTL-VAC-DCGMPPLCGNQTLAISVLDINDNHPVFS--QKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQ-DFSLNIEASD--GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSPRFK 1543
            +L +F L+ S+G+L   + ID +     V P    A D   + L     I   +  I++ DVNDH P                  KF+E    + + E   VG  + L    D D+  N++    +      F +  +N      +Y +  N + D E+  +  T++ V C D G P     +++AI +LD+N+  P F   ++ Y + I+E    G  V    A D+D+     + Y   +     V S F+I   +G +  ++IL+ ++  +  F+++    +   G V     A V V L D+N+  P +  N +        + EN+   S      ++ D D G+N  V   L +V  EN    N   +  ++   L   R  DRE  S +++ +L  D GTP+   T + I V + D N+  P ++
Sbjct:  332 VLDHFGLDASSGRLYTKKPIDAKDTALFVIPV--LAKDGGSVPL-----IGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEG--TMWVYENQPVGTNLGLIIVGDEDIGDNSLVECKLQEREYRFYLEHANSAKGREMYSLSTNQSFDRESLPDGSTSVQVTCSDKGNPTQKTEKSIAIQILDVNEFSPEFPADRRNYNIQIEEGQNPGSFVFQAEATDLDATPM--IYYYLSR----EVQSLFHIDPQSGRVTTRKILDRESTPKIRFTVHATGKNILEGDV-NATVANVTVTLTDINDNEPTLVENEV------LKIVENRPGFSDLVGQLIAIDKDAGLNGTVRYKLLSVLTENNNPVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIVVDVLDENDNKPEWR 741          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A3R7FMR5 (Protocadherin alpha-4 OS=Clonorchis sinensis OX=79923 GN=Pcdha4 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 4.158e-102
Identity = 189/509 (37.13%), Postives = 274/509 (53.83%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTS------FTALD-------------------RCQIELTIFVPIDYWINVI-TIQDVNDHQPKF----AESY----YQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDT-FNITFSN--LLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLG-PAKK----------DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK--KQNYTVNVSENSTIG 1588
            + + Y + EE +VG+F+GNL +D+    + P S    F+LYDD K   YF +E  +GKL +A RIDRE +CP          A D                   +C++ L++FV  +YWINVI  I D+ND+QP F    A+S     Y + +SE+VQ G+ I L  A D D   N V +Y + G   N   F +++S    L LIV++ LD E + NY   +VACD G P P CG Q L I V DINDN PVF +  Y+V++ E  + G  V  V A D DSG  G VRY+ GQ     VL +F +   +G +  ++ ++ K+ A  F + + A DGGSVP +G + V + + DVN+  P I +  +  P K+             + ENQ + ++  +I V D DIG N+ V+C L      F L ++ + KGR++Y+L  N+ FDRE   D    V++ CSD+G P   TE+ I ++I DVNEFSP F   ++NY + + E    G
Sbjct:   33 KELSYTINEEAEVGSFIGNLKLDAERKFLIPYSQLTHFELYDDSKQ-NYFRIEPDSGKLFVAARIDRETICPQPELLSGRLAAQDHRMWAPTLGSEEYGQSDSKKCELHLSLFVAQEYWINVIIAIHDINDNQPYFPIGLAQSTKPNIYVVNVSESVQSGHEIPLIGARDSDAGINAVQSYTLRGDELNPALFAVSYSPPFTLNLIVLDELDAERKANYTGEIVACDGGQPSPKCGVQPLLIHVTDINDNKPVFEKHVYEVVVNETVLTGSTVLTVHASDADSGSHGSVRYQIGQPVSQVVLDHFGLDASSGRLYTKKPIDAKDTAL-FVIPVLAKDGGSVPLIGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEGTMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYDIQIEEGQNPG 539          

HSP 2 Score: 103.605 bits (257), Expect = 4.158e-102
Identity = 96/335 (28.66%), Postives = 144/335 (42.99%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG--EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLT-SIEAITLTVLDINDNPPKW---------------------------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT--------EGDDLVYI---------------------DAIIG-DLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            +++ LF ID + G + T  +LDRE   KI   V A D+   E    +    V +T+TD+NDN PT++    L++ EN       + Q+ A D D   NGTVR+ +  V  +  +A          F I++ SG L   +SLDRE    Y L+++  D G P+   + + I + VLD NDN P+W                              V     + T + L + QR+    A+D DS  NAN+T+H+         EGDD  ++                     + +IG  LR       G   I L  +DNGNP L    ++ + IS
Sbjct:  563 EAQSLFHIDPHSGRVTTRKVLDRESTPKIRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVENEVLKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIA------VNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSSRNANLTFHLVTTYFTPEMEGDDTQHLMHHSGKATTMPNYFMVSSTSGELMIGPGLRGAGLSEPGLAEIYLRVSDNGNPPLEKTSRLFIRIS 891          

HSP 3 Score: 68.1662 bits (165), Expect = 1.347e-7
Identity = 103/432 (23.84%), Postives = 183/432 (42.36%), Query Frame = 2
Query:  362 LLKYFSLEESTGKLIIAQRIDREQ----VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQP------------------KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTL-VAC-DCGMPPLCGNQTLAISVLDINDNHPVFS--QKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG---SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSPRFK 1543
            +L +F L+ S+G+L   + ID +     V P    A D   + L     I   +  I++ DVNDH P                  KF+E    + I E   VG  + L    D D+  N++    +      F +  +N      +Y +  N + D E+  +  T++ + C D G P     +++AI ++D+N+  P F   ++ Y + I+E    G  V    A D+D+     + Y   +       S F+I  ++G +  +++L+ ++  +     + A+D     S      A V V L D+N+  P +  N +        + EN+   S      ++ D D  +N  V   L +V  EN    N   +  ++   L   R  DRE  S +++ +L  D GTP+   T + I V++ D N+  P ++
Sbjct:  332 VLDHFGLDASSGRLYTKKPIDAKDTALFVIP--VLAKDGGSVPL-----IGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEG--TMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYDIQIEEGQNPGTFVFQAEANDLDATPM--IHYYLSR----EAQSLFHIDPHSGRVTTRKVLDRESTPK-IRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVENEV------LKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIAVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWR 741          
BLAST of Protocadherin-9 vs. TrEMBL
Match: G7YNN2 (Protocadherin alpha-4 OS=Clonorchis sinensis OX=79923 GN=CLF_103848 PE=4 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 4.189e-102
Identity = 189/509 (37.13%), Postives = 274/509 (53.83%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKST---FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTS------FTALD-------------------RCQIELTIFVPIDYWINVI-TIQDVNDHQPKF----AESY----YQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG--FNDT-FNITFSN--LLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLG-PAKK----------DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREV--DSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK--KQNYTVNVSENSTIG 1588
            + + Y + EE +VG+F+GNL +D+    + P S    F+LYDD K   YF +E  +GKL +A RIDRE +CP          A D                   +C++ L++FV  +YWINVI  I D+ND+QP F    A+S     Y + +SE+VQ G+ I L  A D D   N V +Y + G   N   F +++S    L LIV++ LD E + NY   +VACD G P P CG Q L I V DINDN PVF +  Y+V++ E  + G  V  V A D DSG  G VRY+ GQ     VL +F +   +G +  ++ ++ K+ A  F + + A DGGSVP +G + V + + DVN+  P I +  +  P K+             + ENQ + ++  +I V D DIG N+ V+C L      F L ++ + KGR++Y+L  N+ FDRE   D    V++ CSD+G P   TE+ I ++I DVNEFSP F   ++NY + + E    G
Sbjct:   33 KELSYTINEEAEVGSFIGNLKLDAERKFLIPYSQLTHFELYDDSKQ-NYFRIEPDSGKLFVAARIDRETICPQPELLSGRLAAQDHRMWAPTLGSEEYGQSDSKKCELHLSLFVAQEYWINVIIAIHDINDNQPYFPIGLAQSTKPNIYVVNVSESVQSGHEIPLIGARDSDAGINAVQSYTLRGDELNPALFAVSYSPPFTLNLIVLDELDAERKANYTGEIVACDGGQPSPKCGVQPLLIHVTDINDNKPVFEKHVYEVVVNETVLTGSTVLTVHASDADSGSHGSVRYQIGQPVSQVVLDHFGLDASSGRLYTKKPIDAKDTAL-FVIPVLAKDGGSVPLIGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEGTMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYHIQIEEGQNPG 539          

HSP 2 Score: 103.605 bits (257), Expect = 4.189e-102
Identity = 96/335 (28.66%), Postives = 144/335 (42.99%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG--EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLT-SIEAITLTVLDINDNPPKW---------------------------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT--------EGDDLVYI---------------------DAIIG-DLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            +++ LF ID + G + T  +LDRE   KI   V A D+   E    +    V +T+TD+NDN PT++    L++ EN       + Q+ A D D   NGTVR+ +  V  +  +A          F I++ SG L   +SLDRE    Y L+++  D G P+   + + I + VLD NDN P+W                              V     + T + L + QR+    A+D DS  NAN+T+H+         EGDD  ++                     + +IG  LR       G   I L  +DNGNP L    ++ + IS
Sbjct:  563 EAQSLFHIDPHSGRVTTRKVLDRESTPKIRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVENEVLKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIAVN------DTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWRPMLPLLPDGQYSAQSAYSKYASRLLGLDKVFELGQLNTTAPLHRGQRVCKLAATDADSSRNANLTFHLVTTYFTPEMEGDDTQHLMHHSGKATTMPNYFMVSSTSGELMIGPGLRGAGLSEPGLAEIYLRVSDNGNPPLEKTSRLFIRIS 891          

HSP 3 Score: 67.781 bits (164), Expect = 1.843e-7
Identity = 103/432 (23.84%), Postives = 183/432 (42.36%), Query Frame = 2
Query:  362 LLKYFSLEESTGKLIIAQRIDREQ----VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQP------------------KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTL-VAC-DCGMPPLCGNQTLAISVLDINDNHPVFS--QKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG---SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSPRFK 1543
            +L +F L+ S+G+L   + ID +     V P    A D   + L     I   +  I++ DVNDH P                  KF+E    + I E   VG  + L    D D+  N++    +      F +  +N      +Y +  N + D E+  +  T++ + C D G P     +++AI ++D+N+  P F   ++ Y + I+E    G  V    A D+D+     + Y   +       S F+I  ++G +  +++L+ ++  +     + A+D     S      A V V L D+N+  P +  N +        + EN+   S      ++ D D  +N  V   L +V  EN    N   +  ++   L   R  DRE  S +++ +L  D GTP+   T + I V++ D N+  P ++
Sbjct:  332 VLDHFGLDASSGRLYTKKPIDAKDTALFVIP--VLAKDGGSVPL-----IGQSVVRISVTDVNDHAPWIEVRPVQLPGKQVTSGVKFSEG--TMWIYENQPVGTNLGLIIVGDEDIGDNSLVECKLQESEYRFYLEHANSAKGREMYSLSANQSFDRESLPDGSTSVQITCSDKGDPTQKTEKSIAIQIIDVNEFSPEFPADRRNYHIQIEEGQNPGTFVFQAEANDLDATPM--IHYYLSR----EAQSLFHIDPHSGRVTTRKVLDRESTPK-IRFTVHATDKNLLESDLNSTVANVTVTLTDINDNEPTLVENEV------LKIVENRPGFSDLVGQLIAIDKDADLNGTVRYKLLSVLTENNIAVNDTFMINQESGKLFTLRSLDREQCSQYRLHVLAYDLGTPESKNTTQTIIVEVLDENDNKPEWR 741          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A4E0R475 (Protocadherin-1 OS=Fasciola hepatica OX=6192 GN=D915_007004 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 4.782e-99
Identity = 183/505 (36.24%), Postives = 265/505 (52.48%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPK---STFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP----------TSFT----------------ALDRCQIELTIFVPIDYWINVI-TIQDVNDHQPKFA-------ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN---DTFNITFSN--LLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL------GPAKK----DFN----VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNV 1567
            F + + YA+ EE +VG+FVGNL +D+    + P    + F LYDD +   YF +E+ TGKL +A RIDRE +CP          T++T                  + CQ+ L + +   +W+NVI TI D+NDH+P F         S Y + ISE+V  GY + L  A D D   N+V TY + G       F I +     L L+++  LD ET+  Y   LVACD G P PLCG Q   + V D+NDN PVF++  Y+V ++E   +   V  + A D DSG  G V+Y FGQ    +V  +F +   TGE+  QR +N +   + F + + A DGG VP +G   V + ++DVN+  P I I ++      GP  +    D N    V ENQ + ++  ++   D D+G N+ V CHL     +F L ++ + KGR++Y L  N  FDRE  +D    V +LC D G PK +TE +I +++ D NEF+P F     T NV
Sbjct:   32 FQKELTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDTRQ-GYFRVEQETGKLFVAARIDREAICPQPDALIPDKLTTYTEDLWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEVPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILRELDAETKSTYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGHVQYLFGQPISQAVHHHFRLDPVTGELITQRGMNARENPR-FIIPVVAKDGGLVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNV 534          

HSP 2 Score: 102.449 bits (254), Expect = 4.782e-99
Identity = 97/354 (27.40%), Postives = 150/354 (42.37%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEP--RSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQ-LTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV---------------------------LAQDQRIIIAQASDPDSRPNANITYHV--------TEGDDL-------------------VYIDAIIGD------LRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQF 2529
            +++ LF ID   G + T  ILDRE+  KI   V A DQ +   R+  A   + + + D+NDN P +       + EN       + Q+ + D D+G NGTVR+ +  V    G    I  +    F ++  SG L   +SLDRE    Y L +++ D+G PQ L S   IT+ VLD NDN P W  P+   + +   S+                               Q++    A+DPD+  NAN+TYH+         E  DL                     + A  GD      L    S + G   + L   DNGNP L +  ++ + ++S +  S +++ ++  F
Sbjct:  567 EAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAVANITVHLADINDNAPELTGNRAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYSLVSVS---GNGNPIAND---TFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSIPEALRQNSRMLGLVNFKDLGLLNATTPFYHGQKVTRLTATDPDAPHNANLTYHLLATYFIPFNEEFDLGKESAHSFASRVAPNVPTYFKLSATTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLDSSARLFVQLTSYNPTSVILDPNNGGF 914          

HSP 3 Score: 85.1149 bits (209), Expect = 9.057e-13
Identity = 96/366 (26.23%), Postives = 159/366 (43.44%), Query Frame = 2
Query:  500 DYWINVITIQDVNDHQPK----FAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQIN--YKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF--SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQ----DFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSP 1534
            D WI +  +Q V    P+      +    + +SE   +G  I L  A D DV  N+     +      F +  +N      +Y +  N + D E  ++      ++  D G P     + +AI VLD N+  P F  SQK   V ++E   VG  V  V A D D+    ++ +   +       + F+I   +G I  + IL+ + + +     ++ + + SD  + P V  A + VHL D+N+  P +  N      + F++ EN+   S       S D D+G N  V   L +V      ++N   +   D   L   R  DRE  S +++ +L  DRGTP+ L +   ITV + D N+ +P
Sbjct:  391 DPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNVYLEEGKPVGTFVIQVRATDEDA--TPKIEHYLSR----EAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAV--ANITVHLADINDNAPELTGN------RAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYSLVSVSGNGNPIANDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAP 742          
BLAST of Protocadherin-9 vs. TrEMBL
Match: A0A2H1C537 (Cadherin domain protein OS=Fasciola hepatica OX=6192 GN=D915_10443 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 7.072e-99
Identity = 183/505 (36.24%), Postives = 265/505 (52.48%), Query Frame = 2
Query:  230 FNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPK---STFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCP----------TSFT----------------ALDRCQIELTIFVPIDYWINVI-TIQDVNDHQPKFA-------ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN---DTFNITFSN--LLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL------GPAKK----DFN----VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNV 1567
            F + + YA+ EE +VG+FVGNL +D+    + P    + F LYDD +   YF +E+ TGKL +A RIDRE +CP          T++T                  + CQ+ L + +   +W+NVI TI D+NDH+P F         S Y + ISE+V  GY + L  A D D   N+V TY + G       F I +     L L+++  LD ET+  Y   LVACD G P PLCG Q   + V D+NDN PVF++  Y+V ++E   +   V  + A D DSG  G V+Y FGQ    +V  +F +   TGE+  QR +N +   + F + + A DGG VP +G   V + ++DVN+  P I I ++      GP  +    D N    V ENQ + ++  ++   D D+G N+ V CHL     +F L ++ + KGR++Y L  N  FDRE  +D    V +LC D G PK +TE +I +++ D NEF+P F     T NV
Sbjct:   32 FQKELTYAINEESEVGSFVGNLKLDAERKFLIPYNQLTRFDLYDDTRQ-GYFRVEQETGKLFVAARIDREAICPQPDALIPDKLTTYTEDLWSTLPGQRNGDQSGANVCQVHLALHIAQQFWVNVIITIHDINDHKPYFPIGSADAEPSLYTVNISESVTAGYEVPLIGAKDADAGMNSVQTYSLRGAELDPSLFAIAYKPPFTLNLVILRELDAETKSTYHGELVACDGGQPQPLCGAQPFQVFVNDLNDNKPVFTKSLYEVEVEETLPINSTVIRLNATDADSGPRGHVQYLFGQPISQAVHHHFRLDPVTGELITQRGMNARENPR-FIIPVVAKDGGLVPLIGQTVVQITVRDVNDHDPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNV 534          

HSP 2 Score: 102.064 bits (253), Expect = 7.072e-99
Identity = 97/354 (27.40%), Postives = 150/354 (42.37%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEP--RSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQ-LTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV---------------------------LAQDQRIIIAQASDPDSRPNANITYHV--------TEGDDL-------------------VYIDAIIGD------LRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQF 2529
            +++ LF ID   G + T  ILDRE+  KI   V A DQ +   R+  A   + + + D+NDN P +       + EN       + Q+ + D D+G NGTVR+ +  V    G    I  +    F ++  SG L   +SLDRE    Y L +++ D+G PQ L S   IT+ VLD NDN P W  P+   + +   S+                               Q++    A+DPD+  NAN+TYH+         E  DL                     + A  GD      L    S + G   + L   DNGNP L +  ++ + ++S +  S +++ ++  F
Sbjct:  567 EAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAVANITVHLADINDNAPELTGNRAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYSLVSVS---GNGNPIAND---TFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAPVWSDPLRIMSALKYVSIPEALRQNSRMLGLVNFKDLGLLNATTPFYHGQKVTRLTATDPDAPHNANLTYHLLATYFIPFNEEFDLGKESAHSFASRVAPNVPTYFKLSATTGDLFIGPGLGGAGSAKSGLAELYLRVCDNGNPPLDSSARLFVQLTSYNPTSVILDPNNGGF 914          

HSP 3 Score: 85.1149 bits (209), Expect = 7.542e-13
Identity = 96/366 (26.23%), Postives = 159/366 (43.44%), Query Frame = 2
Query:  500 DYWINVITIQDVNDHQPK----FAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQIN--YKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF--SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQ----DFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-DGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSP 1534
            D WI +  +Q V    P+      +    + +SE   +G  I L  A D DV  N+     +      F +  +N      +Y +  N + D E  ++      ++  D G P     + +AI VLD N+  P F  SQK   V ++E   VG  V  V A D D+    ++ +   +       + F+I   +G I  + IL+ + + +     ++ + + SD  + P V  A + VHL D+N+  P +  N      + F++ EN+   S       S D D+G N  V   L +V      ++N   +   D   L   R  DRE  S +++ +L  DRGTP+ L +   ITV + D N+ +P
Sbjct:  391 DPWIEIRAVQSVRQQGPQSRSNLTDKNTSLFVSENQPIGTNIGLLIAGDEDVGDNSAVVCHLKSNQAHFYLEHANSAKGREMYRLGTNLSFDREALLDGVVYVDVLCLDGGNPKRSTERKIAIQVLDENEFTPSFDTSQKTQNVYLEEGKPVGTFVIQVRATDEDA--TPKIEHYLSR----EAQNLFHIDAESGAITTRVILDREQMPKIRFNVYATDQDQSDRRASPAV--ANITVHLADINDNAPELTGN------RAFHIVENRPGFSDLVGQLTSIDKDVGNNGTVRYSLVSVSGNGNPIANDTFMLNPDSGKLFTLRSLDREQYSQYELVVLLEDRGTPQALNSTATITVDVLDENDNAP 742          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000034478.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10757013:10760663:1 gene:ENSAMXG00000031253.1 transcript:ENSAMXT00000034478.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 4.165e-63
Identity = 155/462 (33.55%), Postives = 238/462 (51.52%), Query Frame = 2
Query:  227 EFNR-NIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +F+R  I Y++ EE+  G  VGNL  D NI   + +S       G   +YF +   TG L +  R DRE++C        +C + +      P+  +   + I D+ND+ P F+     + ISE V  G R SL  A D DV  + V  Y +   N+ F+I       S    L++  A+D E Q   K TL A D G PP  G   + ++VLDINDN+PVFSQ  YKV ++ENA VG  +  V+A D+D G+ G+V Y     +  SV++ F I+ ++G+I ++  ++ +  A    L I+A D    P+ G   V + + DVN+  P +++  L  +     V E+    + FA++ VSD D G + +VDC +T  A  FKL +S     ++ Y+L  N   DRE  S + V ++ +D G P L++   + V + DVN+  P F     ++NV ENS  G
Sbjct:   23 DFSRCQISYSISEEVKKGAVVGNLAKDLNIDVQELQSRMFQVVAGSNKRYFDVNLKTGVLFVNDRFDREELCERK----QKCSLNIEAMAQNPLTLYRIEVNILDINDNSPVFSLQTLLLNISENVLPGDRFSLPLAHDMDVGTHAVKNYKLSA-NEYFSIDVQISGESASAELVLQKAIDREKQALVKLTLTATDGGKPPRSGTLEILVNVLDINDNYPVFSQPLYKVKVQENAAVGTKILTVSATDLDEGINGEVVYAIVGHERSSVVNLFSINPHSGDITVKGNIDYEENAA-IELRIQAHDKSHSPRHGNCKVLIEVLDVNDNAPEVSVTLLMSS-----VSEDTKPGTGFALVTVSDQDSGTSGKVDCRVT--ALPFKLQSSY----KNSYSLIVNEPLDRECVSQYNVTIVANDEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAG 467          

HSP 2 Score: 47.7506 bits (112), Expect = 4.165e-63
Identity = 44/165 (26.67%), Postives = 73/165 (44.24%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTS 2145
            L  ++   G L      D E   +I+  V A D G P   ++  TV + I D NDN P +++P       N E +P       F+ +I+A D D G N  + ++I    + +G           +F I   SG +   + +    + ++ L I VCD G+P L++
Sbjct:  503 LMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDSGTP-PLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPYSADAGYFVGKIRAIDADSGYNALLSYHIT---EPKG---------NNLFCIGSSSGEIRTKRRMSDNDLKTHPLVITVCDHGEPSLSA 654          

HSP 3 Score: 109.383 bits (272), Expect = 7.443e-24
Identity = 106/390 (27.18%), Postives = 172/390 (44.10%), Query Frame = 2
Query:  347 YDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            ++   ++  FS+   +G + +   ID E+          R Q       P      V I + DVND+ P+ + +     +SE  + G   +L T SD D   +      +         ++ N   LIV   LD E    Y  T+VA D G+PPL     L + V D+NDN P+F      + ++EN+  G +++ +TA D+D G  GQV Y    G+     V +   +++ TGE+   +  + ++  Q     ++A+D G+ P     TV V + D N+ RPVI    L P  +  +V       S  A  +V      D D G NA +  H+T    N  F + +S      +I T +  R+ D ++ +H  V  +C D G P L+ 
Sbjct:  281 HERSSVVNLFSINPHSGDITVKGNIDYEENAAIEL----RIQAHDKSHSPRHGNCKVLIEVLDVNDNAPEVSVTLLMSSVSEDTKPGTGFALVTVSDQDSGTSGKVDCRVTALPFKLQSSYKNSYSLIVNEPLDRECVSQYNVTIVANDEGIPPLSSTMVLHVLVSDVNDNVPLFPALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDTKQ-IQFKVQATDSGTPPLSSNVTVNVFILDENDNRPVI----LSPYSETGSVNTENIPYSADAGYFVGKIRAIDADSGYNALLSYHITEPKGNNLFCIGSSSG----EIRTKR--RMSDNDLKTHPLVITVC-DHGEPSLSA 654          

HSP 4 Score: 79.7221 bits (195), Expect = 1.062e-14
Identity = 74/258 (28.68%), Postives = 130/258 (50.39%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKEN-EETLP--MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLST 2454
            LDRE   +  + ++A D+G P   ++T  + + ++DVNDN P     P L +  N +E  P  + L+ I A+D D GENG V + +   E    L        + + +++ ++G L   +S D E        +   D G P L+S   + + +LD NDN P    P + + ++ T+++  + D    + +  A D DS  NA ++YH+TE  G++L  I +  G++R ++ + +     H L+  V  D+G P+LS 
Sbjct:  409 LDRECVSQYNVTIVANDEGIP-PLSSTMVLHVLVSDVNDNVPLF---PALVISINVQENSPAGVLLSTITAQDVDDGENGQVSYSLINGEGTGTLV-------STLMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDSGTPPLSSNVTVNVFILDENDNRPVILSPYSETGSVNTENIPYSADAGYFVGKIRAIDADSGYNALLSYHITEPKGNNLFCIGSSSGEIRTKRRMSDNDLKTHPLVITVC-DHGEPSLSA 654          

HSP 5 Score: 68.5514 bits (166), Expect = 3.255e-11
Identity = 80/288 (27.78%), Postives = 127/288 (44.10%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-------LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            RS    LF I+ + G++     +D E+   IEL + A D+   PR       V I + DVNDN P V +   L    +E+T P      +   D D G +G V   +        L  K+  +    +S       L + + LDRE +  Y + I+  D+G P L+S   + + V D+NDN P  F  +  S N+   S        I AQ  D D   N  ++Y +  G+        L+ ++++ G+L   QS           K+ A D+G P LS+ + +N++I
Sbjct:  283 RSSVVNLFSINPHSGDITVKGNIDYEENAAIELRIQAHDKSHSPRH--GNCKVLIEVLDVNDNAPEV-SVTLLMSSVSEDTKPGTGFALVTVSDQDSGTSGKVDCRVT------ALPFKLQSSYKNSYS-------LIVNEPLDRECVSQYNVTIVANDEGIPPLSSTMVLHVLVSDVNDNVP-LFPALVISINVQENSPAGVLLSTITAQ--DVDDGENGQVSYSLINGEGTGTLVSTLMNLNSLTGELYCLQSFDYEDTKQIQFKVQATDSGTPPLSSNVTVNVFI 551          

HSP 6 Score: 58.9214 bits (141), Expect = 3.092e-8
Identity = 72/266 (27.07%), Postives = 124/266 (46.62%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR----IIIAQASDPDSRPNANITYHVT------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            +DREK   ++L + A D G+P  ++ T  + + + D+NDN P    P  K++V+EN       LT + A D D G NG V + I  V  +R        +   +FSI+  SG++T+  ++D E   +  L I   D+          + + VLD+NDN P+       S  +   SV ++D +      +   SD DS  +  +   VT      +         I+ +   R+ + +  Y + +VAND G P LS+ + +++ +S
Sbjct:  197 IDREKQALVKLTLTATDGGKP-PRSGTLEILVNVLDINDNYPVFSQPLYKVKVQENAAVGTKILT-VSATDLDEGINGEVVYAI--VGHER-------SSVVNLFSINPHSGDITVKGNIDYEENAAIELRIQAHDKSHSPRHGNCKVLIEVLDVNDNAPEV------SVTLLMSSV-SEDTKPGTGFALVTVSDQDSGTSGKVDCRVTALPFKLQSSYKNSYSLIVNEPLDRECVSQ--YNVTIVANDEGIPPLSSTMVLHVLVS 442          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000050733.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10707461:10713100:1 gene:ENSAMXG00000042154.1 transcript:ENSAMXT00000050733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 5.961e-62
Identity = 154/458 (33.62%), Postives = 232/458 (50.66%), Query Frame = 2
Query:  233 NRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLY------LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +R I Y+V EE+  G FVG L  D N+   + +S           K+F +   TG L + + IDRE+VCP S    +   +E  +  P++ +   + I DVND+ P F   Y  I+ISE    G +  L +A DPDV  N+V +Y +   N  F++  +          L++  ALD E Q   +  L A D G P   G  ++ +SVLD NDN P F+++ YK  + ENA VG V+  + A D D G+ G++ Y F + Q   V   F I++ +GEI +   L+ ++++  + L +EA D G  P   +  V V + DVN+  P I + SL       NV E     S  A I V D D G N  V C ++  +  F L ++Q   G+  Y+L   +  DRE +  + V +  +D G P L++   +TV++ DVN+  PRF +Q   V V ENS  G
Sbjct:   24 SRQIVYSVSEEVSPGTFVGPLAKDLNLKLDELESRALRIVSTSSKKHFDVNMKTGALFVQKAIDREEVCPNSNVCTE--SLEAIVNNPLNVYSIDVKILDVNDNTPTFRGKYQHIKISEQTMPGAKFPLLSAEDPDVGSNSVASYKLSN-NQFFSLEVNTEAESGPSPELVLQKALDREKQAEIQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAVGMVILKLNATDPDEGVNGEIIYTFKEGQK-GVSDRFIINSSSGEIAIAGPLDYEDVSA-YELRVEARDKGHSPLASHCKVLVEVLDVNDNAPDIKLTSLLD-----NVSEGAKKGSVIAFITVQDKDEGKNGIVHCSISNNSP-FILESTQ---GK-YYSLVLGQELDREQNELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAG 466          

HSP 2 Score: 40.817 bits (94), Expect = 5.961e-62
Identity = 40/162 (24.69%), Postives = 70/162 (43.21%), Query Frame = 1
Query: 1678 IDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM------FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTS 2145
            I+   G + +    + E+    +  V A D G P   ++  TV + I D NDN P  + P       + E +P       F+ +I+A D D G N  + ++I    + +G           +F +   SG +   + L    + ++ L I VCD G+P L++
Sbjct:  501 INSMTGEIYSMQSFNYEEIKHFQFQVQATDSGTP-PLSSNVTVNVFILDENDNRPVTLPPYSEAGSVSTENIPYSAEAGYFVGKIRAVDADSGYNALLSYHIT---EPKG---------NNLFRVGSSSGEIRTKRRLSDNDLKTHPLVITVCDHGEPSLSA 649          

HSP 3 Score: 107.842 bits (268), Expect = 2.477e-23
Identity = 114/396 (28.79%), Postives = 179/396 (45.20%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLY--LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR-FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            TFK    G +   F +  S+G++ IA  +D E V        A D+    L     +     ++ + DVND+ P    +     +SE  + G  I+  T  D D E  N   +     N  F +  +   Y  L++   LD E    Y  ++ A D G+PPL     + + V D+NDN P F ++   V +KEN+  G ++A V+A D+D G   QV Y  F +    S +S   I++ TGEI   +  N + I + F   ++A+D G+ P     TV V + D N+ RPV    +L P  +  +V       S  A  +V      D D G NA +  H+T    N  F++ +S      +I T +  R+ D ++ +H  V  +C D G P L+ 
Sbjct:  276 TFKEGQKG-VSDRFIINSSSGEIAIAGPLDYEDVSAYELRVEARDKGHSPLASHCKV-----LVEVLDVNDNAPDIKLTSLLDNVSEGAKKGSVIAFITVQDKD-EGKNGIVHCSISNNSPFILESTQGKYYSLVLGQELDREQNELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGLIALVSAQDIDIGENSQVTYSLFAKSYLSSAVS---INSMTGEIYSMQSFNYEEI-KHFQFQVQATDSGTPPLSSNVTVNVFILDENDNRPV----TLPPYSEAGSVSTENIPYSAEAGYFVGKIRAVDADSGYNALLSYHITEPKGNNLFRVGSSSG----EIRTKR--RLSDNDLKTHPLVITVC-DHGEPSLSA 649          

HSP 4 Score: 80.1073 bits (196), Expect = 9.972e-15
Identity = 72/256 (28.12%), Postives = 132/256 (51.56%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLST 2454
            LDRE+ +   + + A D+G P   ++TT V + + DVNDNPP  +     + VKEN     + +  + A+D D+GEN  V + +     K  L+  +        SI+ ++G +   +S + E I  +   +   D G P L+S   + + +LD NDN P    P + + +++T+++  + +    + +  A D DS  NA ++YH+TE  G++L  + +  G++R ++ + +     H L+  V  D+G P+LS 
Sbjct:  408 LDREQNELYNVSITATDEGIP-PLSSTTVVTVRVYDVNDNPPRFLEQFVNVYVKENSPAGGL-IALVSAQDIDIGENSQVTYSLFA---KSYLSSAV--------SINSMTGEIYSMQSFNYEEIKHFQFQVQATDSGTPPLSSNVTVNVFILDENDNRPVTLPPYSEAGSVSTENIPYSAEAGYFVGKIRAVDADSGYNALLSYHITEPKGNNLFRVGSSSGEIRTKRRLSDNDLKTHPLVITVC-DHGEPSLSA 649          

HSP 5 Score: 79.337 bits (194), Expect = 1.415e-14
Identity = 77/280 (27.50%), Postives = 122/280 (43.57%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQR-----VEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDL---VYIDAIIGDLRARQSIRE---GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F I+   G +  A  LD E     EL V A D+G      +   V + + DVNDN P +     L            +  I  +D D G+NG V   I       +E  +G          K +S       L + + LDRE  + Y + I   D+G P L+S   +T+ V D+NDNPP++ +      N+  K        I +  A D D   N+ +TY +     L   V I+++ G++ + QS       H+  ++ A D+G P LS+ + +N++I
Sbjct:  288 FIINSSSGEIAIAGPLDYEDVSAYELRVEARDKGH-SPLASHCKVLVEVLDVNDNAPDIKLTSLLDNVSEGAKKGSVIAFITVQDKDEGKNGIVHCSISNNSPFILESTQG----------KYYS-------LVLGQELDREQNELYNVSITATDEGIPPLSSTTVVTVRVYDVNDNPPRFLE---QFVNVYVKENSPAGGLIALVSAQDIDIGENSQVTYSLFAKSYLSSAVSINSMTGEIYSMQSFNYEEIKHFQFQVQATDSGTPPLSSNVTVNVFI 546          

HSP 6 Score: 75.485 bits (184), Expect = 2.261e-13
Identity = 54/160 (33.75%), Postives = 89/160 (55.62%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            LDREK  +I+LI+ A+D G P +++ T ++ +++ D NDN PT      K +V EN   + M + ++ A DPD G NG + +  +  E ++G++++        F I+  SG + I   LD E + +Y L +   D+G   L S   + + VLD+NDN P
Sbjct:  196 LDREKQAEIQLILTAVDGGRP-ARSGTASIVVSVLDANDNAPTFAKQVYKARVPEN-AAVGMVILKLNATDPDEGVNGEIIYTFK--EGQKGVSDR--------FIINSSSGEIAIAGPLDYEDVSAYELRVEARDKGHSPLASHCKVLVEVLDVNDNAP 343          

HSP 7 Score: 61.2326 bits (147), Expect = 5.746e-9
Identity = 58/223 (26.01%), Postives = 96/223 (43.05%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIRE-------GHYLIKLVANDNGNPNLSTEIKI 2466
            DVNDN PT     +  +K +E+T+P      + A DPD+G N    +   ++ + +  + +++            S  L + K+LDRE      L +   D G+P  +   +I ++VLD NDN P + + V  +      +V      I+   A+DPD   N  I Y   EG   V    II       +I           Y +++ A D G+  L++  K+
Sbjct:  121 DVNDNTPTFRGKYQ-HIKISEQTMPGAKFPLLSAEDPDVGSNSVASY---KLSNNQFFSLEVNTEAES-----GPSPELVLQKALDREKQAEIQLILTAVDGGRPARSGTASIVVSVLDANDNAPTFAKQVYKARVPENAAV---GMVILKLNATDPDEGVNGEIIYTFKEGQKGVSDRFIINSSSGEIAIAGPLDYEDVSAYELRVEARDKGHSPLASHCKV 331          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh1gc5 (protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GENE-041118-16])

HSP 1 Score: 201.06 bits (510), Expect = 7.097e-62
Identity = 149/480 (31.04%), Postives = 241/480 (50.21%), Query Frame = 2
Query:  173 AFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQ--PKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL------LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            AFLL+  + +       N     IHY + EE+  G+ VGN+  D   F +    KS  ++  +    +YF ++   G+LI+  RIDRE +C  +   L    +++ I  P+      I IQD+ND+ P F      ++I+E+  +G R  + +A DPD   N++ +Y ++  N+ F +    L        LI+   LD E Q+ +K  L A D G P   G+  L I V D NDN P F  + YK  ++E+A +G  V  + A DMD G+ G+++Y F       V   F ++  +GEI +   L+ + I   ++ +I A D G     G+++V + + D N+  P I + SL        V EN T+ +  A+I V D D G N +V   +  G   FKL +S      + Y+L  +   DRE++S + + ++ +D G+P L T + I V I DVN+ +P F + +Y V + EN+  G
Sbjct:   13 AFLLLGFVLLW------NTVGAQIHYTIAEEVKEGSIVGNIAKDLG-FDVSRVAKSKLRIASESSR-QYFDVDTEKGELIVNGRIDRETLCGQAVNCL--VPLQIIIEEPLQLHRVEIEIQDINDNAPNFHTKESVLKIAESAALGSRFPIESAEDPDSGKNSLKSYSLNS-NEHFRLNVKALDGGRKVPELILDKPLDREKQLIHKLILTALDGGDPVRSGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVTIKATDMDEGINGEIQYYFAAHTPDYVRKVFNVNPDSGEITVIGKLDHEGI-NSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPNP-----VPENATVGTVVALINVMDLDSGENGKVSLKIPKGFP-FKLKSS----FENHYSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENNVAG 470          

HSP 2 Score: 58.151 bits (139), Expect = 7.097e-62
Identity = 55/198 (27.78%), Postives = 91/198 (45.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD-----INDNPPKWFQPVAHSTNIT 2232
            F+I+   G + + +  D EK  ++ LIV A D G P S ++  T+ + I D NDN P+VI P  +    + + +P        +T++ A D D G N  + +          LAE  D     +FS++  +G +   +SL  +   S  L I + D G+P  ++   + + + D     I+D P K   P   S  IT
Sbjct:  507 FYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSP-SLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQRMPRSAKPGHLVTKVTAVDADSGHNAWISYR---------LAEATD---ASLFSVNLHTGEVRTKRSLSEQEDSSQRLLIEIQDNGEPVQSTTVTVDVLIEDGFHEPISDYPKKSTDPNKKSGKIT 691          

HSP 3 Score: 104.76 bits (260), Expect = 2.333e-22
Identity = 104/394 (26.40%), Postives = 170/394 (43.15%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDV-EPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI-----NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLS-NSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQD 1516
            K F++   +G++ +  ++D E +   +F   A D+   +L     +      I + D ND+ P+   +     + E   VG  ++L    D D  E   V      GF      +F N   LI  ++LD E    Y   +VA D G PPL   +T+ +++LD+NDN P FSQ  Y V IKEN + G  + ++TA+D D      + Y     +V D    SYFYI++  G I      + + + +  +L ++A D GS      AT+ V + D N+  P +      + S+   +   + K    +    A+    D D G NA +   L    +    S N  T + R        R    + DS  ++ +   D G P  +T   + V I+D
Sbjct:  290 KVFNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGYPKLEGHSSVH-----IRVIDENDNPPEIILTSLPNPVPENATVGTVVALINVMDLDSGENGKVSLKIPKGFPFKLKSSFENHYSLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQTSYNVYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKR-LTLIVQAKDHGSPSLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQRMPRSAKPGHLVTKVTAV----DADSGHNAWISYRLAEATDASLFSVNLHTGEVRT------KRSLSEQEDSSQRLLIEIQDNGEPVQSTTVTVDVLIED 667          

HSP 4 Score: 74.3294 bits (181), Expect = 5.245e-13
Identity = 79/266 (29.70%), Postives = 127/266 (47.74%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWF-----QPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID------AIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDREK    +LI+ A+D G+P  ++ +T + I + D NDN P   +   K  V+E+       +T I+A D D G NG +++Y          A    +   K+F+++  SG +T+   LD E I+SY   I   D+G P+L    ++ + V+D NDNPP+        PV    N T  +V+A      +    D DS  N  ++  + +G             ++I D    + +    Y I++VA D+G+P L T   IN+ I
Sbjct:  199 LDREKQLIHKLILTALDGGDP-VRSGSTLLKIVVEDNNDNEPHFELQIYKASVQESAGIGSNVVT-IKATDMDEGINGEIQYY---------FAAHTPDYVRKVFNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGYPKLEGHSSVHIRVIDENDNPPEIILTSLPNPVPE--NATVGTVVA------LINVMDLDSGENGKVSLKIPKGFPFKLKSSFENHYSLITDSSLDRELN-SEYNIEIVATDSGSPPLKTVKTINVTI 444          

HSP 5 Score: 72.4034 bits (176), Expect = 1.838e-12
Identity = 78/287 (27.18%), Postives = 125/287 (43.55%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-----NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-------GDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            + +F ++   G +     LD E  +     + A D+G P+ +  ++     I D NDNPP +I     NP    V EN  T+   +  I   D D GENG V   I      +G   K+  +    +S       L    SLDRE    Y + I+  D G P L +++ I +T+LD+NDN P + Q    S N+  K        +    A D D   NA +TY V +            YI++  G + +  S    +     + + A D+G+P+LS+   ++++I
Sbjct:  289 RKVFNVNPDSGEITVIGKLDHEGINSYTFDICAQDKGYPKLEGHSSVHIRVI-DENDNPPEIILTSLPNP----VPENA-TVGTVVALINVMDLDSGENGKVSLKI-----PKGFPFKLKSSFENHYS-------LITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTILDVNDNAPAFSQT---SYNVYIKENNVAGSSLFSITALDSDVNNNAILTYSVVDSKVNDIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPSLSSNATLHVFI 554          

HSP 6 Score: 66.2402 bits (160), Expect = 1.470e-10
Identity = 74/272 (27.21%), Postives = 120/272 (44.12%), Query Frame = 1
Query: 1696 NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV---LAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIREGH-----YLIKLVANDNGNPNLSTEIKINLYI 2478
            +L T + LDRE   +  + ++A D G P  +T  T     + DVNDN P        + +KEN       L  I A D D+  N  + + +  V+ K       D   +  F I+  +G +    S D E +    L +   D G P L+S   + + +LD NDN P    P A   +++ + +         +    A D DS  NA I+Y + E  D  L  ++   G++R ++S+ E        LI++   DNG P  ST + +++ I
Sbjct:  405 SLITDSSLDRELNSEYNIEIVATDSGSPPLKTVKTINVTIL-DVNDNAPAFSQTSYNVYIKENN-VAGSSLFSITALDSDVNNNAILTYSV--VDSKVN-----DIPASSYFYINSENGTIYSMSSFDYEKVKRLTLIVQAKDHGSPSLSSNATLHVFILDQNDNAPSVIYPSAVMGSVSHQRMPRSAKPGHLVTKVTAVDADSGHNAWISYRLAEATDASLFSVNLHTGEVRTKRSLSEQEDSSQRLLIEI--QDNGEPVQSTTVTVDVLI 665          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: pcdh2ab5 (protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GENE-041118-4])

HSP 1 Score: 227.639 bits (579), Expect = 1.057e-61
Identity = 155/458 (33.84%), Postives = 233/458 (50.87%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRC--QIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT------FSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + Y+V EE + G  VGN+  D N+  K      F++   G   KYF +   TG L + ++IDRE +C  +     +C   +E  I  P+  +   I + DVND+ P F+E    + I+E    G R++L  A+D DV  N V TY +   ND F++        S    L++  ALD E Q     TL A D G PP  G   + ++VLDINDN PVFS+  YK  + EN   G  V  + A D+D G+  ++RY   +     +L  F I + TG I ++  +N +     F +  +ASD G  P   +  V V + D+N+  P + + SL P+     VKE+    +  A++ V+DGD G N +VDC +      FKL  +     ++ Y+L  N   DRE  S + V ++ +D+GTP L++   ITV + DVN+ +PR  +    V V ENS IG
Sbjct:   22 LSYSVSEETNPGASVGNIAKDLNLDIKELELRMFQIVT-GSKRKYFEVNLKTGFLYVNEKIDREDICSKTL----KCTVSVEACINNPLKLYRIEINVMDVNDNAPTFSEKSLTLDIAENALPGLRLTLPHATDLDVGKNTVSTYKLSP-NDYFSLATTKGAEHSVSADLVLQKALDREKQPVTHLTLTAVDGGSPPKSGTSLIVVNVLDINDNAPVFSRPLYKTTVSENVHAGTTVVVLNATDIDEGMNREIRYSIIKRDQDEILEIFDIDSKTGVITVKGKINFEE-HNAFEIRAQASDKGQPPLAAHCKVLVEVLDLNDNAPELTVTSLLPS-----VKEDAKPGTALALVSVTDGDGGTNGDVDC-IVSNKTPFKLETNY----KNYYSLIVNGPLDREKHSQYNVTLIATDKGTPPLSSSVVITVHVSDVNDNAPRLPETVIKVYVKENSQIG 462          

HSP 2 Score: 107.457 bits (267), Expect = 2.751e-23
Identity = 119/477 (24.95%), Postives = 212/477 (44.44%), Query Frame = 2
Query:  161 RSSQAFLLVSLMQIQIQISVGNEFNRNIH-YAVKEEIDVGNFVGNLN---IDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQ--VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPN-NVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHLTVGAEN--FKL-SNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEI-TVKIQDVNEFSPRFK 1543
            +S  + ++V+++ I     V   F+R ++   V E +  G  V  LN   ID  + +    S  K  D  ++L+ F ++  TG + +  +I+ E+         A D+ Q  L     +     ++ + D+ND+ P+   +     + E  + G  ++L + +D D   N +V     +         + N   LIV   LD E    Y  TL+A D G PPL  +  + + V D+NDN P   +   KV +KEN+ +G V+  V+A D D G   ++ Y   +   P + S   I++ +G+I   +  N + +   F   ++A+D G  P     +V V + D N+  P I    L P  +  +V       S  A  +V+     D D G NA +   ++    N  F++ S+S  V+ +        R+ D ++ +H  + +L SD G P L+    I  V +++  +   +FK
Sbjct:  213 KSGTSLIVVNVLDINDNAPV---FSRPLYKTTVSENVHAGTTVVVLNATDIDEGMNREIRYSIIK-RDQDEILEIFDIDSKTGVITVKGKINFEEHNAFEIRAQASDKGQPPLAAHCKV-----LVEVLDLNDNAPELTVTSLLPSVKEDAKPGTALALVSVTDGDGGTNGDVDCIVSNKTPFKLETNYKNYYSLIVNGPLDREKHSQYNVTLIATDKGTPPLSSSVVITVHVSDVNDNAPRLPETVIKVYVKENSQIGSVIYTVSAFDPDVGDNAKITYSLMEYSTP-ISSLVNINSDSGDIHSLQSFNYEEM-NAFHFKVQATDSGVPPLSSNVSVNVFILDENDNSPGI----LAPYSEQGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYQISEPKGNNLFRIGSSSGEVRTK-------RRMSDNDLKTHPLI-ILVSDNGEPSLSATVSIDVVVVENTGDIQTKFK 666          

HSP 3 Score: 90.1225 bits (222), Expect = 7.769e-18
Identity = 78/270 (28.89%), Postives = 143/270 (52.96%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPP----TVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEI---SGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYI 2478
            LDREK  +  + ++A D+G P   +++  + + ++DVNDN P    TVI   K+ VKEN +   +  T + A DPD+G+N  + + +              E  T I S+  I   SG++   +S + E ++++   +   D G P L+S  ++ + +LD NDN P    P +   ++ T+++  + +    +A+  A D DS  NA ++Y ++E  G++L  I +  G++R ++ + +     H LI LV+ DNG P+LS  + I++ +
Sbjct:  404 LDREKHSQYNVTLIATDKGTP-PLSSSVVITVHVSDVNDNAPRLPETVI---KVYVKENSQIGSVIYT-VSAFDPDVGDNAKITYSLM-------------EYSTPISSLVNINSDSGDIHSLQSFNYEEMNAFHFKVQATDSGVPPLSSNVSVNVFILDENDNSPGILAPYSEQGSVNTENIPYSAEAGYFVAKIRAVDADSGYNALLSYQISEPKGNNLFRIGSSSGEVRTKRRMSDNDLKTHPLIILVS-DNGEPSLSATVSIDVVV 654          

HSP 4 Score: 72.4034 bits (176), Expect = 2.008e-12
Identity = 78/277 (28.16%), Postives = 122/277 (44.04%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG----DDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +F ID   G +     ++ E+ +  E+   A D+G+P    A   V + + D+NDN P +     L   + +      L  +   D D G NG V      V +K     K++ N    +S       L +   LDRE    Y + ++  D+G P L+S   IT+ V D+NDN P+  + V     +  K        I    A DPD   NA ITY + E       LV I++  GD+ + QS        +  K+ A D+G P LS+ + +N++I
Sbjct:  283 IFDIDSKTGVITVKGKINFEEHNAFEIRAQASDKGQP-PLAAHCKVLVEVLDLNDNAPELTVTSLLPSVKEDAKPGTALALVSVTDGDGGTNGDVDCI---VSNKTPF--KLETNYKNYYS-------LIVNGPLDREKHSQYNVTLIATDKGTPPLSSSVVITVHVSDVNDNAPRLPETV---IKVYVKENSQIGSVIYTVSAFDPDVGDNAKITYSLMEYSTPISSLVNINSDSGDIHSLQSFNYEEMNAFHFKVQATDSGVPPLSSNVSVNVFI 543          

HSP 5 Score: 67.3958 bits (163), Expect = 7.009e-11
Identity = 68/224 (30.36%), Postives = 104/224 (46.43%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-----DLVYIDAIIGDLRARQSIR-EGH--YLIKLVANDNGNPNLSTEIKI 2466
            DVNDN PT  +   L +   E  LP + LT   A D D+G+N TV  Y     D   LA       +       +S +L + K+LDRE      L +   D G P  +    I + VLDINDN P + +P+  +T   +++V A    +++  A+D D   N  I Y + + D     ++  ID+  G +  +  I  E H  + I+  A+D G P L+   K+
Sbjct:  116 DVNDNAPT-FSEKSLTLDIAENALPGLRLTLPHATDLDVGKN-TVSTYKLSPNDYFSLATTKGAEHS-------VSADLVLQKALDREKQPVTHLTLTAVDGGSPPKSGTSLIVVNVLDINDNAPVFSRPLYKTT--VSENVHA-GTTVVVLNATDIDEGMNREIRYSIIKRDQDEILEIFDIDSKTGVITVKGKINFEEHNAFEIRAQASDKGQPPLAAHCKV 327          

HSP 6 Score: 65.0846 bits (157), Expect = 3.302e-10
Identity = 67/263 (25.48%), Postives = 117/263 (44.49%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT-------EGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDREK     L + A+D G P  ++ T+ + + + D+NDN P    P  K  V EN       +  + A D D G N  +R+ I + +    L         +IF ID  +G +T+   ++ E  +++ +     D+G+P L +   + + VLD+NDN P+       S   + K        + +   +D D   N ++   V+       E +   Y   I+     R+  +   Y + L+A D G P LS+ + I +++S
Sbjct:  191 LDREKQPVTHLTLTAVDGGSP-PKSGTSLIVVNVLDINDNAPVFSRPLYKTTVSENVHAGTTVVV-LNATDIDEGMNREIRYSIIKRDQDEIL---------EIFDIDSKTGVITVKGKINFEEHNAFEIRAQASDKGQPPLAAHCKVLVEVLDLNDNAPEL---TVTSLLPSVKEDAKPGTALALVSVTDGDGGTNGDVDCIVSNKTPFKLETNYKNYYSLIVNGPLDRE--KHSQYNVTLIATDKGTPPLSSSVVITVHVS 437          
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Match: ENSAMXT00000054364.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:10715673:10726912:1 gene:ENSAMXG00000037804.1 transcript:ENSAMXT00000054364.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.557 bits (571), Expect = 1.834e-60
Identity = 153/458 (33.41%), Postives = 231/458 (50.44%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y+V EE+  G  VGN+  D NI  +      F++   G   KYF +   TG++ + +RIDRE++C  S      C + L      P+  +   + + DVND+ P F    Y + I+E    G R  L  ASD DV  N+V TY +   N+ F++   +         L++  ALD E Q   +  L A D G P   G   L+I+V+D+NDN P FS++ YKV + EN + G  V  + A D+D+GL G++ Y             F I++ TGEI ++  L+ ++ A  F L+ +A D GS P+  +  V + + DVN+  PVI++ SL        V+E+ T  +   +I ++D DIG N EV   +  G   F L  S     ++ Y+L  N   DRE    + V +L +D+GTP L++   + V I DVN+ +PRF        V ENS  G
Sbjct:   38 IVYSVSEEVKAGTVVGNVAKDLNINVQDLEARMFRIIVSGSNKKYFEVNMKTGEMFVNERIDREELCSES----QACSLHLEAIAQNPLRLFSVTVNVLDVNDNAPSFPYKSYDLNITELAFAGERYPLPKASDADVGVNSVKTYKLSA-NEYFSLNVQSGGEQNISPQLVLQKALDREKQATVQLILTALDGGRPHRSGTLDLSINVIDVNDNTPAFSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVYSLISHGKEKWADIFAINSITGEITVKGPLDREDTAA-FELHAQAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTST-----VREDATTGTAVGLITIADNDIGKNGEVSAKVK-GTGPFALQASY----KNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSG 479          

HSP 2 Score: 114.775 bits (286), Expect = 1.561e-25
Identity = 109/408 (26.72%), Postives = 179/408 (43.87%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND-TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKI-QDVNEFSPRFKK 1546
            K    F++   TG++ +   +DRE        A    Q +     P      V I + DVND  P  + +     + E    G  + L T +D D+  N   +  + G        ++ N   L+V   LD E    Y  T++A D G PPL  +  LA+ + D+NDN P FS       +KEN+  G ++A VTA D D     Q+ Y     +  D S +S   I+  +G+I  ++  N + + + F   ++A+D G+ P     TV V + D N+ RPVI    L P  +  ++       S  A  +V      D D G NA +  H+T    N  F++ +S      +I T +  R+ D ++ +H  V  +C D G P L+    + V + + ++   P  ++
Sbjct:  296 KWADIFAINSITGEITVKGPLDREDTAAFELHA----QAQDKGSSPRASHCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEV-KSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVI----LPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGNNLFRIGSSSG----EIRTKR--RMSDNDLKTHPLVITVC-DHGEPSLSATVSVDVVVAESMDSVRPSLRE 687          

HSP 3 Score: 83.5741 bits (205), Expect = 7.780e-16
Identity = 71/266 (26.69%), Postives = 138/266 (51.88%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRF-YIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR---IIIAQASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDRE   +  + +LA D+G P   +++  + + I DVNDN P   +   +  VKEN  +  +  T + A+DPD+ EN  + +  I R        + +D +   +  I+ +SG++   +S + E + S+   +   D G P L+S   + + ++D NDN P    P + + ++ T+++    +    +   +A D DS  NA ++YH+TE  G++L  I +  G++R ++ + +     H L+  V  D+G P+LS  + +++ ++
Sbjct:  421 LDREDMPQYSVTILATDKGTP-PLSSSIVLAVDIADVNDNAPRFSDIVTVFYVKENSPSGNIIAT-VTAQDPDVNENAQIVYSLINR--------KNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFIVDENDNRPVILPPYSEAGSLNTENIPYSAEAGYFVGKVRAIDADSGYNALLSYHITEPKGNNLFRIGSSSGEIRTKRRMSDNDLKTHPLVITVC-DHGEPSLSATVSVDVVVA 675          

HSP 4 Score: 78.5666 bits (192), Expect = 2.896e-14
Identity = 78/290 (26.90%), Postives = 123/290 (42.41%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG-EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN---LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-------TEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            + K   +F I+   G +     LDRE     EL   A D+G  PR+      V I + DVND+PP +           + T    +  I   D D+G+NG V   ++                T  F++     N   L +   LDRE +  Y + I+  D+G P L+S   + + + D+NDN P++   V   T    K        I    A DPD   NA I Y +       +    +V I+ + GD+ ++QS        +  K+ A D+G P LS+ + +N++I
Sbjct:  294 KEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRAS--HCKVLIEVLDVNDSPPVISVTSLTSTVREDATTGTAVGLITIADNDIGKNGEVSAKVK---------------GTGPFALQASYKNYYSLVVNGPLDREDMPQYSVTILATDKGTPPLSSSIVLAVDIADVNDNAPRFSDIV---TVFYVKENSPSGNIIATVTAQDPDVNENAQIVYSLINRKNMDSSWMSMVDINPVSGDIYSKQSFNYEEVKSFQFKVQATDSGAPPLSSNVTVNVFI 563          

HSP 5 Score: 70.4774 bits (171), Expect = 8.024e-12
Identity = 73/267 (27.34%), Postives = 122/267 (45.69%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ----RIIIAQASDPDSRPNANITYHVTEGDDLV-------YIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDREK   ++LI+ A+D G P  ++ T  + I + DVNDN P   +    +V   E TLP   + ++ A D D G NG + +          L     E    IF+I+ I+G +T+   LDRE   ++ L+    D+G     S   + + VLD+ND+P     PV   T++T  S + +D      + +   +D D   N  ++  V              Y   ++     R+ + +  Y + ++A D G P LS+ I + + I+
Sbjct:  208 LDREKQATVQLILTALDGGRPH-RSGTLDLSINVIDVNDNTPA-FSKEMYKVSVLENTLPGTPVIKLNATDLDAGLNGEIVY---------SLISHGKEKWADIFAINSITGEITVKGPLDREDTAAFELHAQAQDKGSSPRASHCKVLIEVLDVNDSP-----PVISVTSLT--STVREDATTGTAVGLITIADNDIGKNGEVSAKVKGTGPFALQASYKNYYSLVVNGPLDREDMPQ--YSVTILATDKGTPPLSSSIVLAVDIA 454          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 161.77 bits (408), Expect = 1.976e-59
Identity = 143/478 (29.92%), Postives = 220/478 (46.03%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLY---DDGKLLKYFSLEESTGKLIIAQR-IDREQVCPTSFTALDRCQIELTIFV------PIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY------------FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLS-----YFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL-GPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + Y V EE+  G F+GN ++D  +     + T+K+     +        +   TG+L  A R +DRE +C       D C +++ + V      P    I V I ++D+ND+ P FA     + + E    G R  ++ A+DPD E N V  Y            F     +T N     + YL+V  +LD E +  Y+  L A D G PP  G+  L I+V D NDN PVF Q E  V I EN+ VG  V  + A D D+G   +V YR G     +         F +   +G + +  +LN +  +  + + I A+D G  P    ATV V + DVN+  P I I  +  P      + E   +    A+I VSD DIG N  V C++      F+L   + +   + Y L+     D E  + + V++  +D G   L+    +T+K+ D N+ +P F +  Y V+V EN+ IG
Sbjct:   39 VSYRVAEELREGAFIGNPSVDLRLADYNLELTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPG-DECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETAN--GEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLN-REESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQL---KKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIG 509          

HSP 2 Score: 87.0409 bits (214), Expect = 1.976e-59
Identity = 80/266 (30.08%), Postives = 122/266 (45.86%), Query Frame = 1
Query: 1660 SKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE----ETLPMFLT--QIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIII---AQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIREGHY-LIKLV 2421
            +  +F +D   G +     LDREK       +LA DQG P  +   T +   + DVNDN P      +  + E +    E +P   T   +   D D GENG VR  I   +++            ++FSID  SG +      DRE    Y+L +   D G+P  +S   + + V+DINDN P    P    +N T K V+ +     I     A D D+  NA + YH+  G+  +L +ID +IG++   + + E H+ L +LV
Sbjct:  536 APTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVL-DVNDNRP------RFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNR------------QLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMP---PSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLV 779          

HSP 3 Score: 135.576 bits (340), Expect = 1.332e-32
Identity = 101/323 (31.27%), Postives = 160/323 (49.54%), Query Frame = 2
Query:  575 IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTF---NITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            I ISEA  V   ++L T SDPD+  N   T +++     F    +T+ N   L     LDYET+  Y   + A D G   L    ++ I +LD NDN PVF++  YKV + EN ++G+ +  V+A D D     ++ Y  G    P   + F++   TG I L   L+ +  A ++S  I A D G     G ATV V++ DVN+ RP  ++     A+ DF V EN    S   ++ V+D D G N  V   + +G +N +L +     G     ++ N  FDRE   ++ + +  +D G P  ++  ++ + + D+N+ SP
Sbjct:  393 IYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLG----PDAPTMFHMDPETGIISLTEQLDREKKA-NYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSL-----AEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSI-LGTDNRQLFSIDPESG----MIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSP 700          

HSP 4 Score: 104.375 bits (259), Expect = 7.468e-23
Identity = 78/280 (27.86%), Postives = 126/280 (45.00%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQD------FSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVG 1336
            I + D ND+ P F E  Y++ + E   +G  +   +A+D D++ N    YF+     T          + +   LD E + NY  T++A D G+P L GN T+ ++VLD+NDN P FS  E+   + EN      V  VT  D D G  G+VR       +      F I   +G I+        N+  D      + L ++A+DGG   +     V +H+ D+N+  P++    + P+   +     +TL       +   D D  +NAE+  H+  G
Sbjct:  481 IKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDN---RQLFSIDPESGMIR-------SNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIV---LMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGG 747          

HSP 5 Score: 63.1586 bits (152), Expect = 4.922e-20
Identity = 98/377 (25.99%), Postives = 155/377 (41.11%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLY-------LIVINAL-DYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYK------VIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYF-YISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN----STIG 1588
            I + D ND+ P F ++   ++I E   VG  +    ASD D   N    Y          +      L+       L+ +N L + E    Y+  ++A D G  P+    T+ ++V D+NDN P    ++        + I E + V   VA +T  D D G  G V       + P  L    Y + Y  E +       KN   ++ + I+A+D G+       +V + L D N+  PV       P  K  +V EN  +  H   +  +D D+  NAE+   L   A      + +T     I +L      DRE  +++   +L  D+G P L     + V + DVN+  PRF    +   V+EN    ST+G
Sbjct:  255 INVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKN---EYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFT----EPTYK-VSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPET----GIISL--TEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVG 617          

HSP 6 Score: 53.1434 bits (126), Expect = 4.922e-20
Identity = 51/161 (31.68%), Postives = 76/161 (47.20%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-----KLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG 2127
            + LF ID   G +R+    DRE+     L V A D GEP  +++T  V I + D+NDN P V+ PP     K  V     TLP   +T++ A D D   N  +R++I            +  N   +F ID + GN+T+ + L   +   + L + V D G
Sbjct:  642 RQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEP-VRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVP---RTLPGTIVTEVSAVDNDAEINAELRYHI------------VGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 7 Score: 64.3142 bits (155), Expect = 1.294e-10
Identity = 79/274 (28.83%), Postives = 132/274 (48.18%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT-----VINPPKLQVKENEET---LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT-EGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNL 2448
            K LF +DQ  G +    +L+RE+     +I+LA D+G P    AT TV +T+TDVNDN PT     ++ P    +  +E +   LP+ L  I   DPD+G NG V  YI   E    L +    N+            L   ++LD E  + Y++ I   D G   L+   ++T+ +LD NDN P + +P  +  ++   +V+   + +I   A+D D   NA + Y +  +   + ++D   G +   + +   ++ +Y   ++A D G P L
Sbjct:  320 KRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKG-PEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVAL--ITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYL----------LETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEP-TYKVSVPENNVIG--KHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVL 577          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 204.527 bits (519), Expect = 1.581e-54
Identity = 145/463 (31.32%), Postives = 226/463 (48.81%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNID-SNIFKIQPKSTFKLY--DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR----CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKD-FNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + YA+ EE   G  VG L+ D        P   F+L   DD  L+    +EE+ G +   + IDREQ C  + + + R    C +   +F  +   + ++   D+NDH P FA S   ++ISE+V +G R+ L  A D DV  N +  Y +   N+ F +        +    L+V + LD E +  Y   L A D G PP  G   + I+VLD NDN PVF+Q    V ++E+A  G V+  + A D+D G  G+V Y F    D  V   F +   TG++ L+  L+   +  ++ ++I+A D G      +  V VH++D+N+  P I ++ +  ++ D   V E     S   ++ VSD D   N  V CHL  G  +FKL     +  RD Y +  N   DRE  + + + +  SD GTP      + TV++ D N+  PRF +  Y  ++ EN++ G
Sbjct:   31 VKYALYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVH---VEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELL---DINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLD-ENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLD-HELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR-GHPHFKL-----LPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPG 479          

HSP 2 Score: 103.219 bits (256), Expect = 1.542e-22
Identity = 98/409 (23.96%), Postives = 171/409 (41.81%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDRE------------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQ------IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKI 1510
            D ++ + F L+  TGKL +  ++D E             + P+S  A   C++             ++ ++D+ND+ P+    +        + +SE       + L T SD D   N +    + G +  F +      Y++V N+ LD E   +Y   L A D G PP    +   + +LD NDN P F +  Y+  + EN   G  V  VTA D D+   G + Y     +V   SV +Y  I+  +G I   R L+ + +    +  ++A D G  P V  ATV V + D N+  PV+    L        +  +  L     ++   D D   N E+   +  G E   F+++      G +++T   +        +   + ++  DRG+P L+    I +++
Sbjct:  289 DAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPA--HCKV-------------LVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRG-HPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTS-LTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINR----LGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRV 676          

HSP 3 Score: 57.7658 bits (138), Expect = 1.248e-8
Identity = 65/282 (23.05%), Postives = 114/282 (40.43%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREK--GDKIELIV-LAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEE-TLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----LVYIDAIIGDLRARQSIRE---GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            L  +++  G +    ++DRE+  G     ++   +    PR         + + D+ND+ P      ++ V+ +E   L   +    ARD D+G N    +++   E + GLA +   +  K          L +   LDRE    Y L +   D G P  +    + +TVLD NDN P + Q    S N+T +        ++   A+D D  PN  + Y  +   D     L  +D   G L  +  +       Y I + A D G  ++    K+ +++
Sbjct:   74 LVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARS-EMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENE-RFGLALRARTDGAKY-------AELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQT---SCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHV 343          

HSP 4 Score: 52.7582 bits (125), Expect = 4.909e-7
Identity = 58/207 (28.02%), Postives = 89/207 (43.00%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW---FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            LDRE+  +  L + A D G+P  ++ TT V IT+ D NDN P V       V   E+  P   L  + A D D G NG V +           +  +D    ++F +D  +G L++   LD E    Y + I   D G   + +   + + V DINDN P+    F   +    +      A +  + +   SD DS  N  +  H+
Sbjct:  203 LDREQEGEYTLQLTAWDGGDP-PRSGTTLVRITVLDSNDNSP-VFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVY---------SFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHL 398          

HSP 5 Score: 52.373 bits (124), Expect = 5.390e-7
Identity = 59/237 (24.89%), Postives = 96/237 (40.51%), Query Frame = 1
Query: 1645 PTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE------ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD 2337
            P  ++ + LF +D   G L     LD E   + E+ + A D G P S  A   V + + D+NDN P +     +Q + +            F+  +   D D  ENG V  +++     + L  + D               +    SLDRE +  Y L +   D G P   +    T+ +LD NDN P++ +    ++ +   S  A    +    A D D+  N  I Y+V E +
Sbjct:  287 PVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMG-PSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYV-------------VVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAY---VTTVTAWDADAEHNGMIAYNVVESE 506          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 3.268e-52
Identity = 104/370 (28.11%), Postives = 165/370 (44.59%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAE-SYYQIQISEAVQVGYRISLRTASDPDVEPNNV--CTYFMHGFNDTFN------ITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGD-IGVNAEVDCHLTVGAE--NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + DVND+ P F E    ++   E   VG ++ L TA D DV PN V    Y +   N+         +T    L+L     LD E   +Y   + A D G P   G   + ++V D NDN P F +  Y+  + E++ VG  + +         L  + R       DP           TG +  ++ L+ +   Q ++L++ A+DGG+ P  G AT  + L DVN+  P I    L PA +  +V E+    +  A++ V+D D    N E+   +  G E  +F L ++  V G  +  L+     DRE    + + +L SD G P   +    + V + DVN+ +PRF    Y   +SE +  G
Sbjct:   11 VVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRD---------LLHRGRGPLAVPFDPK----------TGMVSTRQPLDFEARRQ-YTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVL-HAPGVPG--LRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAG 357          

HSP 2 Score: 104.375 bits (259), Expect = 3.268e-52
Identity = 85/261 (32.57%), Postives = 133/261 (50.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDLRARQSI-REGH--YLIKLVANDNGN 2439
            F +D+  G + T   +DRE    + L + A DQG  + +TA T++ +T+ DVND PP +    K      E +LP +F+  + A D DLGENGTVR+              +     ++F +D ++G +T  KSLDRE ++ Y L +   D+G P L S   +T+ V D+NDN P  F PV +  +I           +    A+DPD   N  + Y +T GD   + ++A+ G +  R S+ RE    Y +++ A D G+
Sbjct:  389 FSVDESTGLVTTDGKVDREVASSVVLNISAQDQG-AQPKTAYTSLTVTLLDVNDEPP-LFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY---------NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPV-FYPVQYFASILENE--PGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGH 635          

HSP 3 Score: 135.961 bits (341), Expect = 1.448e-45
Identity = 133/457 (29.10%), Postives = 212/457 (46.39%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNI-----AQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + V E +  G  VG+  + ++   +    T+ L   G     FS+E S G++  A  IDRE+    +F  L R  +  +  V  +  ++V+ + DVN+H P F  + Y++ I+E   V  R     A+D D   N    Y +   N  + F I     LY  V   LD ET+  Y  T+ A D G+ PL  + T+ ++VLD+NDN P+F+   Y     E   VG +V  V A D D+G  G V Y F   + P V   F + + TG I   R+ + + +     A  FS ++ A+DGG   P    ATV V ++DVN+  P         AK  +  +V E+ + ++    +  SD D GVN  +   +  G E  K +   +     I  L      DRE  + + + +  +D GT  L     + V++ D N+  PRF +   +V+  E++ +G
Sbjct:  665 FVVFENVAPGTLVGS--VSASTLDLNANVTY-LIVSGDQRGSFSIEWSGGRIFTANAIDREE---QAFYQL-RV-VANSGGVAGEASVSVL-VHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLY--VRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF---EKPQV--NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQF-------AKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTG--QITLLG---SLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVG 1093          

HSP 4 Score: 66.2402 bits (160), Expect = 1.448e-45
Identity = 67/229 (29.26%), Postives = 103/229 (44.98%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDS-YILYIMVCDQGKP---QLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRII-IAQASDPDSRPNANITYHVTEGD 2337
            F ID+  G++  A  LD E      L V A D G P  +++ T + + + D NDNPP  +  P        E +P+   +  + ARDPD   NG + + I R                  F+ID  SG +     +DRE     + + +   D+  P   + ++++ +T+ V D NDN P++  P A    I    + A    ++   QASDPD   NA + Y VT GD
Sbjct: 1125 FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRP-PRSSATILVVHVRDFNDNPPAFL--PGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAH-----------FTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTA----ILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTGGD 1335          

HSP 5 Score: 125.561 bits (314), Expect = 4.180e-43
Identity = 123/414 (29.71%), Postives = 192/414 (46.38%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQ--VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND--TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREV------DSHFQVRMLCSDRGTPK-LTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENST 1582
            F +   TG +     +DRE+  V     TALD   +           I  IT+ D  D  P FA   Y   + E V  G  +   +AS  D+  N   TY +   +   +F+I +S    +   NA+D E Q  Y+  +VA   G+    G  ++++ V D+N++ PVF +  Y+V I E+  V     +V A D DSG  G+V+Y  G+         F      G++ ++  L+ +   +++SL + A D G  P     TV V + DVN+ +P+ N +S       F+  E Q + S    +  +D D G N  V         NF+L +S+T  GR I +L   RVFDRE        + F   ++ +D G PK L     + V +QDVN+  P+F K  Y  +VSE+++
Sbjct:  601 FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRAR-----SPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNAN--VTYLIVSGDQRGSFSIEWSGG-RIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIF----PDGQLYVRYELD-RETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYV-----FHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFEL-DSET--GR-IASL---RVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESAS 986          

HSP 6 Score: 68.5514 bits (166), Expect = 4.180e-43
Identity = 66/224 (29.46%), Postives = 96/224 (42.86%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-----FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            F +D   G +     LDRE+     L+V A D G      A+ TV + + D NDNPP       L V   E T +   L  + A D D G +G VR+ I            +  N    F+ID  +G++ + + LD E    Y L +   D G+P  +S   + + V D NDNPP +     F  +  +  I T        R+I   A DPD+  N  + Y +
Sbjct: 1020 FTVDASTGQITLLGSLDREETASYTLVVSATDSGT-SPLAASCTVAVQVLDENDNPPR-FTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAI------------VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGT--------RVITVTARDPDADVNGELHYSI 1221          

HSP 7 Score: 111.309 bits (277), Expect = 1.381e-38
Identity = 100/367 (27.25%), Postives = 169/367 (46.05%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAM-----VGEVVANVTAVDMDSGLFGQVRYRFGQVQDPS-VLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRG---TPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I+++DVND+ P FA    ++++ E    G  I   +A+D D   N + TY  + G    F +  ++ + L     LD E + +Y  T+ A D        +  L+++V D NDN P FS+  Y   + E+A         V+  V A D DSG FG+V Y     +D       F +   TG + + R L+ ++ A  + L   A+DGG +     A ++V++ D N+  P +  +SL        V E+    +    I  +D D GVNAE++  ++ G    + +      G D   L   R  DRE  S + + +  SDR      +L++   +++ + DVN+ +P F      +   E+S +G
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGV-LRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRAC-YVLRARATDGGGL--AATARLYVNVLDANDNAPSVQNDSLA-----AEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFA-----VGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVG 1851          

HSP 8 Score: 67.3958 bits (163), Expect = 1.381e-38
Identity = 63/218 (28.90%), Postives = 98/218 (44.95%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQ--ASDPDSRPNANITY 2319
            F ++   G +R    LDRE      L VLA+D+G P   T+T T+ +T+ D NDN P             +E     + ++ A DPD G NG +R+ I               + T  F +D + G L + + LDRE   SY L +   D G P  +   ++ +T+ D+ND  P  FQ   ++ +    +   Q   ++I Q  A D D   +  +TY
Sbjct: 1892 FALNTVTGEVRLVRELDREARQSYALTVLAVDKGRP-PLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIA------------SGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPA-FQLSPYTVHARENT---QGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 9 Score: 116.316 bits (290), Expect = 3.848e-38
Identity = 99/360 (27.50%), Postives = 164/360 (45.56%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            V+ + DVNDH P+FA S Y   +SE    G  +   TA D D   N    Y +   ND    +      L+  +  +D E   +    + A D G  P     +L +++LD+ND  P+F+Q +Y     EN++ G  V +V+A D D G  G VRY F           F + + TG++   + L+ + + +++ L ++A D GS P    A V V + D+N+  PV       P +   ++ EN+   +    +  +D D G N  V   LT G A  F+++    V G     +      DRE  + +Q+++   D G  +  +   +T+ + D  +  P F + +Y+  V EN   G
Sbjct:  328 VVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREEL-EEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY-----PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVN---AVTG----AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPG 674          

HSP 10 Score: 61.2326 bits (147), Expect = 3.848e-38
Identity = 72/269 (26.77%), Postives = 122/269 (45.35%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIA--QASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRA-----RQS-IREG---HYLIKLVANDNGNP 2442
            F I+   G + TAN +DRE+    +L V+A   G         +V + + DVN++ P       ++ + E+E     F + ++A D D G+NG V++ I          E     +  IF      G L +   LDRE  + Y L +   D G   L+S   + +TVLD+NDN     +P+ +S++        Q+   ++   QA+D D+  N  +TY   +      +D+  G + +     R++ IR+G    +   +VA D G P
Sbjct:  704 FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG----VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFS-VRATDKDSGKNGEVKYEI---------GEGNGGEKFGIFP----DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDN-----KPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRP 949          

HSP 11 Score: 132.88 bits (333), Expect = 1.574e-31
Identity = 122/451 (27.05%), Postives = 202/451 (44.79%), Query Frame = 2
Query:  260 EEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE----QVCPTSFT----ALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEV----------DCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSH-FQVRMLCSDRGTP---KLTTEEEITVKIQDVNEFSPRF 1540
            EE +VG+ VG +             T+      K    F L+  TG++   +  DRE    Q    SF+    A D  + +     P+     V + +QDVND+ P+FA+S YQ  +SE+     ++   TASD D   N    Y ++  N+    T  ++   + ++ +LD E   +Y   + A D G  PL  + T+A+ VLD NDN P F++    V   E+  VGE++  +TA D D+G  G VRY    +   +  + F I   TG + L R L+ +   + + LN+ A DGG  P+     + VH++D N+  P     +  P     ++ EN  + +    +   D D  VN E+            H T+  E+ ++  +  +              DREV    F+V +  +D+  P   + +  + +TV + D N+ +PRF
Sbjct:  873 EEQEVGSLVGAVQATDADAGSNGGVTYSFE---KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPK-----PLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRY---AIVAGNTHATFAIDRSTGSVFLARRLDFET-QRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPP-----AFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEI--------------DREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRF 1292          

HSP 12 Score: 92.4337 bits (228), Expect = 2.338e-30
Identity = 119/519 (22.93%), Postives = 206/519 (39.69%), Query Frame = 2
Query:  128 IIFGDLLVNFHRSSQAFLLVSLMQI--QIQISVGNEFNRNIHYAVKE-EIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGK--LLKY---------FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYR-----ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-----VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDF-SLNIEASDGGSVPKVGYAT---VFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPN----RVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I+F  LL +   +     +   M    Q++ISV +  +    +AV E E++V    G   +   IF +         D G+  L+ Y         F ++ ++G L  ++R+DRE+      T         T     D  ++V  ++D ND+ P+F+   Y   ++E      +     I    A D D  P    TY +    D+     +  L+ +     V   LD E++  Y     A D G   L     L ++VLD NDN P          + E+A  G  +  ++A D D G+  ++ +      DP     F +    G++ + R L+ +   Q F +L +  SD    P    ++   V + L DVN+  P         + +     E+  + +  A +   D D G N+ V+  L    E              + T+       R  DRE    + + +L  D+G P LT+   + V + D N+ +PRF ++ Y   ++E+   G
Sbjct: 1474 IVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEV---IFTLSATDA----DQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHAT-----DARLSV-AVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISS-GDPE--GRFAVGN-DGQLSVARALDRER--QSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPG 1965          

HSP 13 Score: 58.9214 bits (141), Expect = 2.338e-30
Identity = 48/151 (31.79%), Postives = 75/151 (49.67%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCD 2121
            F +D  +G L  A  LDRE+    EL V A D G P +++ T +V +T++DVND  P   ++P  +  +EN +  P+ + Q+ ARD DLG +G V +      D    +   D             G++ + +SLDRE    ++L I   D
Sbjct: 1997 FRLDPVLGTLAVARPLDRERTASYELAVRARDGGGP-ARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPD-------------GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 14 Score: 103.605 bits (257), Expect = 4.181e-29
Identity = 106/425 (24.94%), Postives = 180/425 (42.35%), Query Frame = 2
Query:  338 FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQI------NYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F ++ DG+L   + L+  T          RE+   T  +A+D      T   P+   + V +T+ DVND++P F  S Y     E  +VG  +    A+D D   N   TY        F +  S    +  +   D E  I      ++  ++VA D G P PL    T+ + V D+NDN P F++  Y+  + E+A     +  VTA D+D G+ G +RY   +  +      F +   TG+I L   L+ +  A  ++L + A+D G+ P     TV V + D N+  P    + L       +  E+  +      +  SD D G + +V   +  G  +   +       R   ++   R  D E    +++ +   D G P  ++   + V ++D N+  P F   +   ++ EN  IG
Sbjct:  806 FGIFPDGQLYVRYELDRET----------REEYSLT-VSAMD------TGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELD-SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNE---GGKFTVDASTGQITLLGSLDREETAS-YTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLS-----VDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAID-----RSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIG 1198          

HSP 15 Score: 43.5134 bits (101), Expect = 4.181e-29
Identity = 41/140 (29.29%), Postives = 60/140 (42.86%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDRE-KGDKIELIVLAIDQGEP--RSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDRE 2082
            F ID   G + TA  +DRE  G   E+ V A D+  P    ++A   V + +TD NDN P  + P  + V          +  +QA DPD  EN  VR+ +               +   +F +D  +G +     LDRE
Sbjct: 1231 FTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVT------------GGDAAILFRLDRRTGIIETSTELDRE 1358          

HSP 16 Score: 114.39 bits (285), Expect = 7.453e-26
Identity = 109/415 (26.27%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDRE-QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACD-CGMPPLCGNQTLAISVL--DINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFG------QVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKK-DFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            F L   TG L + + +DRE + C   +    R      +      ++NV+   D ND+ P         ++ E    G  +   +A+D D   N    + +   +        N   L V  ALD E Q  Y   +   D    PP   +  + +S++  D+NDN P F+      +  E++ VG VVA V AVD DSG    V Y              +    F ++T TGE++L R L+ +   Q ++L + A D G  P    AT+ V + D N+  P        P ++ +  + E++   +    +   D D G N E+   +  G    +F+L     V G    TL   R  DRE  + +++ +   D G P  +    + V + DVN+ SP F+   YTV+  EN+
Sbjct: 1674 FGLHPVTGALNVTRPLDRESRAC---YVLRARATDGGGLAATARLYVNVL---DANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPR-SALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELD-REARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF------PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRL---DPVLG----TLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENT 2067          

HSP 17 Score: 109.768 bits (273), Expect = 2.252e-24
Identity = 110/419 (26.25%), Postives = 183/419 (43.68%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPT--SFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYL-------IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            G  L +FS++ESTG +    ++DRE       + +A D+     T +  +      +T+ DVND  P F ++ Y     E    G  +   +A+D D+  N    Y    F+      +  +  L         + +LD E    Y   + A D G PPL     + + V D+NDNHPVF   +Y   I EN   G  V  VTA D D G  G VRY+          + F ++  TG +  +  L+ +  A  + L + A DGG +     A V + + D  +  P         A+ D++    + +     +  VS   + +NA V  +L V  +  + S S    G  I+T       DRE  + +Q+R++ +  G   +  E  ++V + DVN  +P F + +Y V+++E+  +
Sbjct:  383 GNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSL-----TVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY---NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGD----AARFQVNAVTGAVSTRVSLDREERAV-YQLQVTALDGGHLRARSPAIVTITVADAQDTPPTF-------ARDDYSFVVFENVAPGTLVGSVSASTLDLNANV-TYLIVSGDQ-RGSFSIEWSGGRIFTAN---AIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPV 773          

HSP 18 Score: 105.145 bits (261), Expect = 5.138e-23
Identity = 105/372 (28.23%), Postives = 164/372 (44.09%), Query Frame = 2
Query:  515 VITIQDVNDHQPK-----FAESYYQIQISEAVQVGYRISLRTASDPDVE-PNNVCTYFMHGFNDTFNITF-----SNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEV----DCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            VI + DVND+ P         +     + E+   G   +L T +D D    N   +  + G N+  +          L  L V + LD E    Y  T++A D G P       +L + V D+ND+ P F+   Y   + E A  G  V +VTA+D DSGL  ++RY      D   L +F +   TG +     ++ + +A    LNI A D G+ PK  Y ++ V L DVN++ P+          K        +L   F + +  +D D+G N  V    D  +     E F+L +S T K   + TL   +  DRE    + + +   DRG+P L +  ++TV + D+N+  P F    Y  ++ EN
Sbjct:  212 VIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND---LGWFSVDESTGLVTTDGKVD-REVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFT------QTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRL-DSLTGK---VTTL---KSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILEN 566          

HSP 19 Score: 91.2781 bits (225), Expect = 1.078e-18
Identity = 75/286 (26.22%), Postives = 125/286 (43.71%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGE--PRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ----RIIIAQASDPDSRPNANITYHVTEGDDL--VYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINIS 2517
            G L  A  LDRE+     L+V   D+    P   ++   V + +TDVNDN P   +P      E+     +  T +QA DPD G N  V + +                    F+++ ++G + + + LDRE   SY L ++  D+G+P LTS   + +TV D NDN P++            ++ +A+D+     ++   A DPD   N  + Y +  GD      +D ++G L   + +   R   Y + + A D G P  S    + + +S  +  S    +S
Sbjct: 1783 GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVAT-VQAVDPDSGRNSYVEYALA---TDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF-------PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLS 2057          

HSP 20 Score: 87.0409 bits (214), Expect = 1.743e-17
Identity = 79/278 (28.42%), Postives = 122/278 (43.88%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREK------GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDL-RARQSIREGHYLIKL--VANDNGNPNLST 2454
            K +  F +D   G + +  + DRE              V+A D G P+      TV + + DVNDNPP       +  V E+   L   L ++ A D D G NG +R+ I             + N    F++D  +G +T+  SLDRE   SY L +   D G   L +   + + VLD NDNPP++ + +     + +  V    + +I   ASD D+ P+ ++ Y +  G+      ID   G +  AR+   E   L +L   A D G P  S+
Sbjct:  903 KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLL-RVTASDVDEGVNGALRYAIN------------EGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRV---GELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSS 1164          

HSP 21 Score: 82.0333 bits (201), Expect = 5.591e-16
Identity = 70/268 (26.12%), Postives = 124/268 (46.27%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-----TEGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            L+ A+ LDRE+     L +LA D G+P +++AT ++ + + DVND+ P                   ++  + A D D G N  +R+ I            +  N    FS+DE +G +T    +DRE   S +L I   DQG    T+  ++T+T+LD+ND PP + Q    +T +           ++   A+D D   N  + Y+       +  ++  +D++ G +   +S+ RE    Y + + A D G+P L +  K+ + +
Sbjct:  292 LKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI------------VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENS---LPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVV 544          

HSP 22 Score: 69.707 bits (169), Expect = 4.138e-12
Identity = 77/272 (28.31%), Postives = 118/272 (43.38%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL--QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW---------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-----DLVYIDAIIGDLRARQSIREGHYLIKLVANDNG 2436
            +F +D   G + T   LDRE+ ++  L+V A D+G P    +T  V + + D+NDN P V  P +    + ENE      +T + A DPD G NGTVR+ +   +  R             F ++ ++G ++   SLDRE    Y L +   D G  +  S   +T+TV D  D PP +         F+ VA  T + + S    D               NAN+TY +  GD      + +    I    A     +  Y +++VAN  G
Sbjct:  496 MFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP-PLGSTAKVTVVVGDLNDNHP-VFYPVQYFASILENEPGGTA-VTTVTATDPDRGANGTVRYQLTAGDAAR-------------FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--------------NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG 737          

HSP 23 Score: 57.3806 bits (137), Expect = 2.282e-8
Identity = 61/230 (26.52%), Postives = 98/230 (42.61%), Query Frame = 1
Query: 1822 DVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL-AQDQRIIIAQ--ASDPDSRPNANITYHVTEGDDLVYIDA------IIGDLRARQSI-REGH--YLIKLVANDNGNPNLSTEIKINL 2472
            DVNDNPP    P  +L+V+EN     +  T + A D D G+N  V + +                    F +D  SG L   + LDRE   SY+L +   D       +   +++ V D NDN P+ F   A+S ++   +    +  R +I    A D DS P   +TY +   +D  + D       + G L   + + RE    Y+++  A D G    +  + +N+
Sbjct: 1508 DVNDNPPVFAVPEMELEVEENTGEGEVIFT-LSATDADQGQNALVTYSVL-------------SGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPR-FSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNV 1719          

HSP 24 Score: 52.373 bits (124), Expect = 6.247e-7
Identity = 61/215 (28.37%), Postives = 89/215 (41.40%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQV--KENEETLPMFLTQIQARDPDLGENGTVRFYIQRV---EDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLS 2451
            DVNDN P+   P  ++V  KE+       L    A D D+G NG      + V   E+ R +  +    R  +        +L     LDRE   SY L +   D G P+      + +TV D NDNPP + +P A+  ++   S +    R ++ +   P + P    T  V+    L        D  AR+      Y + L A D GNP LS
Sbjct:   15 DVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLD-TAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFL--------HLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKP-AYRASVAEDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPL--------DFEARR-----QYTLSLRAADGGNPPLS 206          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 1.126e-44
Identity = 140/509 (27.50%), Postives = 224/509 (44.01%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNI-----FKIQPK-STFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQ-------IELTIFVPIDYWINV------ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND------TFNITFS------------------NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYK-VIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQD----FSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSL-GPAKKDFNVK--ENQTLMSHFAIIWVSDGDIGVNAEVDCHL--TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQN--------YTVNVSENSTIG 1588
            Y V EE+ VG  +G+L   SN+     F   P  S   L+     +    + E +G+L +A R+DRE +C       D C+       +++          N+      + ++D+NDH P F   +  + ISE+  VG R+ L  A DPD   N++  Y +   +        F++  S                  +   L +   LD E   +Y+  L   D G P L G+  L I V+D NDN PVF     + V I E++ VG  V  + A D D+G  G + Y F  ++   +  +  ++   TG + ++   N + + ++      L + A DGG + +    TV V L D N+  PV  + +L G    D  VK  EN    +   +I VSD D+G +  VD  L    GAE   L++   V+    + L+  R+ D E    + V +L +DRGTPKL+    + + + D+N+ +P F            Y V++ EN   G
Sbjct:   31 YEVDEEVLVGYVIGDLR-QSNLLCVCFFPPAPHVSPLPLHTPSLCI----VNELSGELSVALRLDREALC---MEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVR---NAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAE---LASPNKVQ----FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAG 521          

HSP 2 Score: 57.7658 bits (138), Expect = 1.126e-44
Identity = 72/272 (26.47%), Postives = 111/272 (40.81%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI---NPPKLQVK---ENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIII----AQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDL---RARQSIREGHYLIKLVANDNGN 2439
            LF ++   G L  A  LDREK  + EL V A D G P+ +         + D NDN PT +   N      +   E E ++  ++  +   D D G+N  V   + R      +            + D   G +     LDRE    Y L +   D G+P L++   +++TV D NDN P    P   +TN T K V       ++      A+D D+  N    Y +  G+   +  ++A  G L   R   S+ EG + + +   D G 
Sbjct:  556 LFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVL-DENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGG----------AGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSP---NTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGG 813          

HSP 3 Score: 118.627 bits (296), Expect = 2.232e-27
Identity = 109/403 (27.05%), Postives = 178/403 (44.17%), Query Frame = 2
Query:  410 AQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQ--------IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIV--INALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKE--------YKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQ-DPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPV-ININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQN 1552
            A+++DRE   V      A D  Q+  +  V +   +N     D ND+ P F     Q        ++I E +  G  + L + SDPD+  +      +  F     +   N +  ++     LDYE    Y  +++A D G P L     L ISV+DINDN PVF            Y+V ++EN   G VV N+ A D DSG  G + +   ++    SV   F ++  TG++ L   L+ +     + L++EA DGGS  +   A V V + D N+  P  + +++       F V+E  ++ ++   +  SD D G NA V  +L   A    +  +    G  + TL    V DRE    +++ +   D G P L+    +++ + D N+ +P     N
Sbjct:  339 AEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELN-----DDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE-FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLD-REKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLV---VLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPN 731          

HSP 4 Score: 85.5001 bits (210), Expect = 4.492e-17
Identity = 82/290 (28.28%), Postives = 137/290 (47.24%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQ---------VKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR----IIIAQASDPDSRPNANITYHVTE--GDDLV--YIDAIIGDLRARQSI-REG--HYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVI 2508
            L+T  +LD E+  +  + VLA D+G P+  +    + I++ D+NDN P  +NP  ++         ++EN     + L  + A D D G NG + F +  +     +AE        +FS++  +G LT+   LDRE    Y L +  CD G PQ  +   + +TVLD NDN P  F  V++STN   +  + ++      +     SD D   NA +  ++    G D +    D   G +R    + RE    Y + + A D+G P LS   ++++ +S  +  + VI
Sbjct:  449 LKTTRLLDYEEAQQYNVSVLAADRGTPK-LSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVL-NLLATDADSGPNGAITFTLSELAGGESVAE--------LFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPT-FVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVI 727          

HSP 5 Score: 81.6481 bits (200), Expect = 5.741e-16
Identity = 95/394 (24.11%), Postives = 167/394 (42.39%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQ-IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH------GFNDTFNITFSNLLYLIVINA--LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFS----QKEY----KVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-----GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNV-------KENQTLMSHFAIIWVSDGDIGVNAEVDCHLT--VGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVN------VSENSTIG 1588
            I + D ND+ P F +   + ++I+E  +VG  +    A+DPD  PN    Y  H            ++  +  L + V NA  LD ET   ++  +VA D G      + T+ + + D NDN PVF     Q EY     V I EN   G  V  ++  D D G  G V  R       ++  P+ + +         +K  R+L+ +  AQ +++++ A+D G+        + + + D+N+  PV     + PA  + +V       +EN    +    +  +D D G N  +   L+   G E+     S  ++   +    P    DRE    +++ +   D G+P+      + V + D N+ +P F   + + N      V E +++G
Sbjct:  260 IVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGL-VTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFL--------LKTTRLLDYEE-AQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVF----MNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATP---LDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVG 636          

HSP 6 Score: 67.3958 bits (163), Expect = 1.671e-11
Identity = 69/245 (28.16%), Postives = 114/245 (46.53%), Query Frame = 1
Query: 1648 TRSKSKCLFFIDQYMG--NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV---------INPPKLQVKEN-EETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQR-----IIIAQASDPDSRPNANITYHVTE 2331
            T   ++    +D   G   +R A  LDRE      L+V+A D G+  S++A+ TV + + D NDN P           +    +++ EN     P+ L  I   DPDLG +GTV     R+E   G AE    N+ +          L   + LD E    Y + ++  D+G P+L+ +  + ++V+DINDN P +  P +   ++    V  ++       ++   A+D DS PN  IT+ ++E
Sbjct:  317 TSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQ-LSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVL--ISVSDPDLGSSGTVDV---RLEFPTG-AELASPNKVQFL--------LKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSE 546          

HSP 7 Score: 63.929 bits (154), Expect = 1.886e-10
Identity = 68/258 (26.36%), Postives = 106/258 (41.09%), Query Frame = 1
Query: 1642 IPTRSKSKCLFFIDQYMGNLRTANILDREK------------GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENE-ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN-------------------LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            +P  + S C+  +++  G L  A  LDRE             G    + V A+ +G+  S      V + + D+ND+ P     P L V  +E E +   +   +A DPD G N    + I         A   D  +   FS+ E   +                   L + + LDRE + SY L +   D G P+L+    +T+ V+D NDN P +  P      IT  S +     ++  +A+DPD+ PN  I Y
Sbjct:   66 LPLHTPSLCI--VNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPA-FRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRIS--------AASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTS--VVQLRAADPDAGPNGAIAY 310          

HSP 8 Score: 59.3066 bits (142), Expect = 4.019e-9
Identity = 65/263 (24.71%), Postives = 107/263 (40.68%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV-------PIDYWINVITIQDVNDHQPKF------AESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY---------FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQ-------KEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILN 1069
            + FSL   TG+L +A  +DRE+          R + EL++              I  +T+ D ND+ P F          YQ  + E   VG  +   + SD D   N              ++ G  DT       L+       LD E ++ Y+ ++ A D G P L  +  ++I+V D NDN PV +        K  +       +VG    +VTA D+D+G  G+  Y   ++   +    F ++  +G + L R ++
Sbjct:  555 ELFSLNMRTGQLTLATPLDREK----------RMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVV------LDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVG---VSVTANDIDAGDNGRPLY---EIIGGNPKGIFLLNADSGALSLARTVS 795          
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 4.296e-42
Identity = 82/272 (30.15%), Postives = 132/272 (48.53%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANI-LDREKGDKIE------LIVLAIDQGEP-RSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-----DLVYIDAIIGDLRARQSIREGHYLIKLVANDNG 2436
             + I+   G +RT  + LDRE  + I       ++V   D+G P R  TA+ TV + + DVNDN P+ +  P  LQV E    LP    L Q+ A DPD G NG V + +     +              F +D  +G +T    LDRE + +Y L ++  D+G P L+S   ++L VLD+NDN P  F P   + ++     +A+D  +I    +D DS  NA +++ +T G+      + + D ++  + +     +  Y + + A DNG
Sbjct:  393 FYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEG---LPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD------------FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPT-FHPARSAVSLMES--VARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG 646          

HSP 2 Score: 95.1301 bits (235), Expect = 4.296e-42
Identity = 95/366 (25.96%), Postives = 164/366 (44.81%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGE--IKLQRILNCKNI-AQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVD----CHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQ--VRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            IT+ + ND++P F+   Y + + E   +G  +    A+D D       +Y     +D F++  ++ L + V  ALD+E    +  T++A D G     G   + I++LD+NDN PVF +  Y    +EN      V  V A D DS    Q+ Y    +   +  SYF I+   G   + L R L+ + I     SL I A DGGS P     T  V + D N+  P+ + NS       +++   + +++   +++V+  D   + E       +   G+  F+++     +  DI +     + DRE  S +   VR +    G  + T    + + + DVN+  P ++   Y V + EN+  G
Sbjct:   18 ITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDKFSLDPASGL-ISVAAALDFEATPRFTVTVMARDGGGQETAGR--VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSI--LPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNS-------YSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRIN----ARSGDITS---TTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGG 364          

HSP 3 Score: 90.5077 bits (223), Expect = 6.213e-35
Identity = 69/260 (26.54%), Postives = 122/260 (46.92%), Query Frame = 2
Query:  812 GNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININS-LGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G+  + I++++ NDN P+FS   Y V + ENA +G  V  V A D+D+G+FGQV Y F    D      F +   +G I +   L+ +   + F++ + A DGG     G   V ++L DVN+  PV   +S +G A      +EN   ++    +  +D D   N ++   +   +      +     G  + TL     +++       + ++  D G+P L +     V++ D N+ SP F + +Y++ + EN   G
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDK-----FSLDPASGLISVAAALDFEATPR-FTVTVMARDGGGQETAG--RVRINLLDVNDNTPVFQRDSYVGTA------RENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAG 257          

HSP 4 Score: 75.8702 bits (185), Expect = 6.213e-35
Identity = 83/286 (29.02%), Postives = 126/286 (44.06%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXX-XXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNL-TIYKSLDRE------YIDSYILYIMVCDQGKPQLTSIEAITLTVL--DINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG---DDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F I+   G++ +  +LDRE   +  LIV A+D G+   Q        IT+ DVNDN P   + P  + + EN        T + A DPDL ENGT+ + I              +     + I+  SG + T    LDRE      +     + +   D+G P   +  + T+TVL  D+NDN P +   V     +     L  +  +    A+DPD   N N+TY +T      D   +DA  G +     + RE    Y ++LVA D G P LS+   ++L +
Sbjct:  289 FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFT-VSAADPDLNENGTLVYAI--------------DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSF---VGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDF-QLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVV 555          

HSP 5 Score: 101.679 bits (252), Expect = 2.699e-34
Identity = 130/458 (28.38%), Postives = 202/458 (44.10%), Query Frame = 2
Query:  296 NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR--CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM---HGFNDTFNITFSNLLYLIVI-NALDYETQINYKT---TLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMD-SGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDG--GSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF----NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLC---SDRGTP--KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE----NSTI 1585
            ++D+ +F    + ++   DD      FSL+ ++G + +A  +D E     + T + R     E    V I+       + DVND+ P F    Y     E       +    A+D D  PNN  TY +     ++  F+IT S    ++ +  ALDYE +I   T   T++A D G PPL    T  + V D NDN P+F +  Y + I EN + G  V  V A D D S  +GQ+   +   G  Q       F I+  +G+I    +L+ + ++Q + L + A DG  G+  K G ATV + L DVN+           PA +D      + EN    +    +  +D D+  N  +  +       F   N+ + K R    LQ +R  D    S   +R +    +DRG+P  + T    +TV +QDVN+  P F    Y + V E    NST+
Sbjct:   56 DLDAGVFG---QVSYHFSDDSD---KFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRIN-------LLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYE-KIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ-------FRINARSGDITSTTLLDREAVSQ-YILIVRAVDGGDGNDQKTGIATVNITLLDVNDN---------DPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTL-VYAIDPPNPFYRINAASGKIRTT-GLQLDRE-DLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTL 479          

HSP 6 Score: 62.7734 bits (151), Expect = 2.699e-34
Identity = 66/228 (28.95%), Postives = 102/228 (44.74%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETL-PMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP--QLTSIEAITLTVLDINDNPPKWFQ---PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD 2337
            F +D   G + T   LDRE     +L ++A D+G P + ++TTT+ + + DVNDN PT  +P +  V   E       +  +   D D G N  + F+I               N+   FS+    G +    SLDRE   SY L I   D G    + T    + + VLD+NDN P + +    V+   N+T  +++ Q       QA+D D   N  + Y +  G+
Sbjct:  508 FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTP-ALSSTTTLSLVVLDVNDNAPT-FHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFIT------------GGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQ------VQATDIDEGINGRVWYRIISGN 715          

HSP 7 Score: 106.686 bits (265), Expect = 1.928e-23
Identity = 95/354 (26.84%), Postives = 156/354 (44.07%), Query Frame = 2
Query:  518 ITIQDVNDHQPKF-AESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH-GFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPN---------RVFDREVDSHFQVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRF 1540
            + + DVND+ P F +   Y + + E    G  ++   A+D D  PN   T+ +  G  D  +I  S+ +  +   A +D ET+  Y   +VA D G PPL G+  + + V D+ND  P F      V + E+  VG  VA V A +   G   +  Y+   +   +    F +   +G +   R+L      + F+L   A+D G  P  G A ++V + DVN+ RPV     L P     N+ E   ++     +   DGD G N         GA  +   ++  V  RD  + + N         R  DRE  + + + +L SD+G P    + + + V + D+++  P F
Sbjct: 1941 VIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNA----FTVHATSGLVTSTRLLKS---YERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVF---VLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQN---------GAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVF 2275          

HSP 8 Score: 76.2554 bits (186), Expect = 3.586e-21
Identity = 74/274 (27.01%), Postives = 118/274 (43.07%), Query Frame = 2
Query:  803 PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKEN-AMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK---VGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPN----RV-----FDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            P     ++ I + D NDN P F    Y+V++ E  +  G  VANVTA D D G   +V Y    +   +  + F I   TG +   + L+ +  A  + L + A+D    P       ATV VH+ DVN+  P    +  GP     +V E Q      A    SD D G+N E++  +  G              R+ + + P     RV      DRE  + + + ++  D GTP L +   + V++ DV++  P F       ++SE + +
Sbjct: 1151 PAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVY---AIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGP----IDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDG------------DPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAV 1404          

HSP 9 Score: 43.8986 bits (102), Expect = 3.586e-21
Identity = 71/283 (25.09%), Postives = 116/283 (40.99%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE--PRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENE---ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIY--KSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSR--PNANITYHVTE-GDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNP--NLSTEIKINL 2472
            F+ D   G +     LDRE+  +  L +   D  +    ++  +  + +TI D NDN P       + ++ EN      L +    I A D D G N T             LA  +    +  F ID   GN+++   + LDRE I    L + +  Q   +  +   + +TVLD+NDN P  F   + + ++   S  A    +I+ +A D D        + Y +   G+D   ID   G +     I       YL+ +VA D   P    S E++++L
Sbjct: 1440 FYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNAT-------------LAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPT-FNVTSQTAHVLENSP-AVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSL 1707          

HSP 10 Score: 98.5969 bits (244), Expect = 6.240e-21
Identity = 114/449 (25.39%), Postives = 193/449 (42.98%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGK--LIIAQRIDREQVCPTSFTALDRCQIELTIFV------PIDYWIN-VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNN---VCTYFMHGFND------TFNITFSNLL-------YLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRI------LNCKNIAQDFSLNIEASDGGSVPK--VGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            T+ +        YFS+  S G   + +A+ +D E++   +        I LTI        P++  +  ++ + D ND+ P F  + Y I I E +  G  +    A+D D  P        Y + G         + +IT + LL       Y++++ A+D     + KT             G  T+ I++LD+NDN P +    Y V I EN   G  +  V+A D D    G + Y    +  P+   ++ I+  +G+I+   +      LN  + A   S+ +  +D GS P+     ATV V L+DVN+  P     S         V E     S    +  +D D G N  V   +T      +F+L  +  +    I TL      DRE  + +Q+R++ +DRGTP L++   +++ + DVN+ +P F      V++ E+
Sbjct:  167 TYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGT--------ISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKT-------------GIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVY---AIDPPN--PFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEP-----SFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGL----ITTLVQ---LDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMES 577          

HSP 11 Score: 93.2041 bits (230), Expect = 2.902e-19
Identity = 117/435 (26.90%), Postives = 186/435 (42.76%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PID-----------YWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYE--TQINYKT----TLVACDCGMPPLCGNQTLAISVL--DINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGT--PKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G+L   +SLE ST   I A+  D      TS T LDR  +   I +   +D             +N IT+ DVND+ P + +  Y + I E    G  I   +A+DPD+  N    Y +   N  + I  ++         LD E    I++ +     +   D G PP     +  ++VL  D+NDN P F    Y + + E       +  VTA D D G  G V Y     +  P     F +   TG I     L+ + +A  + L + A+D G+       T+ + + DVN+  P  +     PA+   ++ E+    S    +  +D D G+NAE+   +T G ++ + S    V  RD   ++     DRE  + + + +   D G    + T    + V + DVN+  P F + +Y V+V EN T G
Sbjct:  275 GQLSLIYSLEGSTQFRINARSGD-----ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVN-ITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPD----FQLDAATGLITTLVQLDREAVAA-YQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFH-----PARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFS----VGFRD-GLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRG 688          

HSP 12 Score: 92.8189 bits (229), Expect = 3.803e-19
Identity = 106/384 (27.60%), Postives = 169/384 (44.01%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGF-NDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVV--ANVTAVDMDSGLFGQVRYRF---GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYAT---VFVHLKDVNNQRPV-ININSLGPAKKDFNVKENQTLMSHFA-IIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQ---TVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRG--TPKLTTE-----------EEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + DVND +P F      + + E++ VG  ++   A++     N   TY + G   + F +  ++ L         YE    +  T VA D G PPL G   L + VLD+ND+ PVF       ++    ++  V+    V AVD D G  G VRY F   G V      S F I+  +G I   R L+ ++ A  +SL + ASD G    V Y +   + V L D+++  PV I +   G   + F++ E+    +    +    D D+G NA V   +  G E  K + S+    V   D+         DREV  ++ + +  S     TP +TT             E+ V ++D+N+  P F    YT  V+ ++ +G
Sbjct: 2048 VLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYE---RFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWES-FRINATSGIISTARALDRESQAV-YSLILLASDQGQ--PVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEGNKFNLSRWGLLVVLSDL---------DREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVDAKVG 2415          

HSP 13 Score: 92.4337 bits (228), Expect = 4.542e-19
Identity = 104/365 (28.49%), Postives = 155/365 (42.47%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYY-QIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL---LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYA-----TVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            + + DVND  P F  SY   I +SE  Q G RI+   ASD D   N    Y +   +       S     L +     LD ETQ  Y  T++A D G PPL    T+ + VLD++DN PVF        + E A V  +V+ V A D + G       +       +    FY  + TG + + R L+ + +A+ + L +   D    P   YA      + V + D N+  PV +  +   A+   N      L      I+ SD D GVNA +   L  G+  + L +    + R   ++   +  DRE       ++ +L  D G    T    +TV   DVN+ +P F   + T +V ENS
Sbjct: 1270 VHVADVNDVTPWFLRSYEGPIDVSEG-QPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAE-YRLTLTVRDNPDNPS--YARKDSDIMIVTILDENDNSPVFSQVTY-EAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLID----RDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTV--LDVNDNTPTFNVTSQTAHVLENS 1623          

HSP 14 Score: 92.0485 bits (227), Expect = 5.471e-19
Identity = 102/372 (27.42%), Postives = 161/372 (43.28%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQV-GYRISLRTASDPDVEPNNVCTYFMHGFND--TFNITFSNLLYLIVINALDYETQIN-YKTTLVACDCGMPP---LCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDF-SLNIEASDGGSVPKVGYATVFVHLKDVNNQRPV-ININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT--LQPNRVFDREVDSHFQVRMLCSDR-GTPKLTTEEE--ITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +I I D ND+ P F  + Y++ ++E     G  ++  TASDPD   N    Y +   N   TF I  +    L  + ALD+E     Y   + A D    P   L    T+++ V D+ND  P F +     I       G  +A   A D DSGL G++ Y    + D    + F IS   G+++++R +      Q F +L I A D G+ P     TV V + DV++  PV +N+    PA    ++ E   +++  + +  SD + G N    C   +        N +     D  T  +  NR  DRE  + +++ +   D    P    ++   + V I D N+ SP F +  Y   + ENS  G
Sbjct: 1159 LIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGID-NGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEY---SIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNL----PANA--SLSEAAAVLAIVSRVRASDANEGRN----CAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNG 1516          

HSP 15 Score: 87.0409 bits (214), Expect = 1.954e-17
Identity = 63/209 (30.14%), Postives = 101/209 (48.33%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFND--TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP--PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR 982
            F L+ +TG +    ++DRE V        A DR    L+    +      + + DVND+ P F  +   + + E+V     +     +D D   N   ++F+ G N    F++ F + L   V+ +LD ET+ +Y   + A D G       G  TL + VLD+NDN P+F +  Y+V + EN   G ++  V A D+D G+ G+V YR
Sbjct:  508 FQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLS-----LVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVV-SLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYR 710          

HSP 16 Score: 77.0258 bits (188), Expect = 2.044e-14
Identity = 78/296 (26.35%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  737 ALDYETQINYKTTLVACDCGMPPLCGNQT------LAISVLDINDNHPVFSQKEYKVI-IKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGE-----IKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ALD E   +Y  T+++ D G        T      + ++V D NDN P F      ++ ++E+A  G ++  + A D D+G  G V  R       + +   YI     E     + + +    +  +Q     I A DGGS P+     + V + DVN+  P+     L P     +V E     +  A +W +D D G N +V   +  G  + KLS   +     I  + P    DRE  + + + ++  DRG P L+    + V + DVN+  P F     TV+V E+ ++G
Sbjct: 1790 ALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSAR-AHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIF----LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGD-KLSIGPS---DGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVG 2076          

HSP 17 Score: 71.2478 bits (173), Expect = 1.349e-12
Identity = 79/284 (27.82%), Postives = 121/284 (42.61%), Query Frame = 1
Query: 1675 FIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXX------XXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEK--IDENRTKIFSIDEISGNLTIYKSLDREYIDSYILY-IMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-TEGDDLVYIDAIIGDLRARQSI---RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
             I    G + T   LDRE  D   L VL+ D G PR   A  T        + +TD NDN P         V+  E   P   LT + A D D G NGTV          R   +   I +N + +  +D       + K+   E    +IL+ I+  D G P  ++   +++ VLD+NDN P +  P  ++ ++    + A    +    A+D D+ PN  +T+ + + G D + I    G +R        RE    Y + +VA D GNP LS    + + +
Sbjct: 1777 LIAALQGEITTQAALDREATDSYMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVD-------VAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVV--ELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLV 2050          

HSP 18 Score: 68.9366 bits (167), Expect = 6.216e-12
Identity = 61/231 (26.41%), Postives = 101/231 (43.72%), Query Frame = 1
Query: 1822 DVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDS-YILYIMVCDQGKP---QLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSIR-----EGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            D NDN P       ++ + E   T  + +  + A DPD G+N  V + I            +  N    F ID  +G LT  K+LD E     Y+L +   DQ +    +LTS   +++ V D+ND  P + +      +++         RI    ASD DS  N  + Y + +GD  +   I    GDLR R+ +      +  Y + ++A D G P L++ + + + +
Sbjct: 1164 DENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI------------VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQ---PGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRV 1379          

HSP 19 Score: 60.8474 bits (146), Expect = 1.947e-9
Identity = 64/257 (24.90%), Postives = 112/257 (43.58%), Query Frame = 1
Query: 1714 ILDREKGDKIE-------LIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIY--KSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-GDDLVYIDAIIGDLRARQSIRE-GHYLIKLVANDNGNPNL 2448
            I+D  K D +E         ++A+D G P  ++ T  + + + DVNDN P  ++P    V   E   P   +  + A D D G NG V F I+      G  +K+        SI    G + +    ++DRE   +Y L ++  D+G P L+    + + V D+ND  P +  PV     ++    L+    +   +A++     N   TY +   G +   + A  G + + + ++    + +  VA D+G P L
Sbjct: 1903 IVDVAKADFVEKTSQFILFRIVALDGGSP-PRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIES-----GGGDKL--------SIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPV---QTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPL 2142          

HSP 20 Score: 59.3066 bits (142), Expect = 5.686e-9
Identity = 81/293 (27.65%), Postives = 118/293 (40.27%), Query Frame = 1
Query: 1594 VATSSCDRR*RHRTIAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVL-AIDQGE--PRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTI--YKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDP-DSRPNANITYH----VTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDN 2433
            V  S  D     R +       +   F ID   G L     LD E    + L+V+ A DQ     R  T+T TV + + DVND  P  +   +  +  +E      +    A D D G NG + + I            ID +    F I    G+L +  Y  LDRE    Y L IM  D G P L S   + + VLD++DN P +    A+++     +VLA   R+   +ASD  + R  A +  H       G+   Y D+  G +   + +   R   Y + L   DN
Sbjct: 1195 VTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSI------------IDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRV---RASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDN 1472          

HSP 21 Score: 58.9214 bits (141), Expect = 8.163e-9
Identity = 105/415 (25.30%), Postives = 175/415 (42.17%), Query Frame = 2
Query:  251 AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV---ITIQDVNDHQPKFA--ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMH----GFND--TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVF-----SQKEYKVI-IKENAMVGEVVANVT-AVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGS-VPKVGYATVF------------VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTL 1396
            +V E + VG+FV  +    N      K T+K+   GK    F++  ++G +   + +   +    +  A D  +  L        W      + + DVNDH+P F    +   + I+E + V  RI    A D D   N    Y F+H    G  D  +F I  ++ + +    ALD E+Q  Y   L+A D G P      Q L + + DI+DN PVF         Y+   I E++  G  V NV+ AVD D G    V Y      +    + F +S +   + L  +   + ++  +++ ++AS   +  P V     F            V+L+D+N+Q PV   N    A    + K    L+   A+    D D+G N+ V  +  +     K S++ + +  +I+TL
Sbjct: 2068 SVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGK--NAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPL--------WGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGI-ISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGNEG---NKFNLSRWGLLVVLSDL--DREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFT-NHEYTAGVAVDAKVGSELLQLEAV----DRDVGNNSIV-LYRILSILYIKHSSNSSTRMYNIFTL 2460          

HSP 22 Score: 56.225 bits (134), Expect = 4.525e-8
Identity = 60/217 (27.65%), Postives = 98/217 (45.16%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRT----ASDPDVEPNNVCTYFMHGFNDTFNITFSNL--LYLIVINALDYE--TQINYKTTLVACDCGMPPLCGNQT--LAISVLDINDNHPVFSQKEYKVIIKENA-MVGEVVANVTAVDMDSGL--FGQVRY 979
            + F  +  TG + + + +DRE+V     T   R   +   +   D  I ++TI D ND+ P F++  Y+ +I E    G  +++      ASD D   N    Y + G +  + +   +   + + +   LD E       + T++  D G      N T  L ++VLD+NDN P F+       + EN+  VG  V  V A+D D G+   G VRY
Sbjct: 1438 RAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRR----NATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRY 1650          

HSP 23 Score: 52.7582 bits (125), Expect = 5.408e-7
Identity = 65/258 (25.19%), Postives = 106/258 (41.09%), Query Frame = 1
Query: 1708 ANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLT---IYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID----------AIIGDLRARQSIREGHYLIKLVANDNGNP 2442
            ANI DRE      L+V+A+D+G P   + +  V + + DVND  P  + P +        ++  F+  ++A +   G N    + I            I +N    F++   SG +T   + KS +R     + L  +  D G+P L     + + VLD+ND+ P +  P  + T +    V+    RI+   A D D   N  + Y       +   D           II   RA     +  Y + L+A+D G P
Sbjct: 2016 ANI-DRETRAAYTLMVVAVDRGNP-PLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIA----------GIGKNA---FTVHATSGLVTSTRLLKSYER-----FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLP-PNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQP 2252          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 175.637 bits (444), Expect = 4.363e-60
Identity = 133/468 (28.42%), Postives = 225/468 (48.08%), Query Frame = 2
Query:  209 QISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS-------NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR--FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVK-ENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
             +S G+ +     + V+EE   G +VG ++  ++ F+  PK              F    +TG +    RIDRE           +  ++L    P +  I+V + + D+ND++P+F   YY ++I E++ V     + TA+DPD   N    Y +   ++T   +         + L +I    LD ET   Y+  + A D G P L G   + I++LD ND+ PVF+Q  Y   I EN   G  +  V+A D DSG  G ++Y   +  +Q  S+   F + + TG I+ ++ L+ + +   ++ N+ ASDGG   K   ATV +++ D N+  P + I  L P   D  ++ EN  + ++ A I V+D D   N++ +  +T G +   FK      V+    Y +Q  +  DRE+   + + +  +D+G P  +T   + + + DVN+ SP F    YT N+SE
Sbjct:    5 SVSAGSSYT----FHVQEEQPPGTYVGKVD-GASAFEGSPKQ-------------FGFNSNTGVISTTARIDRETTT--------QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI---FDLDSSTGVIRTKQNLDFE-VKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFK------VEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISE 436          

HSP 2 Score: 75.8702 bits (185), Expect = 4.363e-60
Identity = 76/278 (27.34%), Postives = 125/278 (44.96%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPNLSTEIKINLYISSKS 2490
            F +D   G + TA  LDRE+   + + + A D G    +T +TTV +TI D NDN P  +            ++   + Q+ A D D G+NG + + I             D     +F ++  +G L     LDRE    Y   ++  D G PQL S   + LT+ DINDN P ++ PV +  +I          +++   A+D D   NA I+Y +  G++     ID+  G +    S+    E  + + + A D GN   +    +N+ + +K+
Sbjct:  473 FQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSA-PKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSS----------DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY-PVEYFASIMENE---PPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKA 735          

HSP 3 Score: 115.161 bits (287), Expect = 2.549e-36
Identity = 101/358 (28.21%), Postives = 157/358 (43.85%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT--FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE--NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            +I + DVND+ P F  + Y   ISE  Q G  +    A+DPD   N   +Y + G ND   F + F + L +     LD E   +   T+ A D G  P  G+ T+ ++++D NDN P F +  YK  I E A +G  V  V+A D+DSG  G++ Y      D  V   F ++T TG +  +  L+ +     +S  + A D G    +    V + + D+N+  PV       P +   ++ EN+        +  +D D G NA +   +  G    NF + +S  V    I TL      D EV+  F + +   D G         + V + +  +  P F  + Y   V EN
Sbjct:  412 LIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGL-VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISS-SDAQVNGLFELNTQTGVLWTKSQLD-RETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFY-----PVEYFASIMENEP-PGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGV----ISTLAS---LDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYEN 753          

HSP 4 Score: 56.9954 bits (136), Expect = 2.549e-36
Identity = 69/274 (25.18%), Postives = 118/274 (43.07%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAI-IGDLRARQSIRE---GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            LF +D   G ++    +DRE+  +  L V+A   G  +  +A  TV I + D NDN P       +   +    +   +    A D D G+NG VR+             ++  N   +  I+  SG + + + L       Y + ++  D G P   S   I +T L IN +PPK F   ++ T++     L+     ++A   D DS  N  + Y + +G++         G L  R+S+ +   G Y + + A D G P+ S  + + +YI
Sbjct:  786 LFLVDSTGGIIKINGDMDREEKAQYLLAVIA-RVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRY-------------QLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSIN-HPPK-FTLSSYVTHVLASQPLSYQFFYVVAV--DQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYI 1040          

HSP 5 Score: 85.1149 bits (209), Expect = 1.245e-32
Identity = 82/294 (27.89%), Postives = 131/294 (44.56%), Query Frame = 1
Query: 1666 CLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYI----DSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDLRARQSIREGH--YLIKLVANDNGNPNLSTEIKINLY----ISSKSTFSTV 2505
             +F ++   G L  A  LD E     EL + A D G  P S T   TV +   DVNDN P     P  L V+EN  T  P  + +  A D D G N  + F +              +  +K FS++  +  +T   ++D E +    DS+ L +M  DQG P+L++ ++IT+ V D NDN P +  P A        +       ++   A DPD   N  +TY +  G++  + +    G L+    I +    Y + + A+D G P+  T+  ++++    I    TFS+ 
Sbjct: 1310 AMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVL--DVNDNAPLFPTQPVTLTVRENVNTGFP--VGRCTASDRDTGTNAHIAFSMYS------------QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPA--------AAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSA 1579          

HSP 6 Score: 74.3294 bits (181), Expect = 1.245e-32
Identity = 87/358 (24.30%), Postives = 148/358 (41.34%), Query Frame = 2
Query:  539 DHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT--FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNI-----EASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFK-LSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +H PKF  S Y   +  +  + Y+     A D D   N    Y +   N+   F I     LY  +  +L    + +Y   + A D G+P    +  + I + D ND+  +F    ++  + EN+  G +V  + A  +D      + Y        S  S+F +   +G+I  +  L+ + + ++   N+     EA    +  K   A V V + D+N+  PV +      A     V E     S    I   D D G NA+    L  G    K   NS T +      L  ++  DRE  S + + +  +D     L +  +I + + D N+  P F + +YTVN++E++ IG
Sbjct:  941 NHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLY--IRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL-----ISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFS-----RAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGE------LHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIG 1280          

HSP 7 Score: 98.5969 bits (244), Expect = 1.371e-31
Identity = 107/419 (25.54%), Postives = 169/419 (40.33%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ--DVNDHQPKFAESYYQIQ------ISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT--FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN----FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F L+ STG +   Q +D E     +F       I     VP    +  +TI   D ND+ P+   +Y           SE   +   I+    +D D   N+     +   +D   F + F    ++ +   LD E    Y  TL   D G+P       + I V D+NDN P F+   Y   I E A  G  V  + A D D G  G V Y      D   L +F +   +G +   + L+ + ++   ++ I A D GS PK G  TV V + D N+ +P    +S         + E  ++ +    +  +D D G N  +   ++         F+L N+QT        L      DRE  S +   +L  D G P+L +  ++ + I D+N+ +P F    Y  ++ EN   G
Sbjct:  256 FDLDSSTGVIRTKQNLDFEVKNSYTFNV-----IASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGND---LGWFQVDFQSGLVTTAKPLDREQVSS-VTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSY-----KGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFEL-NTQT------GVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG 653          

HSP 8 Score: 57.3806 bits (137), Expect = 1.371e-31
Identity = 61/276 (22.10%), Postives = 119/276 (43.12%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP--MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-GDDLVYIDAIIGDLRARQSIREG---HYLIKLVANDNGNPNLSTEIKINLYIS 2481
            F ID   G + T   LD E  +   LI+ A D G   +          +   ++ P  +       V EN   +P    + ++ A   D  +NG++ + I            +  + T +F +D   G + I   +DRE    Y+L ++        L++   + + VLD NDN P++      S  +         Q +  A A D D+  N  + Y +T   + L++I++  G ++  + + +G    Y ++++A+D+G+P   + + I++ +S
Sbjct:  684 FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYEN---VPKGTLVGRVYATTKD--KNGSISYAI------------VSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS 939          

HSP 9 Score: 130.568 bits (327), Expect = 1.447e-30
Identity = 118/450 (26.22%), Postives = 204/450 (45.33%), Query Frame = 2
Query:  233 NRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFK--LYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELT---IFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM---HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEV--DCHLTVGAENFKLSNS----QTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
            N    +AV E    G  VG L     +      S  K  +Y       +F+++  +G++    R+DRE++   + + +   Q E       +  D  I ++T+ D+ND+ P F+ + Y I +SE    G  +    A D D   N    Y +    G +  F  + +  L+L     LD ET  +Y   + A D     L     + I+V D ND  PVF + +Y V I E+A++G +V N+ A D D G  G ++Y    + + ++ + F + + TG + + + L+ +   Q + L I A D G +P      V V++ DVN+  P+     +        V+EN            SD D G NA +    +    ++ F ++++     T+   D+ T+   R         FQ+ ++ +D+G+PKL+T + ITV++ D N+ SP F
Sbjct: 1052 NNTFRFAVAENSSPGTLVGTL-----VAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHL--SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY---SISNGNLAAMFDVESATGRLIVAKSLDFE-TTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPV-----TLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAIDLETMPAGR-------DSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGF 1478          

HSP 10 Score: 113.62 bits (283), Expect = 2.492e-25
Identity = 109/418 (26.08%), Postives = 177/418 (42.34%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIA---QDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G  +  F +  STG+L +++ +DRE     +    A D     L     I+     IT+ D ND +P F ES Y + I+E   +G  +    ASD D+  N +  Y +   N    F++  S    LIV  +LD+ET   Y+ T+ A D G+ PL     + ++VLD+NDN P+F  +   + ++EN   G  V   TA D D+G    + +     Q PS    F +++ T EI     ++ + +      F L + A+D GS       ++ V + D N+  P         A    NV            I   D D   N +V   +  G   +   +  T + + I+ +  N          +Q+ +  SD G P   T+  ++V  +      P F   +Y  +V+EN   G
Sbjct: 1201 GTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIE-----ITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVE-SATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSM-YSQTPS--KTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGSSLNV----------MTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPTI-------YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAG 1592          

HSP 11 Score: 95.9005 bits (237), Expect = 3.409e-24
Identity = 108/417 (25.90%), Postives = 182/417 (43.65%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPT--SFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF---SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G  L +F ++  +G +  A+ +DREQV     + TA D      T    +      +TI D ND++P+F +S Y+  ISE   +G  +   +A+D D   N   TY +   +   N  F   +    L   + LD ET+  Y  T++A D G P L  +  + +++ DINDN PVF   EY   I EN   G+++  VTA D D G    + Y    +   +    F I + TG I     L+ + + + FSL I A DGG+      A V V + +  +  PV           +F V EN    +    ++ +  D   N  +   +  G   N  L +S          ++ N   DRE  + + + ++        L+ +  + +++ D N+ +P+F   +  V++     +G
Sbjct:  467 GNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTV-----TVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISY---DIIGGNNNGNFSIDSSTGVISTLASLDHE-VEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMY-----NFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTG------GIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVG 860          

HSP 12 Score: 35.039 bits (79), Expect = 3.409e-24
Identity = 44/183 (24.04%), Postives = 73/183 (39.89%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKI-----DENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDN 2187
            S ++ L +I+   G ++ A  L      +  + VLA D G P   +  T              ++ +PPK        TL  ++T + A  P   +     FY+  V+   G   ++       N   +F I    G L I KSL +    SY L +   D G P  ++   +T+ + D ND+
Sbjct:  885 SNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL---------SINHPPKF-------TLSSYVTHVLASQPLSYQ----FFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDH 1046          

HSP 13 Score: 64.6994 bits (156), Expect = 3.784e-19
Identity = 67/237 (28.27%), Postives = 106/237 (44.73%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV---INPPK---LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGN-LTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIA-QASDPDSRPNANITYHVTEGDDL 2343
            +S  +F +D   G +RT   LD E  +     V+A D G P S+    TV I + D NDN P +     PP      ++     +   +  I   D D   N      I   +D+              F ++ +    + + K LDRE +  Y L + V D+G P  +++  + + V D+NDN P  F   A++ NI   S LAQ+   ++   A+DPD   N  ++Y +T G+DL
Sbjct:  251 QSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVP-SKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDE------------GCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPA-FTSNAYTANI---SELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL 470          

HSP 14 Score: 49.6766 bits (117), Expect = 3.784e-19
Identity = 32/120 (26.67%), Postives = 56/120 (46.67%), Query Frame = 2
Query: 1235 VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++E+  + +   I   +D D G N  VD  +  G     F L  +    G  +  +   +  DRE    +Q+ +  +DRGTP L     I + I D N+ +P F + +Y  +++EN+  G
Sbjct:  104 IRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVIT-KKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPG 222          

HSP 15 Score: 93.2041 bits (230), Expect = 3.827e-19
Identity = 104/406 (25.62%), Postives = 174/406 (42.86%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            FS++ STG +     +D E      F+ +   +     +      +NV T+ +  D+ P F    Y   + E V  G  +    A+  D   N   +Y +   + T      +   +I IN  +D E +  Y   ++A    + PL    T+ I VLD NDN P FS     V I    +VG+VV N  AVD+D+G  G VRY+       +     +I++ +G IKL R L   +  Q +++ + ASD GS P+  ++T+ +H+    N  P   ++S        +V  +Q L   F  +   D D G N ++   +  G E           G  +Y     +   + +   + + +  +D G P  +    +T+ IQD N+    F    +   V+ENS+ G
Sbjct:  684 FSIDSSTGVISTLASLDHE--VEEFFSLIISAKDGGNKYAAKTAVVNV-TVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS----NAEGLLWINSTSGVIKLARKLTDGDETQ-YTVQVLASDSGSPPQ--HSTMTIHITLSINHPPKFTLSSY-----VTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFG---IFPGGKLYI---RKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPG 1066          

HSP 16 Score: 87.8113 bits (216), Expect = 1.824e-17
Identity = 69/257 (26.85%), Postives = 124/257 (48.25%), Query Frame = 2
Query:  830 ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++V D+NDN PVFS+  Y + + E ++ G  V  + A+D D G   +  Y    +   + +  F+I++ TGE+ L + L+ +     ++L ++A+D  +      A + + + D N+QRPV         + D+  N+ E+  + S    +  SD DIG N  +   ++ G  A  F +   ++  GR I      +  D E    +++ +   D G   L++   +TV + DVN+ +P F  Q  T+ V EN   G
Sbjct: 1147 VTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFY---SLVSGTGMDKFFINSSTGELHLSKTLD-RETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVF-------PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDV---ESATGRLIVA----KSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTG 1385          

HSP 17 Score: 86.6557 bits (213), Expect = 4.598e-17
Identity = 81/263 (30.80%), Postives = 121/263 (46.01%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD----DLVYIDAIIGDLRARQSI-REGH--YLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDRE      L +   D+G P S++    V I +TDVNDN P    N     + E  +    ++ Q+ A DPD G+NGTV + I               N    F +D  SG +T  K LDRE + S  + I   D G    T    +T+T++D NDN P++ +     T     S+ A    ++   A+D DS  N  ITY ++  D     L  ++   G L  +  + RE    Y   ++A D+G+P L + +K+ L IS
Sbjct:  383 LDRELVPFYNLTLNVTDKGVP-SRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQN-GSYVLQLNATDPDEGDNGTVSYSIT------------GGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGA---TVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTIS 628          

HSP 18 Score: 83.1889 bits (204), Expect = 5.308e-16
Identity = 108/408 (26.47%), Postives = 173/408 (42.40%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNV 1567
            D ++   F L   TG L    ++DRE     SFT L  D    +L   V ++     +TI D+ND+ P F    Y   I E    G  + + TA+D D   N V +Y + G N+  N +  +   +I  + +LD+E +  +   + A D G         + ++VL+  DN PVF  + Y   + EN   G +V  V A   D    G + Y      DP+ L  F + +  G IK+   ++ +  AQ + L + A  G   P    ATV + + D N+  P  + +S+     D      Q + +  A+    D D G N  V   LT  AE     NS +        ++  R      ++ + V++L SD G+P       +T+ I       P+F   +Y  +V
Sbjct:  573 DAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVE-----LTISDINDNAPVFYPVEYFASIMENEPPGKLLQV-TATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKN--GSISYAIVS-GDPTNL--FLVDSTGGIIKINGDMDREEKAQ-YLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSV-IVDIDGTWLVGQVVYNAAAV----DLDAGKNGLVRYQLTSNAEGLLWINSTS------GVIKLARKLTDGDETQYTVQVLASDSGSPP--QHSTMTIHITLSINHPPKFTLSSYVTHV 955          

HSP 19 Score: 77.7962 bits (190), Expect = 2.300e-14
Identity = 81/284 (28.52%), Postives = 127/284 (44.72%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETL-PMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV------------TEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            FFI+   G L  +  LDRE      L+V A D     +  +T  + IT+ D ND  P V       V   E+ L    +  + A D D+G+NG +++ I             + N   +F ++  +G L + KSLD E    Y L I   D G   L+S   +T+ VLD+NDN P +  QPV     +T +  +     +    ASD D+  NA+I + +            +   ++  I AI  DL    + R+   L+ ++A D G+P LST   I + ++
Sbjct: 1207 FFINSSTGELHLSKTLDRETTSSYNLVVKATDASNA-NLYSTAKIEITVGDSNDQRP-VFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS------------NGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVT----LTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAAI--DLETMPAGRDSFQLV-VMATDQGSPKLSTRKSITVQVT 1469          

HSP 20 Score: 68.1662 bits (165), Expect = 2.089e-11
Identity = 74/275 (26.91%), Postives = 119/275 (43.27%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            LF ++   G L T + LDRE        VLA D G+P+   ++  V +TI+D+NDN P V  P +      E   P  L Q+ A D D G N  + + I            I  N    FSID  +G ++   SLD E  + + L I   D G         + +TVL+  DN P +   +    N T    + +   +    A+  D   N +I+Y +  GD  +L  +D+  G ++    +    +  YL+ ++A       LS +  +N+ +
Sbjct:  579 LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQ-LMSSVKVELTISDINDNAP-VFYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDI------------IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMY---NFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEV 834          

HSP 21 Score: 61.2326 bits (147), Expect = 2.188e-9
Identity = 62/213 (29.11%), Postives = 96/213 (45.07%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPK----WFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD 2340
            LDRE  D  +L + A D+G P +      + ITI D ND+ P       L  + EN +     L ++ A D D G NG +++ I          + I  N   IF +D  +G +   ++LD E  +SY   ++  D G P    +  +T+ VLD NDN P+    +  P      I +++ L  +  I     +D DS  N+     +T GDD
Sbjct:  164 LDRETTDFYQLNITATDRGTP-ALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSIL-RVSAADRDSGSNGDIKYAIDW--------DAIQSN--SIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLI-NTNIAYILVTDKDSNTNSQTELKITNGDD 363          

HSP 22 Score: 58.151 bits (139), Expect = 2.127e-8
Identity = 74/274 (27.01%), Postives = 119/274 (43.43%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQI--QARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEIS----GNLTIY--KSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQ-PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV----TEGDDLVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPN 2445
            F  +   G + T   +DRE   +I L +  ++   P +Q  +  V +   D+NDN P    P         E++ +  T     A DPD G NGTV + I   ++            T  FS+   +      L +   K LDRE  D Y L I   D+G P L     I +T+LD ND+ P + Q     S    TK  ++    I+   A+D DS  N +I Y +     + + +  +D+  G +R +Q++    +  Y   ++A+D G P+
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLN---PSNQPISVQVQVD--DINDNEPRF--PTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDN------------TATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVS----ILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPS 292          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 141.739 bits (356), Expect = 5.391e-55
Identity = 120/419 (28.64%), Postives = 191/419 (45.58%), Query Frame = 2
Query:  347 YDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVI-NALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +  G     F+L+  TG + +++ +D EQ    +   +  DR    LT     D    +I + D+ND+ P F+ S YQ ++ E    G ++S   A+D D   N    + +   ND    T      +I I  + DYE +  Y  T+ A D G+P       + I + D+ND+ PVFS   Y   I E+ ++G  V  VTA D+DSG  G++ YR   G V+       F I   +G I++   L+ +     +SL +EA DGGS  +     V + L+D+N+  P+      GP    F V E+ +       +  +D D   N +V   L+   + F ++ S       + TL+     D E  + + V +   D GTP  ++   + V + DVN+  P+F K  YT  V EN   G
Sbjct:  310 FTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLT-----DTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGTQVS---ATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVK-----GAFNIDANSGSIRVSSELD-RETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ----GPYV--FRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTST-----GLITLKTQ--LDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAG 701          

HSP 2 Score: 92.8189 bits (229), Expect = 5.391e-55
Identity = 87/288 (30.21%), Postives = 136/288 (47.22%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT-EGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDD 2523
            F +D++ G + T   LDRE      L + A D G      A TTV I+I D NDN PT   P +  + E+  T    + Q+ A D D+G NG V + I            I  N+   F +D  SG L++  +LDRE I SY L +   D G PQ +   +I ++VLD+NDN P+ F+    S  I   + +     ++  +  D D   N  IT  ++ EG D   ID+  G + ++  +       Y + + A D G+P+ S   ++ +         T+IN++D+
Sbjct:  733 FAMDRFTGEITTRVPLDRETIASYSLTINA-DDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPT-GTRVGQLTATDRDIGPNGAVTYAI------------ISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPR-FEKSLFSGEIREDASV--HSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKI---------TIINVNDN 993          

HSP 3 Score: 151.754 bits (382), Expect = 5.906e-53
Identity = 116/417 (27.82%), Postives = 191/417 (45.80%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLS-----YFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            G +   F+++ ++G + ++  +DRE     S     R   +             I +QD+ND+ P F +  Y  ++SE+   G++I    A+D D   N    Y +    D F+I  S  L + +   LDYE +  Y  T+ A D G P       + + V D+NDN P F++  Y   + EN   G  V  VTA D DSG  G++ Y        S+LS      F +  +TGEI  +  L+ + IA  +SL I A DG  V  +   TV + + D N+ +P       GP++  FN+ E+    +    +  +D DIG N  V   +  G    +F+L     +       L      DRE    + + +  SD G+P+ +    I V + DVN+ +PRF+K  ++  + E++++
Sbjct:  520 GNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEAR---DGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGL-ITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISY--------SILSGNENMAFAMDRFTGEITTRVPLDRETIAS-YSLTINADDGSLVRFMAATTVNISIADENDNQPTF----TGPSR--FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGI-------LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASV 909          

HSP 4 Score: 75.8702 bits (185), Expect = 5.906e-53
Identity = 80/274 (29.20%), Postives = 131/274 (47.81%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGT-VRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID   G + +   LD E     +L V A D G P S++AT  V ITI +VNDN P+ ++P ++     +  +   + ++ A D D    GT + F I            ++ N    F ID+ SG +++ K LDRE   +Y L +   + G    +     T+ VLD+NDN P  F P +++ ++     L   Q +    A+D D   NA +TY ++ GD   + ++   G +  ++ + RE    Y +++ A D+G P+ S    I L I
Sbjct:  941 FTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSP-SKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSD----GTPLTFDI------------VEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP-VFNPGSYAKSLHEN--LPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTI 1193          

HSP 5 Score: 157.147 bits (396), Expect = 7.699e-53
Identity = 124/411 (30.17%), Postives = 196/411 (47.69%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM----HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININS-LGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            F +  +TG +   + +DRE     S   TA+D  +   +    I      +TI D+ND+ P+F++S Y + ++E    G  I    ASDPD   N   TY +    HG  + F I  S    + V+  +D E   +Y  T+ A D G+PP      +AI+V D NDN P+F+  E    I E   +G  VA VTA D D G   QV Y   +       S F I+   G + +++ +N + +   ++L I ASD GS        + V + DVN+  PV N  S +G      +V+EN    +    +   D D+G NA +   +  G   + FK++++  V    I T  P    D E  S + + +  +D    K T +  +T+++ ++N+ +P F +QNYT +V ENS
Sbjct: 1146 FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAI-----TLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHG--NAFRID-STTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD----TSAFAINAMNGVLTVKKEINRETVPT-YTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIG------SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV----IMTTTP---LDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENS 1527          

HSP 6 Score: 70.4774 bits (171), Expect = 7.699e-53
Identity = 74/268 (27.61%), Postives = 121/268 (45.15%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNI--TTKSVLAQDQRIIIAQASDPDSRPNANITYHV--TEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLST 2454
            F IDQ  G + TA++LDRE      + V   D G P   +  T V I I D NDN P   +               F  ++ A D D G N  + + +               +R   F I   SG +T+ + LDRE   +Y L I   D G P   S   I +TV+DIND+     +P+ +S+++  + +    ++  ++   ASD D+  NA +T+ +   E   +  +D   GD+  +  +   ++  Y +++   D GNP+LS+
Sbjct: 1560 FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNP-PLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL---------------SRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDH-----RPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSS 1806          

HSP 7 Score: 142.895 bits (359), Expect = 7.507e-52
Identity = 111/378 (29.37%), Postives = 176/378 (46.56%), Query Frame = 2
Query:  482 TIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRD--IYTLQPN-------RVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            T FVP+      IT+ DVND+ P FA S Y+  + E V VG  +   TA D DV  N   +Y +    DT   T  +   +    A D ET+ +Y+  L A D G P   G  T+ I +LD+NDN PVFS  +Y   + E+  +G  +  VTA D D+G    +RY F      +    F +   TG + + R L+ +  +  ++L +  +D GS P    + + +++ D+N+  PV       P+     VKEN    +    +  +D D   N         GA  F +     +KG D  ++T+  +       +  D E  + + + +   DRG P      ++T+ I+DVN+ SP F   NY+  + E++ IG
Sbjct:  150 TTFVPL------ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVS-GDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF---TSGNTNHAFTLDAVTGVVTVSRSLDFEQRSS-YALGLSVTDRGSPPLTDTSHLLINVNDINDNPPV-----FSPSAYQSRVKENTPAGTQ---VSATDRDSSTN---------GALVFGI-----IKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIG 494          

HSP 8 Score: 80.8777 bits (198), Expect = 7.507e-52
Identity = 83/299 (27.76%), Postives = 138/299 (46.15%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF-LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYISSKS----TFS--TVINISDD 2523
            K  F ID   G++R ++ LDRE      L V A D     S++++T V I + D+NDN P    P   +V E+    P   + Q+ A D D   NG VR+ +               + T +FSI+  +G +T+   LD E    Y++ +   D G P  +S+  + + V D+NDNPP++ + +      T    LA    +    A+D DS  N  I+Y +  G++     +D   G++  R  + RE    Y + + A+D           +N+ I+ ++    TF+  +  NIS+D
Sbjct:  523 KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSS--PGHQIGQVAATDADDSSNGDVRYALS--------------DNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLY---TCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISED 801          

HSP 9 Score: 136.732 bits (343), Expect = 5.000e-46
Identity = 119/421 (28.27%), Postives = 191/421 (45.37%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQR-IDREQVCPTSFT-----ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTL---AISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            DG     F+++ STG +    R  DRE       T     A +RC    T+ V        I ++D ND+ P+F  + Y   I E      ++++ TA+D D   N   TY +    + F +  S    +  +  LD+ET+ +Y   + A D       G  T     I+V D+NDN P F+   YK  + E+  VG +V  +TAVD+D G+  ++ Y           SYF + +  G I+ +   + +  A  + + + A DGGS  + G ATV + + DVN+ RPV        A+   +V E+  + +    +  SD D G NA++    T G  N   +    V G  + T+  +R  D E  S + + +  +DRG+P LT    + + + D+N+  P F    Y   V EN+  G
Sbjct:    5 DGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVV--------IDVKDENDNAPEFPLNSYVFNIRENTPAA-QVAIVTATDRDSGTNAAITYSLFSGENKFMMN-SKTGEIRTVTPLDHETKDSYTMRISAFD-------GKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGD----TSYFTVDSQ-GVIRTKGAFDRETKAS-YQVALRAQDGGSPSRSGQATVEIEILDVNDNRPV-----FSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFT-LDAVTG--VVTV--SRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAG 392          

HSP 10 Score: 67.781 bits (164), Expect = 5.000e-46
Identity = 71/274 (25.91%), Postives = 122/274 (44.53%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +F ID   G +  A   D E   + +L V A D+G P  +  T  V I I DVND+ P V +P     +  E T +   +  + A D D G  G + + +            I  N    F+ID  SG++ +   LDRE   SY L +   D G    +S   +T+ + DINDN P +  P     + ++    +   +I    A+D D   N ++ Y +++  D+  I+   G +  +  +   ++  Y++ + A D G P+ S+   + + +
Sbjct:  420 VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVP-VKYDTAQVTIFIEDVNDHSP-VFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRL------------ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESS----SPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMV 675          

HSP 11 Score: 117.087 bits (292), Expect = 2.221e-43
Identity = 113/412 (27.43%), Postives = 193/412 (46.84%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWIN----VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYF--MHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPA--KKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            F ++ +TG++ +   +DRE +   + T  A D         VP   W++     IT+ D ND+ P FA +     I E V +G R+++ TA+D D E +N   ++  + G    F I   N + L V   ++ ET   Y  T+ A D G P +  ++ L + V D+NDN PVF+ + Y   ++EN+     V  V A D D G    +RY      D      F I++ +G I     L+ +  +Q + L + A+D     K       V ++       VIN+N + PA  ++++     +   +  +++ VS  D      +   +  G ++ K S  Q  +   I T     V DRE+ S + +++  +D G P L+    +T+KI D N+ SP+F   +Y+ ++ ENS
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASYNLTISAKDSG-------VP--PWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRD-EGSNAQVFYSIVRGDTSAFAINAMNGV-LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEK---RFKINSTSGVIMTTTPLDFEEKSQ-YGLEVTATDSKYTAKTN-----VTIR-------VINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSIVGGKDSDKFSIDQ--RSGIISTAD---VLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENS 1630          

HSP 12 Score: 78.5666 bits (192), Expect = 2.221e-43
Identity = 69/211 (32.70%), Postives = 105/211 (49.76%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQ--VKENE--ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPD 2292
            F I    G +  A  LDRE     +L + A D G P  Q ++ T+ +T+ D+ND+ P +IN   L+  V+EN+  ET  M   +I A D D G N  + F +   E K             +F++D  +G+++    LDRE    Y L I V D+G P L+S+  + + V+D +DN P+ FQP  +  N+T    L +   I+   A D D
Sbjct: 1662 FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTP-PQASSITIRVTVIDINDHRP-LINSSSLRGSVRENQPKETHVM---RILASDADTGLNAELTFSLLSNEHK------------SVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPR-FQPTEY--NVTISESLPRGASIVQVTARDID 1852          

HSP 13 Score: 122.094 bits (305), Expect = 5.488e-28
Identity = 111/410 (27.07%), Postives = 179/410 (43.66%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            G   K F +  ++G ++    +D E+    S   L+    +       +  I VI   ++ND  P F +  Y   + E       +   +ASD D       +Y + G  D+   +      +I   + LD E    Y   +   D G PPL     + I +LD NDN P F    Y   I EN+        + A D D G   ++ Y   +         F I   +G I L + L+ +N +  + L I+A D G+ P+    T+ V + D+N+ RP+IN +SL  +     V+ENQ   +H   I  SD D G+NAE+   L        F L N+      DI T  P    DRE  + + +R+  +D+G P L++  ++ + + D ++  PRF+   Y V +SE+
Sbjct: 1454 GNDEKRFKINSTSGVIMTTTPLDFEE---KSQYGLEVTATDSKYTAKTNVTIRVI---NLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRND------AFMIGASSGVITLAQPLDRENKST-YDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGS-----VRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTG----DISTKVP---LDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISES 1836          

HSP 14 Score: 113.235 bits (282), Expect = 3.120e-25
Identity = 109/410 (26.59%), Postives = 186/410 (45.37%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F+++  TG++     +DRE +   S T  A D   +       ++     I+I D ND+QP F     +  ISE    G R+   TA+D D+ PN   TY +   N  ++F +   + + L V + LD ET  +Y   + A D G P      ++ +SVLD+NDN P F +  +   I+E+A V   V  V   D D G  G +     G+  D      F I + TG +  +  L+ +  A  + L + A DGGS  K   A V + + +VN+  P      + PA+   ++ E+  + +H   +  +D D G     D        +FK+  S  +       +   +  DRE  +++ + +  ++ G+   +     T+++ DVN+ +P F   +Y  ++ EN  IG
Sbjct:  733 FAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVN-----ISIADENDNQPTFT-GPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGI-LSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSD-----NFTIDS-TGFVLSKTPLDYETTAA-YQLTVTARDGGSPSKSATAQVKITIINVNDNVPSF----VSPAQV-TSIPEDVAINTHVVKLNATDSD-GTPLTFDIVEGNAGSSFKIDQSSGL-------ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIG 1115          

HSP 15 Score: 110.923 bits (276), Expect = 1.450e-24
Identity = 102/363 (28.10%), Postives = 155/363 (42.70%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHG-FNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQ---TVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ITI +VND+ P F        I E V +   +    A+D D  P  +    + G    +F I  S+ L + V   LD ET  NY   + A + G           I VLD+NDN PVF+   Y   + EN  +G+ VA VTA D D G   +V Y    V D    S F ++  TG +  +R L+ ++ A  +SL + A D G   +   A + + + D+N+  P         +K    V EN    S+   +  SD D G N  V   +  G     F++ ++    TV G          V DRE  + + + +   D G P   +   + + + D N+ SP F     +  + E  +IG
Sbjct:  985 ITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP--LTFDIVEGNAGSSFKIDQSSGL-ISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYEL-SVGD---TSKFEVNPATGLVTTKRPLDREDQAS-YSLRVTAMDHGKPSQSAVAAITLTINDLNDNSP-----QFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVG----------VVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIG 1324          

HSP 16 Score: 98.9821 bits (245), Expect = 7.295e-21
Identity = 84/264 (31.82%), Postives = 123/264 (46.59%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLT--QIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNP 2442
            F IDQ  G +  A  LDRE      L+V A + G  + ++      I + DVNDN P V NP     K   E LP+  T  ++ A D D GEN  V +             ++    T  F ++  +G +T  + LDRE   SY L +   D GKP  +++ AITLT+ D+NDN P++ Q       +T     A    I+   ASDPD+  N  +TY +  G+  +   ID+  G +     + RE    Y + + A D+G P
Sbjct: 1042 FKIDQSSGLISVAKRLDRETTANYTLVVRATETGS-QGESVYNNATIRVLDVNDNAP-VFNPGSY-AKSLHENLPIGQTVAKVTATDRDEGENAKVTY-------------ELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQ---SKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVP 1286          

HSP 17 Score: 83.5741 bits (205), Expect = 3.629e-16
Identity = 78/274 (28.47%), Postives = 124/274 (45.26%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG-DDLVY-IDAIIGDLRARQS---IREGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +F     G +RT    DRE     ++ + A D G P S++   TV I I DVNDN P   +       + +  +   +  + A D D G N  +R+                 N    F++D ++G +T+ +SLD E   SY L + V D+G P LT    + + V DINDNPP  F P A+ + +  ++  A  Q      A+D DS  N  + + + +G DD V+ ID   G +   +S     +  Y + + A D G P      ++ ++I
Sbjct:  214 YFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSP-SRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS------------GNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-VFSPSAYQSRV-KENTPAGTQ----VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFI 468          

HSP 18 Score: 80.4925 bits (197), Expect = 3.447e-15
Identity = 66/223 (29.60%), Postives = 104/223 (46.64%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD 2340
            F ID   G +    ++DRE      L + A D G P    +T  V IT+ D NDN P   +       +   ++   +  + A D D G N  V + I R +             T  F+I+ ++G LT+ K ++RE + +Y L I   D+G P +TS + +T+ V D+NDNPP  F   ++  ++   S  AQ   ++   A D D   NA + Y +  G+D
Sbjct: 1251 FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVP-PWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD-------------TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP-VFNSQSYIGSVRENS--AQSTSVLTVAADDSDVGANAVLRYSIISGND 1456          

HSP 19 Score: 77.0258 bits (188), Expect = 3.969e-14
Identity = 86/319 (26.96%), Postives = 146/319 (45.77%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIF--VPID--YWINVITIQDVNDHQPKFAESYYQIQISE-AVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDI 1297
            GK    FS+++ +G +  A  +DRE V      +L   Q+ +T     P+    W+  I I D ND+ PKF  S Y   I E +    +   L  A+D D   N   TY +   ND F I  S+ + + +   LD E +  Y   + A D G PP   + T+ ++V+DIND+ P+ +    +  ++EN      V  + A D D+GL  ++ +     +  SV   F +   TG+I  +  L+ +  A  ++L I  +D G+      A V + + D ++  P            ++NV  +++L    +I+ V+  DI
Sbjct: 1554 GKDSDKFSIDQRSGIISTADVLDRELV------SLYAIQVRVTDAGNPPLSNLTWV-TIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKL-AATDADEGTNARITYNLS-RNDAFMIGASSGV-ITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSV---FTLDNTTGDISTKVPLDREQQAV-YTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQ-------PTEYNVTISESLPRGASIVQVTARDI 1851          

HSP 20 Score: 62.3882 bits (150), Expect = 1.075e-9
Identity = 56/168 (33.33%), Postives = 87/168 (51.79%), Query Frame = 1
Query: 2026 FSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-REGH--YLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISD 2520
            FSID+ SG ++    LDRE +  Y + + V D G P L+++  +T+ +LD NDN PK F   ++S++I   S  A         A+D D   NA ITY+++  D  + I A  G +   Q + RE    Y + + A D+G P  ++ I I +         TVI+I+D
Sbjct: 1560 FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPK-FDSSSYSSSILENS--APSSFSFKLAATDADEGTNARITYNLSRNDAFM-IGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRV---------TVIDIND 1714          

HSP 21 Score: 57.3806 bits (137), Expect = 4.098e-8
Identity = 55/194 (28.35%), Postives = 75/194 (38.66%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMD 952
            F +  S+G + +AQ +DRE           R          I   + VI   D+NDH+P    S  +  + E       +    ASD D   N   T+ +         T  N    I     LD E Q  Y   +   D G P L     + I V+D +DN P F   EY V I E+   G  +  VTA D+D
Sbjct: 1662 FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVI---DINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 123.25 bits (308), Expect = 5.962e-45
Identity = 109/406 (26.85%), Postives = 183/406 (45.07%), Query Frame = 2
Query:  380 LEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEP-NNVCTYFMHGFNDTFNITFSNLLYLIVINALDY-ETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            L  STG L +   +D E++     T     Q +     P+  + NV I + D+ND+ P+F  S   +++ E   +G+     +  D D      V    +      FN+  SN   L +   +DY  +  +Y   + A D G PP      L + V+D+ND  PVF    Y   + E       +  V A D+DSG  G++ Y F    D S           G+I ++  L+ ++I ++++L + A D G+  +   A V V + DVN+  P         A   F VKEN+ + ++   +  SD D G N  V          F + + QT K      +  ++V DRE  + +   ++ +D G+     + ++TV ++DVN+ SP+F K  Y+V V+E+  +G
Sbjct:  752 LINSTGTLYLQSEVDHEKIPSLYLT----VQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLD-SNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGL----RNGGKIFIKSKLDREDI-EEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNP-----HFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQF-IVDKQTGK------ITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVG 1135          

HSP 2 Score: 77.411 bits (189), Expect = 5.962e-45
Identity = 72/230 (31.30%), Postives = 109/230 (47.39%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQL-TSIEAITLTVLDINDNPPKW---------FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            F ++Q  G L   + LDRE   +  L V+A D+G  +S    T + I + DVNDN P  IN  +   K   E LP+   +  + A D D G+NG VR+ I            ++ N    F I+E +G ++  ++LD E  + Y+L +   D GK Q  TS + +T+ V D NDN P +         ++ V  +TN+TT             +A D DS  N+ I Y +
Sbjct: 1166 FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFIN--ETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI------------VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTT------------IKAHDDDSGLNSRIWYTI 1369          

HSP 3 Score: 137.117 bits (344), Expect = 1.017e-43
Identity = 117/413 (28.33%), Postives = 190/413 (46.00%), Query Frame = 2
Query:  365 LKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--DRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA--LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            L +F+++ S+G +  A  +DREQ+     T L  DR    L+     D    ++ + D ND+ P F +S Y   + E    G  +    A DPD+  N++  Y +   N  F   F +    +V N+  LD+E Q +Y   + A D G      N T+ +S+ D+NDN PVF    Y V   EN  +G+ +  + A+D DS  F   R+   Q     V S       +G I L ++L+ +    ++ L ++A DGG    V  A V + + DVN++ P+        A+ +F ++E+   +S    +     D G NAEV   ++ G  +N  L NS         TL      D E      + +   D+GTP L     +T+ + D+N+ SP+F   +  V + E++ IG
Sbjct:  438 LHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLS-----DNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPF---FLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSV----DGSGLITLAKLLD-RETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPI-----FSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTG-------TLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIG 823          

HSP 4 Score: 59.6918 bits (143), Expect = 1.017e-43
Identity = 71/267 (26.59%), Postives = 114/267 (42.70%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDK-IELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI-REGH--YLIKLVANDNGN 2439
            S    LF +D   G L    ++D     +   L V A D G P  +++T  + + + DVND  P V           E T P   + ++ A D D GENG + +             K+D ++  + +     G + I   LDRE I+ Y L ++  D G P+ +S   + + V D+NDN P  FQ  +++  +     +A    +    ASD D   N ++TY          +D   G +   Q + RE    Y+  +VA D G+
Sbjct:  848 SNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSP-PRSSTAMLELKVVDVNDYSP-VFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISY---------AFDSKVDTSKFGLRN----GGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPH-FQQASYAFFVKENEPVA--TYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGS 1096          

HSP 5 Score: 95.9005 bits (237), Expect = 1.946e-40
Identity = 103/394 (26.14%), Postives = 169/394 (42.89%), Query Frame = 2
Query:  503 YWINVITIQDVNDHQPKFA-ESYYQIQISEAVQVGYRIS---LRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKEN--AMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRP----------------------VININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGR---DIYTLQPNRVFD-REVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            Y I  I I ++ D  P+F  ++  ++ I E  +VG  I+    R +SD  V  + +       F   +   F+ ++ +   +ALDYE+  N++  LVA   G   L G   L I+V+D NDN P F        + E+  A     V  VTA D+DSG  G+V Y      +  V   F I + TGEI   ++L+ +  A  F L I  +D G  PK     V V + D+N+  P                      V+  ++   ++  +N+K   T       +  +D D G NA++         +F ++NS  +  +   D   +   R  D R  DS  Q+ +   D+G P     +   V ++ +    P+F+  +Y   V EN+ +G
Sbjct: 1945 YGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAF---YVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRETTAS-FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKY-------SFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMG 2320          

HSP 6 Score: 89.7373 bits (221), Expect = 1.946e-40
Identity = 85/297 (28.62%), Postives = 135/297 (45.45%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT--EGDDLVYIDAIIGDLRAR-----QSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRV 2535
            F I Q  G +     LD E   +  L+V AID   P S+     V+I ++DVND  P       +   +  E +P+   +  + A D D G NG V F IQ  +DK              F+ID  +G +   ++LD E I ++ + +   D+G P + +  ++T+ VLD+NDNPP +  P  +   +     L  + R+    A+D DS  NA +++ V    G  L  ID   G L        ++     Y + + A D GNP LS+ I I + ++ +  +    N  D +F V
Sbjct: 2350 FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAP-SKPVRVPVYINVSDVNDEKPVFGQSGYM--AQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS------------FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLEN--LPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDV 2629          

HSP 7 Score: 120.939 bits (302), Expect = 4.232e-36
Identity = 115/412 (27.91%), Postives = 200/412 (48.54%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVE-PNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLA------ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD-GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE----NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRG---TPKLTTEEEITVKIQDVNEFSPRFKKQNYT 1558
            F +++ TGK+  +Q +DRE      F+  A D           +D     + ++DVND  PKF+++ Y + ++E + VG  +    A+D D + PN+  TY +      F++     + L +++ LD E    +   +VA D G     GNQ+L       I+VLD+NDN+PVF  +     + E   +G VVA V AVD D G  G+VRY+   + + +    F I+  TG I   R L+ + +   + L + A+D G    K  Y  V ++++D N+ RP  + N +        + EN  + ++   I   D D G+N+ +    T+ ++    +FK+ NS+T        +Q     DRE  S + +++  +D+      +L     + + IQD+N+ +P+F  +N T
Sbjct: 1062 FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPR-----VDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGV-LTLVSPLDREVTHRHILHVVASDKG-----GNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYK---IVNGNTDGTFKINETTGVISTLRALDFE-VTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITW-----IYENVPINTNVTTIKAHDDDSGLNSRI--WYTIDSQSPRAHFKI-NSET------GLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLT 1444          

HSP 8 Score: 50.0618 bits (118), Expect = 4.232e-36
Identity = 70/275 (25.45%), Postives = 109/275 (39.64%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIA-QASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F +D   G L+    LD E   +  L + A D G P   +      + +   ++ P    +     V EN+ T    + ++ A D D G N  + + I           ++D+     FSID+ SG +     LDRE  D+Y L +       P   S  ++ + V+D NDNPPK+  PV     +T K       R+I      D D   N  + Y +  G  D    I    G+L     + RE    Y + + A D   P  +    I ++I
Sbjct: 1484 FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPT-GTSVVKVTAYDRDSGSNAELTYSIPS-------GVEMDK-----FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV-----VTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFI 1740          

HSP 9 Score: 84.7297 bits (208), Expect = 2.900e-35
Identity = 92/325 (28.31%), Postives = 142/325 (43.69%), Query Frame = 1
Query: 1633 TIAIPTRSKSKCLFFIDQYMG--NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET---LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAH-------STNITTKSVLAQDQ------------------RIIIAQASDPDSRPNANITYH--VTEGDDLVY-IDAIIGDLRARQS----IREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTF 2496
            T +I + +K +  F++D + G  ++ +A+ LD E      L ++A  QG   S      + I + D NDN P   +P  +  +  E+T    P F+ ++ A D D G NG V + I               N   +F+ID  +G +T  K LDRE   S+ L I   D G P  ++   + + V D+NDNPP  F P++         T     SV+A D                    I+   A+D DS  NA I Y   +T  D + Y IDA  G + AR++    IR+    I + A D G P     + + + I+ +  F
Sbjct: 1996 TYSIISGNKGRA-FYVDPFTGVISVASADALDYESTKNFRLHLVATPQGW-VSLNGYMILDINVIDRNDNSP-AFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWT------------GNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP-LFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKF 2304          

HSP 10 Score: 83.5741 bits (205), Expect = 2.900e-35
Identity = 98/414 (23.67%), Postives = 167/414 (40.34%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVP-IDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYT-VNVSENSTIG 1588
            G  +  FS+++ +G ++    +DRE+   T F  +    +     V      INV+   D ND+ PKF      +++ E        +L T  D D   N    Y  M G  D       +   L     LD ET+ +Y+ ++ A D   P       + I + D NDN PVF Q  Y   I E    G  + N+TA D DSG  G + Y             + I + TG +         +I Q+++    A D G  PK+    V + ++D NN  P            + ++  N +  +   ++  +D D   +   +  +T   ++ K S S  V   +  +++ +  F         + ++  D G+P L     + + I ++ +  PRF  Q    V++ ENS +G
Sbjct: 1583 GVEMDKFSIDKHSGLIVTNSILDREK-KDTYFLTVHATGVSYPFRVSSTSVRINVM---DRNDNPPKFISPVVTLKVPENSPARLIYTL-TVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSN----DTYGVYSIDSRTGIVYSAARFET-SIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAP-----QFTKTPYEVHIFPNTSASALVTMVTATDAD--TDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVG 1979          

HSP 11 Score: 107.842 bits (268), Expect = 1.586e-34
Identity = 117/463 (25.27%), Postives = 198/463 (42.76%), Query Frame = 2
Query:  227 EFNRNIHYA--VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYY---QIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL---LYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDP-SVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            EF+ N+ Y+  + E IDVG  +  ++          +  + +         F +  +TG ++   R+D E     S+  + + + + +        I  I + DVND+ P    SY      Q++E   +G +++  + SD D   N      + G +  F++ F  L     + V  +LD ET  ++    V  D G PP    ++  I+V D+ND  P F +  Y+  + ENA V  +VA V AVD D G   ++ Y      +  S L +F I   +G I     L+ + I Q   L +   D GS P     +V V+L D N+  P  N +S      + ++ EN    S    +   D DIG N+ +   +      F L   + +       +  +R  D EV S +  ++  +D G    +    + V + D+N+  P F   +Y+V   EN+ IG
Sbjct:  171 EFS-NVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYE--AKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQ-VVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSY-----NASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGL-------VTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIG 615          

HSP 12 Score: 58.151 bits (139), Expect = 1.586e-34
Identity = 74/281 (26.33%), Postives = 121/281 (43.06%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRI----IIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDLRARQSIREGH----YLIKLVANDNGNPNLSTEIKINLYISSKSTFSTV 2505
            G +  A +LDRE  D   L V A+D G   S      V IT+ DVND PP          ++E+ + L + +  + A   D G N  V + I +             N   I  I+  +G L +   +D E I S  L +   D+G P L     +T+ V+DINDN P++     +S++I  +  L +D  I          D DS     +++ +      ++ +D+  G L   + I  G+    Y + + A D G+P  S+   + L +   + +S V
Sbjct:  653 GLITLAKLLDRETQDNYLLTVKAVDGGGQDS-VNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSV-IGHVHAISRDKGTNAEVVYSISK------------GNTDNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQF-----NSSSILVR--LPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPV 911          

HSP 13 Score: 136.346 bits (342), Expect = 3.348e-32
Identity = 120/419 (28.64%), Postives = 196/419 (46.78%), Query Frame = 2
Query:  380 LEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNI-----TFSNLLYLIVINA----LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGY-ATVFVHLKDVNNQRPVININ-SLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG----AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            LE + G +     +DRE+V   + T ++          P   +  ++ +QD+ND+ P F        +       +R  L  A D D   N+  +Y +   N  + F +     T  +L   +V+NA    +D E   +Y   + A D G P   G   L+I+V D NDN P FS   Y   I EN  VG  +  V+A D D G   +++Y      DP  +  F I   TG I     L+ +   + + + ++A D GS  ++   A V + + DVN+  PVI+++ +LG +   + V EN T+ +  A + VSD D G N EV+  L  G    +  F + N +++       +   +  DRE   HF ++ +C D+G P  TTE+   + + DVN+ +P+F +  Y   V EN+T+
Sbjct:    7 LEYNAGVITTKTVLDREKVSAYNLTIVE-------FSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAI--FGIHPTTGVIVNNVRLDYE-AKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGS---YQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI-------IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATV 404          

HSP 14 Score: 80.4925 bits (197), Expect = 2.857e-30
Identity = 86/261 (32.95%), Postives = 120/261 (45.98%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY-IDAIIGDL----RARQSIREGHYLIKLVANDNG 2436
            F ID++ G + T +ILDREK D   L V A     P  + ++T+V I + D NDNPP  I+P   L+V EN     ++   +Q  D D G N  V + I            +  N    F+I   +G L+    LDRE   SY L +   D   P  T+   IT+ + D NDNPP + Q +  S   T   +      I+   ASD DS  N NI Y ++     VY ID+  G +    R   SI++  Y    +A D G
Sbjct: 1589 FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPF-RVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ--DLDYGNNTKVLYSI------------MSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSS---TISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQ-EYNFFCIAKDQG 1830          

HSP 15 Score: 71.2478 bits (173), Expect = 2.857e-30
Identity = 108/420 (25.71%), Postives = 177/420 (42.14%), Query Frame = 2
Query:  368 KYFSLEESTGKLIIAQRIDREQVCP--TSFTALDRC---QIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFND-TFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPP-LCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPK---VGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT--LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            K FSL + TG L +   +DRE          A D+     +E   ++ I+       + DVND+ P F        + E + +G  ++   A D D   N    Y  ++G  D TF I  +  + +  + ALD+E    Y   + A D G        Q + I V D NDN P F +      I EN  +   V  + A D DSGL  ++ Y    +   S  ++F I++ TG I+    ++ + I++ +SL + A+D     +      AT+ + ++D+N+  P     +L        V E++        I   D D G    V+  + V  +  K S        D+ T  L+     D E    + + +  +D G+P LT+ +   V + DVN+  P F +  +   VSEN   G
Sbjct: 1164 KAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEIN-------VLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGV-ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWY---TIDSQSPRAHFKINSETGLIQTTHPIDREEISE-YSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNL------TYVMEDEPFNFQVTSITALDPDTGQGGNVEYRI-VSPDTGKFS-------LDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTG 1557          

HSP 16 Score: 120.553 bits (301), Expect = 2.109e-27
Identity = 102/360 (28.33%), Postives = 172/360 (47.78%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM---HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT--LQPNRVFDREVDSH-FQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            +++ D+ND+QP F  S Y ++  E  ++G  I    A D D  P    T F+      ++ F++  S L+ L  +  LD ETQ NY  T+ A D G         + I+VLD+ND  P+FS+ EY   I+E++    V+ +V A+  D G   +V Y   +    +++    +   TG + LQ  ++ + I   + L ++A D G+ P  GYA V + + D+N+  P  N +S+        + E+  +   F  + V D D GV   V   L        LSN  T+   D  T  L   ++ D    +  + + +   D G+P  ++   + +K+ DVN++SP F   +YT +V E +
Sbjct:  587 VSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRD-SPKFAITRFIIEQGNADEVFSVDGSGLITLAKL--LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIV----LINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSIL-----VRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSL--------LSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETT 925          

HSP 17 Score: 116.316 bits (290), Expect = 4.536e-26
Identity = 101/361 (27.98%), Postives = 157/361 (43.49%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTL---MSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDR-GTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + DVND+ P F    Y   + E       I    A+D D   N   +Y      DT      N   + + + LD E    Y   ++A D G P    +  + + V D+NDN+P F Q  Y   +KEN  V   +  V+A D D G  G V YRF      + ++ F +   TG+I   ++L+ +  A  +  +I A+DGGS P+V    V V ++DVN+  P         +K  ++V  N+ L    S   +I   D   G N+++   +  G + F L+    V    +  + P    DREV     + ++ SD+ G   L T   I + + DVN+  P F  +     V E   IG
Sbjct:  900 LKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFD-----TQVAQFIVDKQTGKITTSQVLDREAKAS-YVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF-------SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGV----LTLVSP---LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIG 1240          

HSP 18 Score: 91.2781 bits (225), Expect = 2.319e-25
Identity = 112/409 (27.38%), Postives = 175/409 (42.79%), Query Frame = 2
Query:  371 YFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIT----IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDV-EPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPS--VLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP-KVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
            +F +   TG +     IDRE++   S     + +     F   D   N  T    IQD+ND+ PKF  S     + E     ++++  TA DPD  +  NV    +      F++     + L +I +LDYE    Y   + A D G PPL   Q   + V+D+NDN P F++  +   + EN   G  V  VTA D DSG   ++ Y       PS   +  F I  ++G I    IL+ +     + L + A+ G S P +V   +V +++ D N+  P      + P      V EN      + +  V D D G N +V   +  G  +   +      GR    L      DRE  + +Q+ +   D   P  T    IT+ I+D N+  P F++  Y+  +SE
Sbjct: 1377 HFKINSETGLIQTTHPIDREEISEYSL----KVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV-SRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGV-LKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI-----PSGVEMDKFSIDKHSGLIVTNSILD-REKKDTYFLTVHAT-GVSYPFRVSSTSVRINVMDRNDNPPKF----ISPVVT-LKVPENSPARLIYTLT-VQDLDYGNNTKVLYSIMSGNTDGAFT-----IGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISE 1761          

HSP 19 Score: 43.8986 bits (102), Expect = 2.319e-25
Identity = 48/237 (20.25%), Postives = 91/237 (38.40%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGE--NGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIG 2367
            ++ ID   G + +A   +     +     +A DQG+                 N  P     P ++ +  N  +    +T + A D D  +  NG V +   R++D +        N T +F ++  +G++             + LYI+  D G P L     + + + +I D+PP++        +I   S +      + A+AS      +A +TY +  G+     Y+D   G
Sbjct: 1796 VYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNT-SASALVTMVTATDADTDKSTNGKVTY---RLDDSK--------NSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASS-----DAQVTYSIISGNKGRAFYVDPFTG 2015          

HSP 20 Score: 109.768 bits (273), Expect = 3.907e-24
Identity = 88/285 (30.88%), Postives = 129/285 (45.26%), Query Frame = 2
Query:  740 LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRML--CSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            LDYET+  +   + A D   P       + I+V D+ND  PVF Q  Y     E   VG +V NV+A D DSG  G+V +    +Q       F I   TG I+ QR L+ + I +   +++ A+D GS P     +V + + D+N+  PV  +    P   D  V EN  L S    I  +D D G NA +     +G     L       G     L  N  FD E  + +Q  +    +D G P L++   I V + D +E+ P F + +Y  +V  N+ IG
Sbjct: 2365 LDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWF---AIQSGDDKGSFAIDRKTGVIRTQRALDHETI-KTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV----PGPNDVQVLENLPLNSRLYEINATDRDSGANARL-SFTVIGGTGQGLFLIDKFSGW----LTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIG 2636          

HSP 21 Score: 75.485 bits (184), Expect = 1.196e-13
Identity = 79/280 (28.21%), Postives = 123/280 (43.93%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGE-PRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM---FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQ-LTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYID---AIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIK-INLYI 2478
            F +D+  G + T+ +LDRE        ++A D G  PR     T V + + DVND  P   +  K  V  NE+ LP+    LT I   D   G N  + + I                  K FS+++++G LT+   LDRE    +IL+++  D+G  Q L +I  I + VLD+NDN P +   +  +T  T    L     +    A D D   N  + Y +  G  D    I+    +I  LRA        Y++++ A D G     T  + + +Y+
Sbjct: 1062 FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPR--VDKTQVTVIVRDVNDCSPK-FSKNKYSVTVNED-LPVGSSLLTLIATDDDQQGPNSDITYMIVA--------------GPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVF---INETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYV 1320          

HSP 22 Score: 72.0182 bits (175), Expect = 1.430e-12
Identity = 98/440 (22.27%), Postives = 176/440 (40.00%), Query Frame = 2
Query:  329 KSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPN---NVCTYFMHGF-------NDTFNITFSNLLYLIVINALDYETQINYKT------------------------TLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGL-FGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK 1543
            K T+ ++  G     F+++ +TG++  A+ +DRE     SF  + R           +  + V+ + D+ND+ P F +   ++ I E  + G  ++   A+D D E     N+ +    G         D  + + + + Y   I   D   QI+YK                          + A D G+PP    Q   + V  I    P F    Y   + ENAM+G  V  V   D  +GL  G++ Y           +YF I   +G I + + L+ +   + F L + A D  +  K     V++++ DVN+++PV      G +       E   + +    +  +D D G N  V   +  G +    +       R    ++  R  D E      V +  +D G+P + T+  +T+++ D+N+  P F+
Sbjct: 2103 KVTYSIWT-GNEAGVFTIDSTTGEITTAKLLDRETTA--SFDLVIRGTDSGIPPKSTNCQVKVV-VTDLNDNPPLF-DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD---QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS------NYFRIGQRSGVISVNKPLDYET-KRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPV-----FGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFA-----IDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFR 2513          

HSP 23 Score: 68.5514 bits (166), Expect = 1.484e-11
Identity = 67/256 (26.17%), Postives = 117/256 (45.70%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYID---AIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINL 2472
            LDRE  D   L  + ID+G+P  +T   +  I + DVND  P    +  + +V EN  T+   +  + A D D G N  + + I    + R             F+ID  SG +T    LDRE I   +L ++V D+G P L+   ++ + + D NDN P +F   +++ ++   S        ++AQ  DPD   N+ I Y +   +   ++D    ++ + R      +  Y  ++ A D G  + +  + ++L
Sbjct:  347 LDRETHDHFFLKAVCIDKGDP-PRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENA-TVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLH--------WFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDP-YFNQSSYNASLFENSPSGSPVVQLLAQ--DPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSL 589          

HSP 24 Score: 55.4546 bits (132), Expect = 2.177e-11
Identity = 61/233 (26.18%), Postives = 101/233 (43.35%), Query Frame = 1
Query: 1639 AIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL----QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            +I T S  + +F I    G +     LD E      ++V A D+G     +++  V I + DVNDN P +     L    QV EN  T+   + ++   D D G+NG V   +          E  D   +  F +      + + +SLDRE  D + L  +  D+G P  T+ ++  + V D+ND  PK F    + T +   + +  +  + I  A D D   N+ + Y +
Sbjct:  210 SIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENA-TIGTQVARVSVSDADSGKNGEVNVTL----------EGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPK-FDRHTYETRVWENATV--NTLVAIVNAVDQDFGSNSELVYTI 428          

HSP 25 Score: 32.3426 bits (72), Expect = 2.177e-11
Identity = 36/160 (22.50%), Postives = 65/160 (40.62%), Query Frame = 2
Query: 1124 SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKG---RDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            S P   Y TV V+++D+N+  P       G + K    + ++        +   D D G N+     +  G     FKL + +   G    D+     +   DRE    + + +  SD G P       +++ ++D N+  P F   +Y+  + EN  +G
Sbjct:   36 STPPKSY-TVLVYVQDLNDNSPSF---VRGTSAKLVVFENDKDFRQKLIAV---DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVG 188          

HSP 26 Score: 68.1662 bits (165), Expect = 2.283e-11
Identity = 75/265 (28.30%), Postives = 121/265 (45.66%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNL 2448
            FF+D   G +  +  LD E        V A D G    ++   TV +++TD+NDN P V +P    V+  E T +   + Q++A D D  +    RF I++             N  ++FS+D  SG +T+ K LDRE  D+Y+L +   D G     +   + +TVLD+ND PP + +      N T +        I    A   D   NA + Y +++G  D++V I++  G L  +  +   +     + + A D G P L
Sbjct:  544 FFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG---GRSCNATVHVSLTDLNDNQP-VFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQ------------GNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKA---EYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPL 787          

HSP 27 Score: 67.781 bits (164), Expect = 2.299e-11
Identity = 57/210 (27.14%), Postives = 93/210 (44.29%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKF-AESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQI--NYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF 985
            F+++  TG +   + +D E +     S  A D     +   V +      I + D+ND+ P F       +Q+ E + +  R+    A+D D   N   ++ + G               +  N   DYE      Y  T+ A D G PPL  N T+ ++V D ++  P F++ +YK  +  NA +G+ V  VTA D DSG  G+V + F
Sbjct: 2455 FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSV-----TIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVF 2659          

HSP 28 Score: 67.3958 bits (163), Expect = 3.227e-11
Identity = 72/229 (31.44%), Postives = 108/229 (47.16%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG--EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDL 2343
            +  F I+   G ++T + +DRE+  +  L V A DQ   E      T T+ I I D+NDN P  ++     V E +E     +T I A DPD G+ G V +             +I    T  FS+D  +G L +  SLD E +  Y L+I   D G P LTS +   + V+D+NDNPP++ + +   T    K        ++   A D DS  NA +TY +  G ++
Sbjct: 1375 RAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVME-DEPFNFQVTSITALDPDTGQGGNVEY-------------RIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENK---PTGTSVVKVTAYDRDSGSNAELTYSIPSGVEM 1586          

HSP 29 Score: 61.2326 bits (147), Expect = 2.271e-9
Identity = 78/265 (29.43%), Postives = 116/265 (43.77%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI--NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS---LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-----------LVYIDAIIGDLRARQSIREGHYLIKLVANDNGN 2439
            G + T  +LDREK     L ++      P+S T    V     D+NDN P+ +     KL V EN++    F  ++ A D D G N T  + I  V    G   K+   R    +  ++  +L +  S   +DRE +DSY+L I   D G P       +++TV D NDN P+ F  V++S  I     +     I+   ASD D   NA I Y +    D            V ++ +  D  A++S     YLI + A D G+
Sbjct:   12 GVITTKTVLDREKVSAYNLTIVEFST-PPKSYTVLVYVQ----DLNDNSPSFVRGTSAKLVVFENDKD---FRQKLIAVDSDFGSNSTQSYTI--VSGNVGNVFKLISKRD---TDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPE-FSNVSYSGTIPEN--IDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRS-----YLIVVKAEDKGS 255          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO41767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G3])

HSP 1 Score: 115.546 bits (288), Expect = 9.099e-44
Identity = 120/458 (26.20%), Postives = 203/458 (44.32%), Query Frame = 2
Query:  251 AVKEEIDVGN-----FVGNLNIDSNIFKIQPKSTFKLYDDGKLLK-YFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYR-FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDF-SLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN-FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++ E ID+G+     F  +L+  SN        T+ L    KL+K  F +++ TG +     +DRE+     F   A D     LT    +        + DVND  PKF++S +   + E   +G  ++  TA+D D+  N    YF+   +            +I ++ +LD E+  +Y   + A D G+        + I + D NDN P+ +Q  Y   IKEN  +G  V  V A D D G+  ++ Y  FGQ         F         K+  ++      + F +  + A+D G   +  Y+ + +HL DVN+ RP+ + +S   A     V E+  L      +   D D+GVN ++   L   A   F +       G  I +L+  +  +RE+  ++ + +   D GTP L++   + +K+ ++N+  P F    Y  NVSE++ IG
Sbjct: 2764 SIPENIDIGSKVLRVFAEDLDSGSNGM-----VTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVR-----AIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDL--NTELYYFILSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASD-GL--FTSFAQMKIDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQ--------GFGTFAVDKNGKMTNLVELDRETRPFYNFMVSAADIGG--QACYSNISIHLDDVNDNRPLFSQSSYFTA-----VYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIET-----GTGIISLE--KPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIG 3184          

HSP 2 Score: 81.6481 bits (200), Expect = 9.099e-44
Identity = 83/293 (28.33%), Postives = 131/293 (44.71%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQ----DQRIIIAQASDPDSRPN-ANITYHVTEGDDLVY------IDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKST 2493
            R     LF ID+  G +     LD E      L V A D G P  ++ +        D NDN P   +  +   K +E + L  F+ Q+ A D D G N  +++ I             + N  K F I E +G + +   +DRE + SY L +   DQG P   +   + + V D+NDN P++      STN+TT  VL++    +  +I  +  D D+  N A   + +  GD   +      +   IGD+    S  +G Y ++++  DNG+P  STE+ I + I+   T
Sbjct: 3208 RGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVT-DSNDNGPE-FSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIA------------EGNDAKKFKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEF-----SSTNLTT--VLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNGLITKIGDV----SHSDGQYRLRVLVADNGHPPQSTEVSITVKIAESKT 3475          

HSP 3 Score: 119.398 bits (298), Expect = 4.380e-32
Identity = 121/417 (29.02%), Postives = 188/417 (45.08%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCP--TSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY--FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP----AKKDFNVKENQTLMSHF----AIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F +E  TG + +   +DRE V     + +A D      T F  +      I I+D ND+ P   +S Y   I E   +G  +    A+D DV  N   TY  F  GF  TF +  +  +  +V   LD ET+  Y   + A D G      N  ++I + D+NDN P+FSQ  Y   + E+A + +V+  V A D D G+  ++ Y    V D      F I T TG I L++ LN + + ++++LN+E  DGG+ P    ATV         Q  V+NIN + P    +    NV E+  + +      A+   S  D+     +   +  GA++   S       R   T+  NR  D E    + + +  SD G P L +   + + + D N+  P F ++ Y+  V ENS +G
Sbjct: 2909 FGIERKTGVIFVHGSLDRESVGSYDLNISASDGL---FTSFAQMK-----IDIEDANDNPPICTQSIYVEHIKENTPLGSTVLTVGATDADVGVNAELTYSVFGQGFG-TFAVDKNGKMTNLV--ELDRETRPFYNFMVSAADIGGQACYSN--ISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSL--VTDAG--GTFTIETGTGIISLEKPLN-RELKENYTLNVEVMDGGTPPLSSIATV---------QIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESSNDV-----ITYAILRGADSGLFSID-----RKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALG 3288          

HSP 4 Score: 38.1206 bits (87), Expect = 4.380e-32
Identity = 53/177 (29.94%), Postives = 80/177 (45.20%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPD-LGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDS-YILYIMVCDQGKPQLTSIEAITLTVLDINDNPP 2193
            F I +  G ++ +  +DRE+     L V A DQG P  Q A T V I +TDVNDN P   +   L    +E +LP   +  ++  D D LG     +F +             D +R K+ S      N  I K  D  + D  Y L ++V D G P  ++  +IT+ + +   +PP
Sbjct: 3320 FKIVEETGVIKVSGDIDREEVASYRLKVRAQDQGLP-PQVADTVVDIEVTDVNDNSPE-FSSTNLTTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLI----------SGDASRFKLHS------NGLITKIGDVSHSDGQYRLRVLVADNGHPPQSTEVSITVKIAESKTHPP 3478          

HSP 5 Score: 119.783 bits (299), Expect = 3.592e-27
Identity = 123/448 (27.46%), Postives = 195/448 (43.53%), Query Frame = 2
Query:  251 AVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT--FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGD---IGVNAEVDCHLTVG-AENFKL-SNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNV 1567
            AV E+  +   +  +  D     +  K T+ L  D      F++E  TG + + + ++RE  +    +   +D     L+    +      I + ++ND  P+F+ S Y   +SE   +G  + +R  +      N+V TY +    D+  F+I   N   + V   LDYET   Y  T+ A D G P L     + ISV D NDN P FS+K Y   + EN+ +G  V  V A D DSG   Q++Y   +  D      F I   TG IK+   ++ + +A  + L + A D G  P+V    V + + DVN+  P  +  +L           +++ + + A+I +   D   +G  A     L  G A  FKL SN    K  D+             D  +++R+L +D G P  +TE  ITVKI +     P        VN+
Sbjct: 3072 AVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAG--GTFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQ-----IKVLNINDVPPEFSHSIYHGNVSEDAPIGNEV-VRVRAVSRESSNDVITYAILRGADSGLFSIDRKNGT-IHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGND---AKKFKIVEETGVIKVSGDIDREEVAS-YRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNL-------TTVLSESSLPNAAVIHLRPHDRDALGNGAPYQFTLISGDASRFKLHSNGLITKIGDV----------SHSDGQYRLRVLVADNGHPPQSTEVSITVKIAESKTHPPNVHPLTVYVNL 3489          

HSP 6 Score: 109.383 bits (272), Expect = 5.662e-24
Identity = 104/362 (28.73%), Postives = 170/362 (46.96%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNI-TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP--AKKDFNVK--ENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            I + DVND++P F++S Y   + E   +   +    A D DV  N   TY  +     TF I T + ++ L     L+ E + NY   +   D G PPL    T+ I VL+IND  P FS   Y   + E+A +G  V  V AV  +S     + Y   +  D  +   F I    G I + R L+ +   + ++L +EASD G  P V  +T +V +        V + N  GP  ++K ++ K  EN  L +    ++ +D D G NA++   +  G  A+ FK+     V       ++ +   DRE  + +++++   D+G P    +  + +++ DVN+ SP F   N T  +SE+S
Sbjct: 3052 IHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSLVTDAGGTFTIETGTGIISLE--KPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHGNVSEDAPIGNEVVRVRAVSRESS-NDVITYAILRGADSGL---FSIDRKNGTIHVNRKLDYET-TKLYTLTVEASDAG--PPVLRSTSYVRIS-------VTDSNDNGPEFSEKRYSAKVDENSALGTFVLQVFATDRDSGTNAQIKYSIAEGNDAKKFKIVEETGV-------IKVSGDIDREEVASYRLKVRAQDQGLPPQVADTVVDIEVTDVNDNSPEFSSTNLTTVLSESS 3390          

HSP 7 Score: 68.1662 bits (165), Expect = 1.770e-23
Identity = 67/218 (30.73%), Postives = 98/218 (44.95%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            F IDQ+ G + T   LDREK    E  V A D G  R  T+ TTV   + DVND PP       +   + +  +   +T I A D DL  N  + ++I            +  +    F I+  +G + ++ SLDRE + SY L I   D      TS   + + + D NDNPP   Q + +  +I   + L     ++   A+D D   NA +TY V
Sbjct: 2806 FDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTR-LTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDEDL--NTELYYFI------------LSGDPQARFGIERKTGVIFVHGSLDRESVGSYDLNISASDG---LFTSFAQMKIDIEDANDNPPICTQSI-YVEHIKENTPLG--STVLTVGATDADVGVNAELTYSV 3002          

HSP 8 Score: 60.8474 bits (146), Expect = 1.770e-23
Identity = 95/418 (22.73%), Postives = 176/418 (42.11%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHF-AIIWVSDGDIGVNAEVDCHLTVG---AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G+  ++F ++  +G + +++ +  +Q        LD   +E++  V +      + I D NDH P F+E  Y++  +E    G  +++ +A+D D       TY +   +    F I   S +LY  ++   +  +Q      + A D G     G   + + ++D NDN P+F  K Y   I  +  +G  V   +A D D+     + Y     Q P V   F I+  TG I++ R    K+    ++  +   DGG+      A+V + + + + +     I   G +K D  V EN  +      +  V  G  G   +VD  +  G     + K     T + R I  L      D E+ + + V ++ ++           + V++ D+N+ +P+F    Y  ++ EN  IG
Sbjct: 2384 GQGRQHFQIDSQSGVITLSRVVGIKQ---GKVYGLD---VEVSDSVHVSTSKVRVIIGDTNDHSPIFSEDVYKVSFNENYPEGTFVTMVSATDLDSGNYAHLTYSIDSVDAMRKFRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGGG--RFGFCVVEVHLIDENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPV---FTINAATGVIQVSREPEVKS----YNFFVLVKDGGNPLLRSIASVKITVLERDAR-----ILHFGKSKYDVTVGENAEMGQIVTGLNLVVPG--GNPVDVDYRIIKGNNDNNDRKFGVDSTGRVRVIGRL------DYEIRNRY-VMIVEANVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIG 2772          

HSP 9 Score: 107.842 bits (268), Expect = 1.773e-23
Identity = 107/409 (26.16%), Postives = 183/409 (44.74%), Query Frame = 2
Query:  386 ESTGKLIIAQRIDRE------QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS---NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            +STG++ +  R+D E       +   + +A++  QI  T+ V        + + D+ND  PKF    Y   I E + +G ++    A D D   N + TY +   +      F    +  ++    ALD E Q +++  + A D G   L    T+   VLD+ND  P FSQ E+   +KE+A++G+ V  +TA D D        Y F    DP   + F I   TG I +   L+ +++   + LNI ASDG       +A + + ++D N+  P+   +         ++KEN  L S    +  +D D+GVNAE+  +   G      +  +  K  ++  L      DRE    +   +  +D G     +   I++ + DVN+  P F + +Y   V E++ +
Sbjct: 2704 DSTGRVRVIGRLDYEIRNRYVMIVEANVSAIN--QIARTVVV--------VQVLDINDVTPKFVSDPYLASIPENIDIGSKVLRVFAEDLDSGSNGMVTYALVSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIGQSVTTITATDED---LNTELYYFILSGDPQ--ARFGIERKTGVIFVHGSLDRESVGS-YDLNISASDG---LFTSFAQMKIDIEDANDNPPICTQSIYVE-----HIKENTPLGSTVLTVGATDADVGVNAEL-TYSVFGQGFGTFAVDKNGKMTNLVEL------DRETRPFYNFMVSAADIGGQACYS--NISIHLDDVNDNRPLFSQSSYFTAVYEDAPL 3079          

HSP 10 Score: 98.5969 bits (244), Expect = 1.263e-20
Identity = 75/260 (28.85%), Postives = 135/260 (51.92%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGS 1126
            +G +   F++   TG+L +A  +DRE +  +S+T L+   ++        Y I  + I DVND  P F ++ Y++ + E + VG  ++   ASD D   N   TY  ++ F   F +   + + + V + LDYE Q  YK  + A D  +     G+  + +++LDINDN P+   K++ V ++E+ +V  VV ++ A D DSG  G++ +       P     F I + +G I+L++ L+ +  +  ++L +  +D GS
Sbjct:  727 EGDVDSVFNINMFTGELTVAMPLDRETI--SSYT-LNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQIVNDFGGKFRVNRISGV-VSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSL-----PESTRKFNIDSKSGVIRLRQRLDFEQKST-YNLTVRVTDKGS 976          

HSP 11 Score: 98.2117 bits (243), Expect = 1.600e-20
Identity = 108/418 (25.84%), Postives = 177/418 (42.34%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIV-INALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVA--NVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNI-AQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT--LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            DG  +  F ++  TG +  A  +D E       T   +      ++  I   IN++   D+ND  P FA S Y   ++E +  G  +   TA DPD    ++  Y +   N+  N        LI  +  LD E +  YK T+ A D G PP+  + T  + + D NDN P F +K+Y V +       +      V A D D G    +RY    +   +  + F I + +GEI      N   +  + + L I A D G +PK+  +T  V +  +   +P  N       +   +++E++ + S   II   D D          +T    +    N  T+   D Y   +      DRE  S + +R+  +D      T    +T+ I DVN+ SP+  ++ Y  +V+ENS +G
Sbjct: 1040 DGTGVDKFIIDPDTGAIRTAGELDHEVADHYWLTVQAKDGESYPLYTNIPVLINIV---DLNDEAPYFAPSTYYPVLAENLPSGSSVVQVTAKDPD-SGGSLLRYTITKGNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRY---SITKGNRDNKFIIDSRSGEI----FTNVSLVDGESYDLTIVAEDNG-LPKLSTST-NVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPDFD-------QITYNIASGNHGNKFTI---DRYGGFITVAHSLDREEKSFYSLRVEATDGYN---TASVPVTINILDVNDNSPQPARREYRAHVAENSDVG 1431          

HSP 12 Score: 94.7449 bits (234), Expect = 1.808e-19
Identity = 88/330 (26.67%), Postives = 142/330 (43.03%), Query Frame = 2
Query:  536 NDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDT-FNITFSNLLY--LIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIA--------QDFSLNIEASDGG-SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTT 1486
            N H P F      I ISE+  +   +S   A+D D   N +  Y  + G  D+ FNI   N+    L V   LD ET  +Y   + A DCG         L + + D+ND  PVF +  Y+V + EN  VG+ V +V A D D G  G + Y+              ++ + G+ ++ RI    ++         + + + I+A D      KVG   V V L D+N+  P++      P K +  V+E+  + +    I  SD D G   E++  L      F + +   V       ++  +  D E  S + + +  +D+G+P L T
Sbjct:  680 NRHHPVFRSHDQNIHISESTPIATVVSQFMATDEDKGYNGLVLYSIVEGDVDSVFNI---NMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQI-------------VNDFGGKFRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSPIVK-----PKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGV-------IRLRQRLDFEQKSTYNLTVRVTDKGSPALFT 981          

HSP 13 Score: 91.6633 bits (226), Expect = 1.598e-18
Identity = 100/356 (28.09%), Postives = 156/356 (43.82%), Query Frame = 2
Query:  536 NDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT---FNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSH--FQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ND  P F  S Y   ISE+  V   +    A D D   N    YF+   +     F I   + + + V  +LDYE+++ ++  +VA D G P L G   + + ++D NDN P F +  Y   I  +A  G+ V  + A D D G   ++RY     Q      +F I + +G I L R++  K   + + L++E SD  SV  V  + V V + D N+  P+ + +     K  FN  EN    +   ++  +D D G  A    HLT   ++        +   D   L    +FDRE  S     V +  +D G        E  V + D N+  P F+ +NY   +S + T+G
Sbjct: 2230 NDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAFFKIDKKSGV-VFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRILATDPDEGDAKKLRYSITGGQG---RQHFQIDSQSGVITLSRVVGIKQ-GKVYGLDVEVSD--SV-HVSTSKVRVIIGDTNDHSPIFSEDVY---KVSFN--ENYPEGTFVTMVSATDLDSGNYA----HLTYSIDSVDAMRKFRIDA-DSGMLYSRLMFDRENSSQAIMSVPIRATDGGGRFGFCVVE--VHLIDENDNQPIFELKNYDTTISRSVTMG 2565          

HSP 14 Score: 86.6557 bits (213), Expect = 4.451e-17
Identity = 101/371 (27.22%), Postives = 173/371 (46.63%), Query Frame = 2
Query:  509 INVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLL-YLIVINALDYETQINYKTTLVACD----CGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDV---NNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLS---NSQTVK--GRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQD-VNEFSPRFKKQNYTVNVSENS 1579
            I+VI     + + P F    Y   I E  ++   + +  A DPD +     TY +   N     T      ++ V ++LD E +  Y   + A D      +P       + I++LD+NDN P  +++EY+  + EN+ VG +V  V   D D+G+ G+V Y   Q       S F I +++G I   + L+ + + Q+  L I+ASD G +PK    T+F  +  V   N+ +P   ++ L  ++ D + K    ++     +  +D D G N+++   +  G  N  LS   NS  VK  GR + TL             + +++  +D G P L T+ ++ VK++  V  F+  F+K  Y V++ ENS
Sbjct: 1301 IDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPDFDQ---ITYNIASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTASVP-------VTINILDVNDNSPQPARREYRAHVAENSDVGTLVTTVK--DPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETM-QEHVLTIKASDRG-IPK--RETLFSVVVSVDDVNDHKPEF-LSPLFESEVDVSAKAGTAILR----VIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGR-LSTLV----------HQYALKVQSTDGGEPPLKTQVDVKVKVRGIVKNFA--FEKPKYEVSLPENS 1637          

HSP 15 Score: 86.2705 bits (212), Expect = 5.646e-17
Identity = 83/270 (30.74%), Postives = 122/270 (45.19%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSIREGH-YLIKLVANDNGNPNLSTEIKI 2466
            F ID   G +RTA  LD E  D   L V A D GE         V I I D+ND  P     P        E LP    + Q+ A+DPD G    +R+ I +             N    F ID  SG +T  + LDRE+   Y L +   D G P +++    T+ + D NDN P+ F+   +   +  +   ++   +    A+D D   NA++ Y +T+G  D+   ID+  G++    S+ +G  Y + +VA DNG P LST   +
Sbjct: 1047 FIIDPDTGAIRTAGELDHEVADHYWLTVQAKD-GESYPLYTNIPVLINIVDLNDEAPYF--APSTYYPVLAENLPSGSSVVQVTAKDPDSG-GSLLRYTITK------------GNEQNNFVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPE-FKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGESYDLTIVAEDNGLPKLSTSTNV 1299          

HSP 16 Score: 85.8853 bits (211), Expect = 8.454e-17
Identity = 114/398 (28.64%), Postives = 182/398 (45.73%), Query Frame = 2
Query:  419 IDREQVCPTSFTALDR---CQIELTIFV------PIDYWIN-VITIQDVNDHQPKFAESYYQIQI--SEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDIND---NHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDG---GSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVD-CHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
            ID +    T+   LDR    + +LT+        P+   +   + I D ND+QP+F E  Y + +   +A    + +    A+D D+  N    Y +   N  + F I   +      ++ +D E+   Y  T+VA D G+P L  +  + I V+  N    N PVF  K+Y   I+E+  +   V  + A D D   F Q+ Y    +   +  + F I  Y G I +   L+ +     +SL +EA+DG    SVP      V +++ DVN+       NS  PA++++  +V EN  + +   +  V D D GVN EV+ C + T  AE+  L   ++  GR I T++P    D E      + +  SDRG PK  T   + V + DVN+  P F
Sbjct: 1153 IDPQSGLITTLRPLDREFKSEYKLTVSASDGGTPPVSTDVTFTVKITDENDNQPEFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITKGNRDNKFIIDSRSGEIFTNVSLVDGES---YDLTIVAEDNGLPKLSTSTNVLIDVIQGNKPSKNAPVFWNKQYSADIQEDKRINSFVLIIGAEDPD---FDQITY---NIASGNHGNKFTIDRYGGFITVAHSLD-REEKSFYSLRVEATDGYNTASVP------VTINILDVND-------NSPQPARREYRAHVAENSDVGT--LVTTVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGR-ILTVKP---LDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEF 1521          

HSP 17 Score: 67.0106 bits (162), Expect = 2.833e-16
Identity = 99/409 (24.21%), Postives = 184/409 (44.99%), Query Frame = 2
Query:  371 YFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELT--IFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN--DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLT--VGAENFKL-SNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            YFS+   TG++++ + +D  +V P  FT +    +E T  +F        V+ I+ V+   P F +  +   ++E   +G  ++  TA  P+        Y + G +  + F+I F   + + ++++LDYET+  YK  + A D        +  + ++V D+ND  P F++  Y   I E+  V   V  V A+D DSG+  ++ Y    V    V ++F I   +G + + + L+ ++      + I A+D G     G   V V L D N+  P  +  S+  A    +    Q +      I  +D D G   ++   +T   G ++F++ S S  +    +  ++  +V+  +V+    V +  S           ++ V I D N+ SP F +  Y V+ +EN
Sbjct: 2081 YFSISRKTGEVVVRRTLDDVKV-PRLFTLM----VEATDGLF----RTEAVVKIKVVDKETPVFDQLSFSKVLAEDTPIGSEVTSVTARSPN---GAGILYSITGGDPVNQFSIDFKTGV-VTLVSSLDYETRTKYKLVVRATDARTSSHS-DVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVS--RVGAFFKIDKKSGVVFVAKSLDYESRVV-HEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFD-KSMYAASILGSASPGQFVTR----ILATDPDEGDAKKLRYSITGGQGRQHFQIDSQSGVITLSRVVGIKQGKVYGLDVEVSDSVHVSTS-----------KVRVIIGDTNDHSPIFSEDVYKVSFNEN 2456          

HSP 18 Score: 37.3502 bits (85), Expect = 2.833e-16
Identity = 42/178 (23.60%), Postives = 76/178 (42.70%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDK--IELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETL--------PMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLD 2175
            F ID   G L +  + DRE   +  + + + A D G    +     V + + D NDN P        ++K  + T+        P+ +T   A DPD   N  + + I            +      +F+I+  +G + + +  +   + SY  +++V D G P L SI ++ +TVL+
Sbjct: 2492 FRIDADSGMLYSRLMFDRENSSQAIMSVPIRATDGG---GRFGFCVVEVHLIDENDNQPI------FELKNYDTTISRSVTMGTPVLMTS--ASDPDASSNAALTYVI------------VGHQTPPVFTINAATGVIQVSREPE---VKSYNFFVLVKDGGNPLLRSIASVKITVLE 2643          

HSP 19 Score: 80.8777 bits (198), Expect = 2.714e-15
Identity = 113/447 (25.28%), Postives = 189/447 (42.28%), Query Frame = 2
Query:  365 LKYFSLEEST---------GKLIIAQRID------------REQVCPTSFTALDR-CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQ-VGYR----ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYE-TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP----KVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK---GRDIYTLQPNRVFDRE--VDSHFQVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            L Y+S +E T         G + +AQ++             R++  P S     R CQ+             ++ +Q VN   P+F+       +SE    + Y     I     S+ D++   + +  + G    F+I  S   Y + VI  LD E     Y  TL A D G P   G+  L ++VLD NDN+P F+Q  Y   + E A +   V  V A D D+G  G + Y   +  +   L  F I++ TG+I  +  L+ ++  Q F L + A DG  VP    K+    V V++ D N+  P          +KD    E+ T  +    +   D D G N +V          + L+N + V      D   ++     DR+  +     +++  SD GTP +  TE  + ++++++N+ +P  K+    + V  N+ +G
Sbjct:  139 LIYYSFKEKTTSFAINPISGVVSVAQKLSNSARIHRLTVVARDRALPPSKPKSSRNCQL-------------IVNVQAVNQFSPEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSGNLDG---AFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNE---LGKFEINSKTGQIYTKGDLDYES-RQRFDLTVAALDG--VPLQSRKISTVPVVVNILDANDHDPEFKAPEY---RKDL--YEDLTPGTSVFTVSAEDLDSGGNGKV---------RYSLANLRPVPFEIEPDTGIIRTTTNLDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVG 549          

HSP 20 Score: 80.1073 bits (196), Expect = 5.155e-15
Identity = 88/359 (24.51%), Postives = 164/359 (45.68%), Query Frame = 2
Query:  530 DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQI-NYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGR---DIYT--LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            D ND+QP F    Y   IS +V +G  + + +ASDPD   N   TY + G       T +    +I ++    E ++ +Y   ++  D G P L    ++ I+VL+ +     F + +Y V + ENA +G++V  +  V +  G    V YR  +  + +    F + + TG +++   L+ + I   + + +EA +  ++ ++    V V + D+N+  P    +    +     + EN  + S    ++  D D G N  V   L        +S  + VK +   D +T  +      DRE    F+ ++  +D GT +LT+   +   + DVN+  P+F +  +  +V E++ IG
Sbjct: 2541 DENDNQPIFELKNYDTTISRSVTMGTPVLMTSASDPDASSNAALTYVIVGHQTPPVFTINAATGVIQVS---REPEVKSYNFFVLVKDGGNPLLRSIASVKITVLERDARILHFGKSKYDVTVGENAEMGQIVTGLNLV-VPGGNPVDVDYRIIKGNNDNNDRKFGVDS-TGRVRVIGRLDYE-IRNRYVMIVEA-NVSAINQIARTVVVVQVLDINDVTPKFVSDPYLAS-----IPENIDIGSKVLRVFAEDLDSGSNGMVTYAL--------VSKDKLVKEKFDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQSEFMASVKEDALIG 2879          

HSP 21 Score: 75.8702 bits (185), Expect = 9.564e-14
Identity = 76/275 (27.64%), Postives = 127/275 (46.18%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPT-VINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHS-TNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLR--ARQSIREGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID+Y G +  A+ LDRE+     L V A D     S      V I I DVNDN P       +  V EN +   +  T    +DPD G NG V + I          +        +F I+  SG +   K LD E +  ++L I   D+G P+  ++ ++ ++V D+ND+ P++  P+  S  +++ K+  A    I+   A+D D   N+ + Y +  G  +  + +D   G ++   R S     Y +K+ + D G P L T++ + + +
Sbjct: 1361 FTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYNTAS----VPVTINILDVNDNSPQPARREYRAHVAENSDVGTLVTT---VKDPDAGVNGEVEYCI---------VQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTA----ILRVIATDKDDGTNSKLKYSIVSGNTNKSLSVDQNSGVVKVAGRLSTLVHQYALKVQSTDGGEPPLKTQVDVKVKV 1615          

HSP 22 Score: 74.7146 bits (182), Expect = 1.878e-13
Identity = 82/267 (30.71%), Postives = 124/267 (46.44%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEE-TLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG-KPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLST 2454
            +F I+ + G L  A  LDRE      L + A+D G+ R ++A T + + ITDVND  P V +    +V   E  T+   +T + A D D G NG + + I  V D  G            F ++ ISG +++   LD E  + Y + I   D     Q      + +T+LDINDN P   +P     N+T +  L  +  +    ASDPDS P   I + + E      ID+  G +R RQ +   ++  Y + +   D G+P L T
Sbjct:  733 VFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHR-KSAYTILNVKITDVNDCSP-VFDKTVYEVTLPENITVGQTVTHVHASDKDQGTNGFITYQI--VNDFGGK-----------FRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSP-IVKP--KKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPESTRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFT 981          

HSP 23 Score: 70.8626 bits (172), Expect = 3.138e-12
Identity = 75/309 (24.27%), Postives = 137/309 (44.34%), Query Frame = 2
Query:  686 DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSH------FAIIWVSDGDIGVNAEVD-CHLTVGAENFKLSNSQTVKGR-DIYTLQPNRVFDREVDS-HFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
            D+  ++  N + +     L+ E+  +Y+  +V  D           + I+V D NDN P+F +K+Y   I E+  +   +A + AVD D G  G + Y F +       + F I+  +G + + + L+  N A+   L + A D    P           K   N + ++N+ ++     +F+VK     +S       +A + + D D G N ++D   +T G     L  + ++K   + Y +Q  +  DRE+    + V +   D+GTP       + V + D N+ +P F +  Y  N+SE + I
Sbjct:   45 DSRQVSDFNFMDIKTSKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKT-----TSFAINPISGVVSVAQKLS--NSARIHRLTVVARDRALPPS--------KPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSEGTSGIVYATLGIIDKDKGSNGDIDRVEITSG----NLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFNQSRYITNLSELAPI 334          

HSP 24 Score: 70.0922 bits (170), Expect = 5.250e-12
Identity = 59/218 (27.06%), Postives = 99/218 (45.41%), Query Frame = 2
Query:  551 KFAESYYQIQISEAVQVGYR-ISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVIN 1198
            +F+   Y   + E V V    +++R    P     +  TY +   ++ F+I  S  +  I     LD E+   Y+  + A D  +PP      + + V+D NDN PVF    Y ++++     G ++    A D D G    +RY      DP    YF IS  TGE+ ++R L+   + + F+L +EA+DG     +      V +K V+ + PV +
Sbjct: 1931 QFSRKNYSASVREGVSVDSELVTVRALGYP---IGSTITYTIINPSELFHIVPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIG-GDP---GYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDG-----LFRTEAVVKIKVVDKETPVFD 2136          

HSP 25 Score: 69.3218 bits (168), Expect = 1.050e-11
Identity = 70/260 (26.92%), Postives = 119/260 (45.77%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDRE       +V A D G    Q   + + I + DVNDN P             +  L   L Q++A D D+G N  + + +  V D  G            F+I+  +G +++ K L+RE  ++Y L + V D G P L+SI  + + VL+IND PP++   + H  N++  + +  +  ++  +A   +S  N  ITY +  G D  L  ID   G +   + +       Y + + A+D G P L +   + + ++
Sbjct: 3024 LDRETRPFYNFMVSAADIG---GQACYSNISIHLDDVNDNRPLFSQSSYFTAVYEDAPLKKVLLQVKADDADVGVNRKLTYSL--VTDAGG-----------TFTIETGTGIISLEKPLNRELKENYTLNVEVMDGGTPPLSSIATVQIKVLNINDVPPEFSHSIYHG-NVSEDAPIGNE--VVRVRAVSRESS-NDVITYAILRGADSGLFSIDRKNGTIHVNRKLDYETTKLYTLTVEASDAGPPVLRSTSYVRISVT 3263          

HSP 26 Score: 68.9366 bits (167), Expect = 1.273e-11
Identity = 71/264 (26.89%), Postives = 116/264 (43.94%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDT-FNITFSNLLYLIVINALDYETQINYKTTL--VACDCGMPPLCGNQTLA-ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMD-SGLFGQVRYR--FGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDG 1120
            G  L  F +   TG++     +D E  Q    +  ALD   ++      +   +N++   D NDH P+F    Y+  + E +  G  +   +A D D   N    Y +       F I     +     N LD +T +     L   A D G P     +TL  + V ++NDN PV  Q +  +++  NA VG ++  VTA+D+D S     + Y+  FG          F +   TGE++  R L  + + ++F+L I+A+DG
Sbjct:  361 GNELGKFEINSKTGQIYTKGDLDYESRQRFDLTVAALDGVPLQSRKISTVPVVVNIL---DANDHDPEFKAPEYRKDLYEDLTPGTSVFTVSAEDLDSGGNGKVRYSLANLRPVPFEIEPDTGIIRTTTN-LDRDTGLPEFINLQVRASDFGTPLRRETETLVKMRVKEMNDNAPVLKQFKCNILVDRNAPVGVLITTVTAIDIDISDKDQSLMYKSTFGNTG-----KAFSLDPKTGELRTARSL--RGLQREFTLIIKATDG 613          

HSP 27 Score: 66.2402 bits (160), Expect = 8.486e-11
Identity = 67/262 (25.57%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELT-----IFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVP 1132
            F+++   G + +A  +DRE+    SF +L   ++E T       VP+      I I DVND+ P+ A   Y+  ++E   VG  ++  T  DPD   N    Y +       + +     S+   ++ +  LDYET   +  T+ A D G+P      ++ +SV D+ND+ P F    ++  +  +A  G  +  V A D D G   +++Y          LS   +   +G +K+   L+   +   ++L ++++DGG  P
Sbjct: 1361 FTIDRYGGFITVAHSLDREE---KSFYSL---RVEATDGYNTASVPV-----TINILDVNDNSPQPARREYRAHVAENSDVGTLVT--TVKDPDAGVNGEVEYCIVQTAKAESASLFKIESHSGRILTVKPLDYETMQEHVLTIKASDRGIPKRETLFSVVVSVDDVNDHKPEFLSPLFESEVDVSAKAGTAILRVIATDKDDGTNSKLKYSIVSGNTNKSLS---VDQNSGVVKVAGRLST--LVHQYALKVQSTDGGEPP 1604          

HSP 28 Score: 62.3882 bits (150), Expect = 1.084e-9
Identity = 65/223 (29.15%), Postives = 102/223 (45.74%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD 2337
            F +D   G +R    LD E  ++  +IV A       +Q A T V + + D+ND  P  ++ P L  + EN +     L ++ A D D G NG V + +  V   + + EK        F ID+ +G +T   +LDRE   S+   +   D G  +LTS+  +   VLD+ND PPK+ Q      ++   +++ Q    I A     D   N  + Y +  GD
Sbjct: 2701 FGVDS-TGRVRVIGRLDYEIRNRYVMIVEA--NVSAINQIARTVVVVQVLDINDVTPKFVSDPYLASIPENIDIGSKVL-RVFAEDLDSGSNGMVTYAL--VSKDKLVKEK--------FDIDQHTGWITTRGALDREKQPSFEFQVRATDNGTTRLTSLTTVRAIVLDVNDTPPKFSQS-EFMASVKEDALIGQSVTTITAT----DEDLNTELYYFILSGD 2904          

HSP 29 Score: 61.2326 bits (147), Expect = 2.810e-9
Identity = 62/221 (28.05%), Postives = 99/221 (44.80%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG 2334
            F ID   G +   + LD E   K +L+V A D     S  +   V +T+TDVND  P       L        +   +  ++A D D G N  + ++IQ V                 F ID+ SG + + KSLD E    + + I+  D+GKP LT    + + ++D NDN P++ + +  ++ + + S      RI+   A+DPD      + Y +T G
Sbjct: 2180 FSIDFKTGVVTLVSSLDYETRTKYKLVVRATDA--RTSSHSDVAVDVTVTDVNDVAPAFNRSLYLATISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGAF-----------FKIDKKSGVVFVAKSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPGQFVTRIL---ATDPDEGDAKKLRYSITGG 2384          

HSP 30 Score: 61.2326 bits (147), Expect = 2.977e-9
Identity = 96/369 (26.02%), Postives = 153/369 (41.46%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNIT-FSNLLYLIVINALDYETQINYKTTLVACDCGMPP----LCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNI--EASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLS-NSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTP----KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            IT+ D ND++P F +  Y   I E + +   I+   A D DV PN +  Y       +F I   S ++   V   L    +I ++ T+VA D  +PP       N  L ++V  +N   P FS K     + E    G V A +  +D D G  G +     ++   ++   F I +   +  +Q I         F  N+   A D G+  + G   + V++ D N+  P  N      ++   N+ E   + +    +  +D D G N  +   +T G E  K   NS+T +   IYT       D E    F + +   D G P    K++T   + V I D N+  P FK   Y  ++ E+ T G
Sbjct:   93 ITVDDSNDNRPIFLKKKYLKTIPEDIPMHTSIARIEAVDADVGPNGLIYYSFKEKTTSFAINPISGVVS--VAQKLSNSARI-HRLTVVARDRALPPSKPKSSRNCQLIVNVQAVNQFSPEFSVKTQLQNVSE-GTSGIVYATLGIIDKDKGSNGDIDRV--EITSGNLDGAFSIKSSPNDYAVQVIKPLDRELAPFGYNVTLTAYDKGTPVRNGSYVLRVNVLDENDNNPEFN-----QSRYITNLSELAPIHTPVLRVLATDKDAGSNGNIMYVITRGNELGKFEINSKTGQ---IYTKGD---LDYESRQRFDLTVAALD-GVPLQSRKIST-VPVVVNILDANDHDPEFKAPEYRKDLYEDLTPG 442          

HSP 31 Score: 60.8474 bits (146), Expect = 3.706e-9
Identity = 91/423 (21.51%), Postives = 173/423 (40.90%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIEL---TIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRIS-------LRTASDPDVEPNNVCTYFMH-GFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQD-FSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDF--NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNY----TVNVSENSTIG 1588
            F+++  +G +I  +  D E+V          C++E+   +        + ++TIQD ND+QP F  +     ++E    G  +        +  A+D D+  + +    +     D F+I  +    +     LDYE    Y   +   D G P L     + I V DIND  PVFS   Y   +   +  G  V  VTA D DS     + +   + QD  +   F ++  TG + +    N   + +D +++ +  SDG       +A V +  +++ +       + L  ++K++  +V+E  ++ S    +      IG  + +   +   +E F +     V    + +++     DRE    +QV +   D   P    +  + V++ D N+  P F    Y     + V++ + IG
Sbjct: 1668 FTVQRQSGVIISKKSFDAEEVT--------HCKLEIRANSTDGQHSSTLVIVTIQDKNDNQPIFEHARITGHVTEGSPQGTAVLDHKGSQLVAVATDQDISGDKLTYEIVETSARDVFSIHPATGA-ITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHATVYLPSYAGTRVTMVTATDGDSA--ANLTFSLAR-QDTEL---FAVNPLTGVVTVS---NAALLRRDTYTIKLTVSDGN---HTAHARVRIRCENLPS-------SDLQFSRKNYSASVREGVSVDSELVTVRALGYPIG--STITYTIINPSELFHI-----VPSTGVMSIRAGFDLDRESIDAYQVIVQARDDSVPPNVAQAAVHVQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIG 2055          

HSP 32 Score: 58.9214 bits (141), Expect = 1.516e-8
Identity = 46/152 (30.26%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 1885 ETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHST---NITTKSVLAQDQRIIIAQASDPDSRPNANITYHV 2325
            E+ P+   ++Q  A D D G NG V + I            ++ +   +F+I+  +G LT+   LDRE I SY L I   D GK + ++   + + + D+ND  P + + V   T   NIT        Q +    ASD D   N  ITY +
Sbjct:  697 ESTPIATVVSQFMATDEDKGYNGLVLYSI------------VEGDVDSVFNINMFTGELTVAMPLDRETISSYTLNISAVDCGKHRKSAYTILNVKITDVNDCSPVFDKTVYEVTLPENITVG------QTVTHVHASDKDQGTNGFITYQI 830          

HSP 33 Score: 58.151 bits (139), Expect = 2.216e-8
Identity = 46/160 (28.75%), Postives = 76/160 (47.50%), Query Frame = 1
Query: 1996 EKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-DLVYIDAIIGDLRARQS--IREGHYLIKLVANDNGNPNLSTEIKI 2466
            E ++ +   +FSI   +G +T  K LD E    Y   I V D G P+L++   + + V DIND  P +     H+T +   S      R+ +  A+D DS   AN+T+ +   D +L  ++ + G +    +  +R   Y IKL  +D GN      ++I
Sbjct: 1767 EIVETSARDVFSIHPATGAITTAKVLDYEVTPQYAFKIKVTDSGNPRLSAFADVKIHVTDINDIAPVFSASTYHAT-VYLPSYAG--TRVTMVTATDGDSA--ANLTFSLARQDTELFAVNPLTGVVTVSNAALLRRDTYTIKLTVSD-GNHTAHARVRI 1920          

HSP 34 Score: 55.8398 bits (133), Expect = 1.332e-7
Identity = 89/362 (24.59%), Postives = 153/362 (42.27%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMD-SGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHL----TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + + D ND+QP F  S Y I +   V  G  I    A+D D+  N    Y + G +  +         ++V   LD        T +V    G+        + I V+D     PVF Q  +  ++ E+  +G  V +VTA   + +G+   +        DP  ++ F I   TG + L   L+ +   + + L + A+D  +        V V + DVN+  P  N  SL  A     + E+  + +    +   DGD G+N E++  +     VGA  FK+     V    ++     +  D E     ++ ++ +D G P LT E  + V + D N+ +PRF K  Y  ++  +++ G
Sbjct: 2023 VQVIDRNDNQPVFINSPYFIVLQLGVAQGTIIGQAQATDADIGSNANLRYDLIGGDPGYFSISRKTGEVVVRRTLDDVKVPRLFTLMVEATDGL--FRTEAVVKIKVVD--KETPVFDQLSFSKVLAEDTPIGSEVTSVTARSPNGAGILYSI-----TGGDP--VNQFSIDFKTGVVTLVSSLDYETRTK-YKLVVRATDARTSSH-SDVAVDVTVTDVNDVAPAFN-RSLYLA----TISESTPVDTAVVTVKAIDGDSGINKEINYFIQNVSRVGA-FFKIDKKSGV----VFVA---KSLDYESRVVHEMIIVAADEGKPSLTGETRVRVVLMDANDNAPRFDKSMYAASILGSASPG 2358          

HSP 35 Score: 53.5286 bits (127), Expect = 6.288e-7
Identity = 47/168 (27.98%), Postives = 80/168 (47.62%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVL 2172
            F +++  G +   + LD E+ +  ++ + A+D      +  +T V +T+ D+NDN P ++ P K  V   E+ L    +T I A DPD G  G + F +                 T+ F+ID  SG + + + LD E   +Y L + V D+G P L +   + + VL
Sbjct:  838 FRVNRISGVVSVGDYLDYEEQEMYKIEIQAMDSSVDNQKVGSTHVIVTLLDINDNSP-IVKPKKFNVTVQEDLLVNAVVTSIHASDPDSGPGGEIEFSLPE--------------STRKFNIDSKSGVIRLRQRLDFEQKSTYNLTVRVTDKGSPALFTDVEVVVNVL 990          

HSP 36 Score: 52.373 bits (124), Expect = 1.388e-6
Identity = 83/287 (28.92%), Postives = 122/287 (42.51%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF----------LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSL-DREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRI----IIAQASDPDSRPNANITYHVTEGD--DLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINL 2472
            F ID   G + T   LDRE   + +L V A D G P   +   T  + ITD NDN P        + KE +  + +F          L Q+ A D D+G N  +R+ I +             NR   F ID  SG +    SL D E   SY L I+  D G P+L++   + + V  I  N P    PV  +   +    + +D+RI    +I  A DPD      ITY++  G+  +   ID   G +    S+    +  Y +++ A D  N   S  + IN+
Sbjct: 1151 FVIDPQSGLITTLRPLDREFKSEYKLTVSASDGGTP-PVSTDVTFTVKITDENDNQP--------EFKEKQYVVGVFARQATSKSFGLYQVVATDEDIGSNADLRYSITK------------GNRDNKFIIDSRSGEIFTNVSLVDGE---SYDLTIVAEDNGLPKLSTSTNVLIDV--IQGNKPSKNAPVFWNKQYSAD--IQEDKRINSFVLIIGAEDPDFD---QITYNIASGNHGNKFTIDRYGGFITVAHSLDREEKSFYSLRVEATDGYN-TASVPVTINI 1405          
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 100.138 bits (248), Expect = 1.953e-42
Identity = 100/355 (28.17%), Postives = 163/355 (45.92%), Query Frame = 2
Query:  533 VNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVG-YATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS--DGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +ND  P F +S Y + +SE+   G  I   TA+D D   N +  Y  +G    F ++ S    +IV + LD E +  Y   + A +           + I+V D+ D+ P F+     V + ENA +G  V  +TA+D D G    + Y      DP  L  F I   TGEI+    L+ +N+ Q + L ++A D  SV  V     V V ++DVN+  PV ++         + ++  +      +I+ V   D DIG NA V   +     ++   N+ T     + +L  ++  DREV+ +F   +  +D G P  ++   + +K+ D+N+ SP F   +Y   V EN   G
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTG-DIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIG--DTISYSIAN-GDPYGL--FTIDNVTGEIRTVAELDRENVTQ-YELFVQAKD--SVNLVSDLLKVVVQVEDVNDNPPVFSM-------PGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAIT----GVISLGSSQ-LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAG 1415          

HSP 2 Score: 92.4337 bits (228), Expect = 1.953e-42
Identity = 82/276 (29.71%), Postives = 136/276 (49.28%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            F ID   GN+ T   L+RE+     L + A+D    R++  TT V IT+TD ND+ P          V+E+ + +   + ++   D D+ +N  VR+YI               N + +FS++E +G ++   +LDRE   SY L I   D G P L S  ++ +T+ D+NDN P + + V    N+T +  +    +++   A+DPD   N   TY +T G  DD+ YIDA  G +  +  +   +   Y + + A D G P L+    + +++S
Sbjct: 1446 FAIDPDTGNITTREPLNREETGSYTLTLRAVDSA-IRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVK-VGHTVGRVATTDEDINDNARVRYYISS------------GNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVY---NVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVS 1704          

HSP 3 Score: 130.568 bits (327), Expect = 1.544e-30
Identity = 129/488 (26.43%), Postives = 222/488 (45.49%), Query Frame = 2
Query:  161 RSSQAFLLVSLMQIQIQISVGNEFNRNIHYA-VKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFT--ALDRC--QIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA-LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNA---EVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEI---TVKIQDVNEFSPRFKKQNYTVNVSENS 1579
            +SS A + + L+ I     V   FN   +YA V+E    G  V  +           K ++ L   G L   F+++  TG +   + ++RE+    + T  A+D      E T  V       +IT+ D NDH P+F +S Y   + E V+VG+ +     +D D+  N    Y++   N +   + +    +I   + LD E   +Y   + A D G+P L  N ++ I++ D+NDN P+FS+  Y V ++E+  +   V  V A D D G  GQ  Y+   G   D      FYI   TG I ++  L+ +  +  ++L + A D G+ P  G   V +H+ DV++  PV +       +    + EN T   H  +I V+  DI   A    V   +  G  ++  L   Q+  G       P+   +RE  + +++++    R    LT ++ +    + + DVN+ +PRF  ++Y  +V E++
Sbjct: 1379 KSSTASVAIKLVDINDNSPV---FNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVL--SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRV-------IITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDD-----VFYIDANTGLITIKAKLDYEKTSL-YNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFH-----KPRYSAELYENVTRGHH--VITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQS--GVITLNCTPSGCLNRETHARYELQVAAISR--VNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDT 1837          

HSP 4 Score: 81.2629 bits (199), Expect = 5.851e-29
Identity = 75/271 (27.68%), Postives = 121/271 (44.65%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKL--QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS-LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW----FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSI-RE-----------GHYLIKLVANDNGNP 2442
            G + TA  LDRE      L V A D G   S+     + + + D NDN P + +   +   + E      + L+ I A DPD G NG + + +   + +              F+++  +G L I  + LDRE  DSY L I V D G P  T+   + +T+LD+NDN P +     Q +A       +     ++ +I   A+DPD+  N  + Y ++ GD+     +D + G+L  R+ + RE           G +L+ + A D   P
Sbjct:  548 GLVTTARELDRETIATYTLTVSAYDHG-VSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSR--------------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLS-GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP 802          

HSP 5 Score: 66.2402 bits (160), Expect = 5.851e-29
Identity = 117/499 (23.45%), Postives = 207/499 (41.48%), Query Frame = 2
Query:  281 FVGNLNIDSNIFKIQPKSTFKLYDDGK----LLKYFSLEESTGKLIIAQ-RIDREQVCPTSFTALDRCQIELTIFVPIDYWIN-----------------------VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY-FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKEN-AMVGEVVAN-VTAVDMDSG-LFGQVRYRF-GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEA------------SDGGSVPKV------------GYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK---GRDIYTLQPNRVFDREVDSHFQVRMLCSDRGT-PKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             V + N ++ +F  QP    K+ ++ +    +LK  +++  +G     Q +        T F +L+    ELT+  P+D+ +                        +I + D++D  P+F +S+Y  +I E   +G  +    A D DV  NN   Y  + G +D      SN   + V  ++D E    ++ T+ A +   P      T+ ++V+D+NDN P F Q  Y   ++E+ A+ G VV++ +   D D   +F +V Y   G   D      F I   +G + + + L+ +    +F+ + E             +  G   KV              A+V + L +VN+ +P+        AK  +N  + E  T  +H A I  +D D+G         T GA  ++L   Q        D  T+   ++ D +    +Q  ++  D G   +      +TV +QDVN+  P F    YT +++EN   G
Sbjct:   35 IVDDYNDNAPVFTEQPYMA-KIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDK-----FAIDPTSGTLYINKTLDYEK-QINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMF-------AKSSYNYTMDEEITPGTHIADITATDADLG---------TFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAG 510          

HSP 6 Score: 77.7962 bits (190), Expect = 1.140e-28
Identity = 78/273 (28.57%), Postives = 124/273 (45.42%), Query Frame = 1
Query: 1651 RSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQ--ASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRAR-----QSIREGHYLIKLVANDNGNP 2442
            R      F ++   G +  A ILD +   + +  ++  D G    + A  TV +T+ DVNDN P     P     +  E LP    + Q+ A D D GENG + F I   +D               FSI+  SG +T  + LDRE I +Y L +   D G         +T+ VLD NDN P+    +  +TNI+     A    ++++   A DPD+  N  +TY ++ GD    +++  G L+       + +++ + LI +   DNG+P
Sbjct:  429 RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMP--YTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH------------FSING-SGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEG---AGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLI-INVTDNGSP 682          

HSP 7 Score: 68.5514 bits (166), Expect = 1.140e-28
Identity = 116/417 (27.82%), Postives = 177/417 (42.45%), Query Frame = 2
Query:  524 IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS-NLL--YLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI--IWVSDGDIG-VNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHF-----------------------QVRMLCSDRGTP-KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGXXXXXXXXXXXXXXX--XXXYQLAPSQNAFFS 1678
            + D ND+ P F E  Y  +I+E  +VG  I   +A D D   N+   Y       T    FS N +   L +   LD+E   +Y   ++A D G+P L    T+ I V DI+D  P F Q  Y   I+EN  +G  V  V A D D G+   + Y         V   F I + TG I +   ++ +     F + ++AS+          TV V + DVN+ RP   + S+      F+V+E+  L        + V+DGD   V   V  HL VGA++ K +   T       TL  N+  D E   +F                       + +++ ++  T  K +    +T+ + +VN+  P F K +Y   + E  T G  +  + ATD D      L Y+L   Q A+FS
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV---FTIDSNTGVITVNGSIDAEK-TDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAF-LQSV----YIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHL-VGADSDKFAIDPTSG-----TLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFS 437          

HSP 8 Score: 122.094 bits (305), Expect = 6.214e-28
Identity = 107/410 (26.10%), Postives = 184/410 (44.88%), Query Frame = 2
Query:  353 DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINA--LDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            +G     F+++  TG++     +DRE V  T +      Q + ++ +  D    V+ ++DVND+ P F+   Y I+  E    G  I    A D D+  N    Y +   N T  +T + +  +I + +  LD E +  +  T+ A D G+P      ++AI ++DINDN PVF+  +Y   ++EN   G  V  VTA D D G   ++ Y    V    + + F I   TG I  +  LN +     ++L + A D     + G   V + + D N+  P    +        F+V+E+  +      +  +D DI  NA V  +++ G  +   S ++T        +      DRE ++ + + +   D G P L +   + + I+DVN+  P F K  Y V + E+
Sbjct: 1231 NGDPYGLFTIDNVTGEIRTVAELDRENV--TQYELF--VQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVE-NVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGV----LYTRFAIDPDTGNITTREPLNREETGS-YTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYA-----FSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTG-----IISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRES 1620          

HSP 9 Score: 114.39 bits (285), Expect = 1.315e-25
Identity = 121/443 (27.31%), Postives = 202/443 (45.60%), Query Frame = 2
Query:  248 YAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLY-DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF--SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDS-GLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKL----QRILNCKNIAQDFSLNIEA-SDGGSVPKVGYATVFVHLKDVNNQRPVININS-LGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            ++V+E++ VG+ VG +        I   +  + Y   G     FS+ E+TG +     +DREQ    +   TA D     L     +     +ITI+DVND++P F++S Y + + E+V +  ++    A+DPD   N   TY +    DT ++ +  +N   + +   LDYE    Y  T+ A D G PPL G   + I V D++DN PVF +  Y   + EN   G  V  V A D+D+     +V YR   ++  +  S F I   +G I L       LN +  A+ + L + A S      +       + + DVN+  P  +  S +    +D     + T+++    +   DGD G + E+   +  G EN  F++ N   V  R        R  DRE  S + + ++  D+G P L++   + + + D+N+  P
Sbjct: 1510 FSVREDVKVGHTVGRVATTDE--DINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSV-----MITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITA-GDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYR---IESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHAR-YELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILT----VKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTR-------TRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLP 1929          

HSP 10 Score: 114.005 bits (284), Expect = 1.894e-25
Identity = 115/468 (24.57%), Postives = 201/468 (42.95%), Query Frame = 2
Query:  245 HYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI------FVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQK-EYKVIIKENAMVGEV-VANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKK----DFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENF----KLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTP---KLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +Y + EEI  G  + ++             T++L   G    YFS+    G +  AQ +D        +  L + Q  L +      +  I      +T+QDVND+ P+F    Y   I+E +  G  +   TA+D D   N   ++ +   +D  + + +    +     LD ET   Y  T+ A D G+     +  L ++VLD NDN P  +        I E A  G V ++++ AVD D+G  GQ+ Y           S F +++ TG +++      + +   + L I  +D GS P     TV V + DVN+  P  + N   PA+        V E    ++   I I  +D D   N +V   L+     F     ++   +V+ +++    P    + + D  F + +  +D+ TP   + +    +++ ++D N+ SP+F+ QNY   +SE +  G
Sbjct:  395 NYTMDEEITPGTHIADITATDADLGTFGALTYELR--GGQAAYFSVNADNGTISAAQILD--------YDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD-----SRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPN---PAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVR-KELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPG 843          

HSP 11 Score: 104.375 bits (259), Expect = 1.835e-22
Identity = 96/342 (28.07%), Postives = 156/342 (45.61%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACD-CGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
            +T+ +VND++P FA+S Y   + E +  G  I+  TA+D D+      TY + G    +    ++   +     LDY+T   Y+ +LV  D  G        T+ +++ D+NDN P F+   Y   I EN   G +V  VTA D DSG  G++ +      D     +F I+  +G +   R L+ + IA  ++L + A D G   +  +  + V++ D N+  P I                   L+S  A +   D D G N ++   ++ G   F L NS T  GR    + P    DRE+   + + +  +D G+P  T    + V I DVN+ +P F
Sbjct:  377 LTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDG---GHFSING-SGLVTTARELDRETIAT-YTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAV---DPDAGSNGQLTYSMSGGDSRFTL-NSAT--GR--LQISPTG-LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAF 704          

HSP 12 Score: 87.8113 bits (216), Expect = 2.498e-22
Identity = 110/441 (24.94%), Postives = 181/441 (41.04%), Query Frame = 2
Query:  350 DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYY-QIQISEAVQVG-YRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF------SQKEYKVIIKEN-AMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILN------CKNIAQD--FSLNIEASDGG---SVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFA-----IIWVS--DGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEE-ITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            DDG    +FS+  S G +  A+ +DRE +   + T         +    +   +NV+   D ND+ P+  +       ISE    G   +S   A DPD   N   TY M G +  F +  +     I    LD E + +Y   +   D G PP   + T+ +++LD+NDN P F      S   Y + + E    + + + ++ A D D+   G+V Y     +      +F +   TGE+ +++ L+       +N   D  F L+I A+D     S  K     V + ++D N+  P             F  +  +T +S  A     +I VS  D D+    +V  ++T G EN K    + V               R  + H +  +LC +    K + E   + + + DVN+  P F +  Y  +V ENS  G
Sbjct:  537 DDGG---HFSINGS-GLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVL---DENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEH----GFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSP------------QFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLV---------------RHYNWHKKNCVLCKES---KCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTG 936          

HSP 13 Score: 37.3502 bits (85), Expect = 2.498e-22
Identity = 24/57 (42.11%), Postives = 30/57 (52.63%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPP 1842
            F I+   G +  A ++DRE      L V A DQGEP S+     V IT+ D NDN P
Sbjct:  968 FSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFP 1024          

HSP 14 Score: 94.7449 bits (234), Expect = 1.393e-19
Identity = 105/412 (25.49%), Postives = 176/412 (42.72%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLT-VGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F +  STG +I+   +DRE   V   + TA +       +    D    V IT+ DV D +P F  S   +++SE   +G  ++  TA D D+   +  +Y +   +     T  N+   I  +  LD E    Y+  + A D  +  +     + + V D+NDN PVFS   Y +   E +  G  +  V A+D D G    V Y   +    +V  Y  ++  TG I L      + + + F+  I A+D G   K   A+V + L D+N+  PV N         D+   V+ENQ   +   ++  SD D+G NA++   L+ V    F +         +I T +P    +RE    + + +   D           + + + D N+  P+F +  Y  +V E+  +G
Sbjct: 1135 FYVSRSTGDIIVDSPLDREFKNVYILNVTAAN------IVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDI--GDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVE----NVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFN-------NTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTG----NITTREP---LNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVG 1519          

HSP 15 Score: 87.8113 bits (216), Expect = 2.037e-17
Identity = 96/381 (25.20%), Postives = 162/381 (42.52%), Query Frame = 2
Query:  545 QPKFAESYYQIQISEAVQVGYRI--SLRTASDPDVEP--NNVCTYFMHGFNDTFNI-TFSNLLYLIVINALDYETQINY-----------------------KTTLVACDCGMP-PLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY--RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQ-DFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQ-NYTVNVSENSTIG 1588
            +P F +S Y   + E V +  R+       +D D  P    V  + +   +D F I   S  LY  +   LDYE QIN+                       +  +VA +         N ++ ++++++NDN P+F++  Y   + E    G  +A++TA D D G FG + Y  R GQ       +YF ++   G I   +IL+   + Q  FSL ++   GG   ++  ATV V L+DVN+  P     +  P   D  + EN    +    +  +D D G N  +  +++ G +    S    + G  + T    R  DRE  + + + +   D G        ++TV + D N+ +P+       T N+SE +  G
Sbjct:  255 RPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLY--INKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQA------AYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDG-GGFYQEIAIATVTVTLQDVNDNDPEF---TGMPYTSD--IAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFS----INGSGLVTTA--RELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGG 615          

HSP 16 Score: 83.9593 bits (206), Expect = 3.217e-16
Identity = 91/317 (28.71%), Postives = 145/317 (45.74%), Query Frame = 1
Query: 1546 AELYSERVGKQYNWSAVATSSCDRR*RHRTIAIPTRS-KSKCLFFIDQYMG----NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF---LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPV-----AHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY--IDAIIGDLRARQSI-REG---HYLIKLVANDNGN 2439
            AELY E V + ++   V  +  D    H+ +     S  +  +F I +  G    N   +  L+RE   + EL V AI +     Q +     IT+ DVNDN P   +   ++    E+T P+    +  ++A+D D GE+G + F I            +  N   +F +D  +G LT  + LDRE    Y L +M  D+G+P L+S   + +TVLD+NDN P    P+        T  + K  L     + +  A D D++    I Y++T  ++  Y  ++   G+LR R ++ RE    HYL    +ND  N
Sbjct: 1720 AELY-ENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVR-SVLEDTGPITDATILTVKAQDGDEGESGEIIFTI------------VSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTK--NLIYYYITNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASNDKLN 2020          

HSP 17 Score: 82.8037 bits (203), Expect = 6.593e-16
Identity = 108/424 (25.47%), Postives = 175/424 (41.27%), Query Frame = 2
Query:  356 GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALD-RCQIELTI---FVPIDYWINV-----ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQT-LAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGS-VPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            G    +F L+  TG+L + + +DRE    +     D R  +++T      PI    +      IT++D ND+ P+F    Y+ ++SEA + G  +   +A+D D+E      Y         NIT  +      +  L      + K  ++   C        +T + I V D+NDN PVF+Q +Y   + EN+  G  V  V A D D G  G++ Y+   G   D      F I+  TGEI +  +++ +     F L ++A D G    +  +A V + +KD N+  P  +                             +G+I  N+ V   +T+   + K+S+S         TL+P                  S R    L T  E    I  +N+ SP F+K  Y VNVSE+++ G
Sbjct:  752 GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIY---------NITDGDENRKCEVEKLVRHYNWHKKNCVL---CKESKCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDA-----FSINNVTGEITVAGVID-REAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGY-------------------------EGEIAENSPVGSTITM-VPDQKISSS---------TLRPR----------------SSPRAPAALLTARE-KRPITLINDESPLFEKSMYYVNVSESASRG 1105          

HSP 18 Score: 75.8702 bits (185), Expect = 8.325e-14
Identity = 79/269 (29.37%), Postives = 127/269 (47.21%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKS-LDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ----RIIIAQASDPDSRPNANITYHVTEGDDLVY----IDAIIGDLRARQSI-RE--GHYLIKLVANDNG 2436
            LF ID   G +RT   LDRE   + EL V A D     S      V +   DVNDNPP V + P   ++  EE+     + Q++A D D+G+N  V +              I EN T   +++ I+G +++  S LDRE  + +   I   D G P  +S  ++ + ++DINDN P +        N    + + ++Q     +++  ASD D   NA ++Y ++    ++Y    ID   G++  R+ + RE  G Y + L A D+ 
Sbjct: 1237 LFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVE--DVNDNPP-VFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLY-------------SIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVF-------NNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLS---GVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSA 1479          

HSP 19 Score: 73.1738 bits (178), Expect = 6.113e-13
Identity = 57/188 (30.32%), Postives = 97/188 (51.60%), Query Frame = 2
Query:  755 QINYKTTLVACD---CGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKV-GYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVN 1306
            Q NY+ T+   D    G     G++   + V D NDN PVF+++ Y   I ENA VG  +  ++A+D DSG   QV+Y+F      +   +F +++  GE+ L   L+ + +A+ + L + A D G VPK+    TV + + D+++  P   + S    +    ++EN  + S    +   DGD+G+N
Sbjct:    6 QDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNAT-ATQTPFFSLNSVNGELTLGGPLDFE-VARSYMLVVIAEDLG-VPKLESRTTVIIEVTDISDMPPRF-LQSFYLKE----IEENTPIGSTVVTVEARDGDVGIN 185          

HSP 20 Score: 63.1586 bits (152), Expect = 5.994e-10
Identity = 54/193 (27.98%), Postives = 85/193 (44.04%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKL-QVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG--DDLVYIDAIIGDLRARQSI 2391
            D NDN P     P + ++ EN       L +I A D D G N  V++                  +T  FS++ ++G LT+   LD E   SY+L ++  D G P+L S   + + V DI+D PP++ Q   +   I   + +     ++  +A D D   N  I Y +  G  D +  ID+  G +    SI
Sbjct:   38 DYNDNAPVFTEQPYMAKIAENARVGTTIL-KISAIDADSGTNSQVQYKFSNAT----------ATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSF-YLKEIEENTPIG--STVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNGSI 216          

HSP 21 Score: 62.003 bits (149), Expect = 1.407e-9
Identity = 73/269 (27.14%), Postives = 115/269 (42.75%), Query Frame = 1
Query: 1528 FTKV*KAELYSERVGKQYNWSAVATSSCDRR*RHRTIAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE 2331
            FT+   A    E V   +    VAT+  D     R     +   +  +F +++  G + T + LDRE+     LI+ A D G P  ++ T+ +     DVNDN P + +     V   E   L   + Q+ A DPD G NG   + I         A   D+    +F ID  +G +TI   LD E    Y L +   D G P LT    + + V D++DN P + +P  +S  +     + +   +I   A+D D+  +    Y+  E
Sbjct: 1503 FTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIE-DVNDNKP-LFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKIT--------AGDTDD----VFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKP-RYSAELYEN--VTRGHHVITVNATDIDAEASHKRVYYRIE 1754          

HSP 22 Score: 57.3806 bits (137), Expect = 3.823e-8
Identity = 49/170 (28.82%), Postives = 81/170 (47.65%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQ--VKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPK-----WFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNA 2307
            DVNDN P V N  K    V EN  T    L ++ A D D G NG + + +             + N+   FSI+ ++G +T+   +DRE + +++L +   DQG+P    +   + +TV D NDN P+     +   +A ++ + +   +  DQ+ I +    P S P A
Sbjct:  912 DVNDNDP-VFNQSKYAADVLENSPTGTPVL-RVHASDRDQGANGKITYKLT------------NGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQK-ISSSTLRPRSSPRA 1066          

HSP 23 Score: 53.5286 bits (127), Expect = 6.361e-7
Identity = 45/174 (25.86%), Postives = 81/174 (46.55%), Query Frame = 1
Query: 1822 DVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGK-PQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD 2340
            +VNDN P           + E T    +  I A D DLG  G + + +      RG        +   FS++  +G ++  + LD + +  Y   ++V D G   Q  +I  +T+T+ D+NDN P+ F  + ++++I     L     +    A+D DS  N  ++++++ GDD
Sbjct:  381 NVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYEL------RG-------GQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPE-FTGMPYTSDIAEN--LPAGTIVFQVTATDKDSGENGRLSFNISAGDD 538          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000005325.2 (protocadherin-16 [Source:NCBI gene;Acc:101171352])

HSP 1 Score: 177.563 bits (449), Expect = 3.578e-62
Identity = 136/448 (30.36%), Postives = 211/448 (47.10%), Query Frame = 2
Query:  272 VGNFVGNLNIDSNIFKIQPKSTFKLY-----DDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFM------HGFNDTFNITFSNLLYL--IVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQ-DPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
             G  VG+++       + P  T +LY     +   +     ++E+TG +   +R+DRE+    SF A+    I + +          IT+ D+NDH P+F +    ++I E   VG R SL  A+D D +      Y +      H F      + + +LYL  +V   LD E + +Y   + A D G P   G  TL ++V DIND+ PVF+Q  Y  II E+   G  +  V A D D G  G V Y   + Q DP    YF I   +G I L R L+ + + +   L ++A D  S P+V  A V +H++D N+ +P + I  L        + E      + A I V+D D G  A V+  L  G   F L+   ++    IY +  ++V DRE    + +R++ +D GTP L  E   T+++ DVN+  P F +Q Y   + E
Sbjct:   41 AGTIVGDISA-----GLPPGETARLYFISDHEGTGVGSDLDIDETTGIITTKRRLDREERDHYSFIAVTMTGITIEV---------SITVNDINDHAPEFPKKKALLKIPEHTVVGTRFSLDPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISESLPQGSSILQVFAADEDEGDNGLVLYEINRRQSDPE--RYFVIDLKSGVITLNRPLDYE-LKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLS-EDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSI----IYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPE 466          

HSP 2 Score: 82.8037 bits (203), Expect = 3.578e-62
Identity = 75/228 (32.89%), Postives = 109/228 (47.81%), Query Frame = 1
Query: 1657 KSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDR-EYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG 2334
            K K  F ID   G + TA  LD E      + V+A D G P   ++T  V I + DVNDN P    N   + VKEN      FL ++ A D D G  GT+ +          L  K        F+I++ +G L    +LDR E ++ Y L +   D G   L+S   + + V+DINDN P ++ PV ++ +++T S  A    ++   A+DPD+  N  ITY    G
Sbjct:  496 KGKKWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRP-PLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFL-EVSATDEDRGSFGTITY---------ALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGG--LSSAVGVRVKVMDINDNRPTFY-PVLYTVSLSTHS--APGTSVVKVTANDPDAGENGRITYRTVPG 707          

HSP 3 Score: 99.7525 bits (247), Expect = 1.342e-38
Identity = 130/494 (26.32%), Postives = 219/494 (44.33%), Query Frame = 2
Query:  182 LVSLMQIQIQI-----SVGNEFNRNIHYAVKEEIDVGNFVGNLN----IDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIF---VPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVE-PNNVCTYFM-HGFNDTFNITFSNLL--YLIVINALDYETQ----INYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVF-VHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQP-------NRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            L S  QI+IQ+     S+      ++   V E    G+ +G++      +SN+ + Q   T+ + D       F ++   G + + + +D E+   +S+T      +E++ F    P  Y + + I +QD NDH P+F+E    I I E  + G  I    A D D   PN+   Y + H +  T ++   + L   L +   LD E+     +  + T  A D       G+ T  + V D NDN PVFS     + + E+  VG V+ +V A D D G  G+V YR   +Q  +    F +S  TG + + + L+ +   + F+L I A D G +P++  + V  V + DVN++ P+      G      +V EN+   +    +  +D D G N     H+T G               D + + P        +  D E+ +H+ + +   D G P    +  + V++QDVN+ +P F K  Y + V EN
Sbjct: 1289 LSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQ--VTYLVVDGTDRDGTFMVDRLRGDVYLVRELDYEKG--SSYT----LHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPGASIYAFQAGDQDGSGPNSELRYSIEHQWPQTSDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQ-RRWGSVTARLFVKDENDNPPVFSSPS-AISVMEDQPVGFVILHVMAHDADEGENGRVSYR---IQSGNNAGRFSLSPNTGSLSILKALD-REEQEVFNLTIVAEDHG-IPQLSTSQVLCVQVIDVNDEAPMFQQAEFG-----THVMENKGPGTTVLKVTATDRDQGSNG----HITYGGVT-----------EDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPEN 1747          

HSP 4 Score: 81.6481 bits (200), Expect = 1.342e-38
Identity = 78/268 (29.10%), Postives = 131/268 (48.88%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKP-QLTSIEAITLTVLDINDNPPKWFQ-PVAHSTNITTKSVLAQDQRIIIA-QASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQ---SIREGHYLIKLVANDNGNPNLST 2454
            F +    G L T++ LDREK  K  L V+A+D+G P + +AT TV + + DVNDN P    N   ++V EN E     L Q+ A D D G NG + +++ +  D               F++DE +G +T    LDRE + SY   +   D      + S   + +T+LD+NDN P + Q P+     ++++    + QR++   +A D D   N ++ Y          I+++ G+++A +   S+ +    + + A D G+P  S 
Sbjct: 1782 FQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSP-ALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVL-QVSATDVDEGLNGKILYFLSQEADG-------------AFAVDEDTGRITTAAPLDREKLASYNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFIQDPLI--IEVSSR----RSQRVLATMKAEDKDFGANGSVFYRFATPVKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSA 2028          

HSP 5 Score: 109.768 bits (273), Expect = 4.482e-38
Identity = 100/359 (27.86%), Postives = 160/359 (44.57%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF-SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD-GGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            + +QDVND+ P FA+ +Y +++ E  Q    +    A+DPD  P     Y +   +   +    S    L   + LD E +  Y   +VA D G P L    T+ + VLD+NDN PVFS+  Y V + ENA  G  V  V+A D+D GL G++ Y   Q  D      F +   TG I     L+ + +A  ++  + A D   SVP    A V V + DVN+  P    +   P   + + + +Q ++   A +   D D G N  V        + F + NS T +      +Q          +   + +   D+G+P  +    + V +++V     RF K    V++ EN++ G
Sbjct: 1723 VEVQDVNDNAPVFAKMWYGLEVPEN-QPAVELCFVKATDPDSGPGGELEYKIAAGDPDGDFQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEAD----GAFAVDEDTGRITTAAPLDREKLAS-YNFRVFAVDLSPSVPINSSAQVKVTILDVNDNAPFFIQD---PLIIEVSSRRSQRVL---ATMKAEDKDFGANGSVFYRFATPVKGFSI-NSLTGE------IQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARDVSIQENASKG 2062          

HSP 6 Score: 69.707 bits (169), Expect = 4.482e-38
Identity = 58/215 (26.98%), Postives = 98/215 (45.58%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNL--RTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRP 2301
            K LF I    G +   ++N LD E+  ++ L+V A    E  S T+     + + DVNDN P       +   +  +   M + Q+ A D D G+NG V + IQ              + + +F ID ++G++T    +DRE      L +   D+G P+L  +  +T+ ++D NDN P    P+     I   +++  +  I +   +D DS P
Sbjct: 2090 KHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKA----ETVSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQ------------SSSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTI--PLPQEIRIPENTLIGTE--ITLVTGNDVDSSP 2284          

HSP 7 Score: 155.221 bits (391), Expect = 1.272e-37
Identity = 128/411 (31.14%), Postives = 193/411 (46.96%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIT---IQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS-NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAE--NFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
             +L+  +G L I Q++DRE    T F  L     +  + +    W +V     ++D ND+ P F+ S   I + E   VG+ I    A D D   N   +Y +   N+    + S N   L ++ ALD E Q  +  T+VA D G+P L  +Q L + V+D+ND  P+F Q E+   + EN   G  V  VTA D D G  G + Y  G  +D      F I+  TG I   + L+ + +   + L + A DGG  P    A V V ++DVN+  PV      G       V ENQ  +     +  +D D G   E++  +  G    +F+L +S+T        L  +   DRE    + + ++  DRG+P L+    + VK+ DVN+ SP F K +YTV V EN+  G
Sbjct: 1469 LALDPLSGVLTIRQQLDRES---TPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFS-SPSAISVMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAPMFQQAEFGTHVMENKGPGTTVLKVTATDRDQGSNGHITYG-GVTED-----GFVINPLTGVITTTKELDAE-LQNHYVLTVYARDGGLPPNFAKAVVRVEVQDVNDNAPVFAKMWYG-----LEVPENQPAV-ELCFVKATDPDSGPGGELEYKIAAGDPDGDFQL-HSRT------GALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVFSKNSYTVEVLENAEEG 1855          

HSP 8 Score: 96.6709 bits (239), Expect = 2.303e-37
Identity = 77/262 (29.39%), Postives = 120/262 (45.80%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQX--XXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVY--IDAIIGDLRARQSIREGHYLIKLVANDNGNP 2442
            L  +D   G L     LDRE    + L+V A DQ    SQ    + T  + + D NDNPP   +P  + V E++  +   +  + A D D GENG V + IQ              N    FS+   +G+L+I K+LDRE  + + L I+  D G PQL++ + + + V+D+ND  P  FQ     T++           ++   A+D D   N +ITY     D  V   +  +I   +   +  + HY++ + A D G P
Sbjct: 1468 LLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTARLFVKDENDNPPVFSSPSAISVMEDQP-VGFVILHVMAHDADEGENGRVSYRIQ------------SGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLSTSQVLCVQVIDVNDEAP-MFQQAEFGTHVMENK--GPGTTVLKVTATDRDQGSNGHITYGGVTEDGFVINPLTGVITTTKELDAELQNHYVLTVYARDGGLP 1713          

HSP 9 Score: 80.4925 bits (197), Expect = 2.303e-37
Identity = 105/431 (24.36%), Postives = 179/431 (41.53%), Query Frame = 2
Query:  338 FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQ----KEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGR--------DIYTLQPNRVFDREVDSHFQVRMLCSD--RGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            ++L  DG     F +   +G L +   +DRE       T L   +   T           +T+ D ND+ P+ ++    + + E +  G      +A+D D   N   TY +   +  F I  S    +    ALD E Q +Y+  +V  D G PP     T  ISVLD ND+ P F+      E    ++E    G +V +V A D D G  G V Y        S +  F ++  TGE+K    L     A+ ++  + A+D G+ P +  +T  + ++ +++ R +   N L       NV E     S   II    G +G   + + ++  G   + + +     G         D+Y +   R  D E  S + + +  SD  +  P  +   ++ + +QD N+ +P+F +   T+ + EN   G
Sbjct: 1029 YRLRPDGDAAG-FGIMPDSGWLFVRSSLDREAKDMYLLTVLATSRHSGTGRT--GSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHADKHFQIN-SQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSG----SRVERFSLNPNTGELKTASPLRWAERAE-YTFTLTAADHGT-PGLS-STCQIRIQVISSSRSIPKPNVL---SMTLNVVEGTAPGS---II----GSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGDVYLV---RELDYEKGSSYTLHVEVSDFSKAFPN-SYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEPG 1434          

HSP 10 Score: 112.464 bits (280), Expect = 1.305e-33
Identity = 93/356 (26.12%), Postives = 149/356 (41.85%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
             I + DVND+ P F +  Y+  I E V  G  +   TA D D  PN    Y +      F+I     + +    ALD+E++     T++A D G PPL     + I V D+NDN PVFS   Y V +KEN   G     V+A D D G FG + Y        +V + F I+  TG++     L+     + + L + A+DGG +       V V + D+N+ RP     +  P     ++  +    +    +  +D D G N  +      G  +  F L+       +D   +  +R    + ++   + +   D           + V I   +  SP F++  Y   VSE+
Sbjct:  442 TIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGKKWFSIDPITGI-ITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGGLSSA--VGVRVKVMDINDNRP-----TFYPVLYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLN-------KDTGVISLSRSLHSKANTVISMVITAVDGDGLTAPVNARVNVSIVGGSTSSPVFEQAQYFFTVSED 782          

HSP 11 Score: 52.373 bits (124), Expect = 1.305e-33
Identity = 50/159 (31.45%), Postives = 75/159 (47.17%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEET-LPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTS 2145
            F +D   G +RTA  LD E    ++L + A   G P S    + V I+I+D+NDN PT +      +   E T +   + +IQA D D G NG + F +         A     +  + F ID  SG + +  SL  + +  Y L ++  D G PQL+S
Sbjct:  817 FTVDSTSGTIRTALPLDHETCSSLDLEIQA-RYGSPPS-YGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLIS-------AGAAGSSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSS 966          

HSP 12 Score: 117.087 bits (292), Expect = 5.525e-32
Identity = 121/427 (28.34%), Postives = 183/427 (42.86%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSF--TALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPD----------VEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLA---ISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGV-NAEVDCHLTVGAEN--FKLSNS-QTVKGRD---IYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F ++  TG +     +DRE    T    TA DR    L     +      + I D ND+ P       +I+I E   +G  I+L T +D D          ++P  +  + +H +    +IT            LD+E +  Y  T+ A D        +QT A   I V DINDN P+F+   Y++ + E+   G  V  VTA D DSG  G+V YR       S    FYI    G + +             ++ IEASDGGS       TV VH+ D+N+  PV +      ++    V E+    S   I    D D+   N   D  +  G E   F++ +S + ++GR    + TL      D E  S + + ++ SDRG P+ ++     + I DVN+  P F +  YTV +SE +  G
Sbjct: 2197 FKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATL-----TVIIIDQNDNSPTIPLPQ-EIRIPENTLIGTEITLVTGNDVDSSPALSYSLLLDPTALGKFGIHRYTGGVSIT----------GPLDFEEKTWYTVTVQATDSQ------HQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMS----STQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHISDINDNAPVFH-----QSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSG 2592          

HSP 13 Score: 41.9726 bits (97), Expect = 5.525e-32
Identity = 46/155 (29.68%), Postives = 67/155 (43.23%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG 2127
            LF IDQ+ G LR    LDRE      +I+ A D    +   A   V + + DVNDN P    P +      +E LP    +T + A D D G  G +++Y         + E+    R   F I++ SG +      D E I+S+    +  D G
Sbjct: 2623 LFSIDQWTGALRLQRALDREHQSTHVVIIQATDG---QGYFALVPVIVDVKDVNDNHPYF--PVETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYY---------MMERSGSGRDS-FVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSG 2762          

HSP 14 Score: 124.02 bits (310), Expect = 5.781e-28
Identity = 120/445 (26.97%), Postives = 194/445 (43.60%), Query Frame = 2
Query:  362 LLKYFSLEESTG-KLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWIN-----------------------VITIQDVNDHQPK----FAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN-LLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVK-----GRDIYTLQPNRVFDR-EVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +L+ F+ +E  G   ++   I+R Q  P  +  +D     +T+  P+DY +                         I ++D ND+QP     F       +ISE  Q G  ++  + +DPD          + G +  F +T  + ++YLI ++  LD E + +Y   ++A D G PPL    +  I V D+NDN P+F Q+ Y+  I E    G  V  VTA D D G  G VRY   + +      +F I   TG I     L+ ++     S+ + A+DGG  P    A V + ++DVN+  PV + N       + +VKEN    + F  +  +D D G    +   LT       L +  TV+      +    L      DR E    + + +  +D G   L++   + VK+ D+N+  P F    YTV++S +S  G
Sbjct:  257 ILQVFAADEDEGDNGLVLYEINRRQSDPERYFVIDLKSGVITLNRPLDYELKRVHELVVQARDNASQPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRISEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGK-----KWFSIDPITGIITTATALDFESEPAP-SVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVFSSNFY-----NVSVKENTPAGTCFLEVSATDEDRGSFGTITYALT-------LKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGG--GLSSAVGVRVKVMDINDNRPTFYPVLYTVSLSTHSAPG 681          

HSP 15 Score: 86.6557 bits (213), Expect = 1.758e-27
Identity = 77/294 (26.19%), Postives = 134/294 (45.58%), Query Frame = 2
Query:  719 YLIVINALDYETQINYKTTLVACD--CGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGP-AKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG-AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +L V ++LD E +  Y  T++A     G     G+ T+ ++V D NDN P  SQ+   + ++EN + G     V+A D D+GL  ++ YR           +F I++ TGEI  +  L+ +     + L +   DGG+ P+    T  + + D N+  P      + P  ++ F V+E     +    +   D D G N  V   L+    E F L N  T    ++ T  P R  +R   + +   +  +D GTP L++  +I +++   +   P+    + T+NV E +  G
Sbjct: 1048 WLFVRSSLDREAKDMYLLTVLATSRHSGTG-RTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHAD-----KHFQINSQTGEISTRLALD-REQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPT--FTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSL-NPNT---GELKTASPLRWAER---AEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPG 1325          

HSP 16 Score: 57.3806 bits (137), Expect = 1.758e-27
Identity = 73/276 (26.45%), Postives = 117/276 (42.39%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPD-LGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQG----KPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQ----RIIIAQASDPDSRPNANITYHVTEGDDLVYID-----AIIGDLRARQSIREGHYLIKLVANDNGNPNLST 2454
            F +D+  G++     LD EKG    L V   D  +    +    + I + D ND+ P    +P  + + EN+E     +   QA D D  G N  +R+ I+    +           + + ++D +SG LTI + LDRE      L +   DQ     + +  S+ A  L V D NDNPP +  P A S        + +DQ     I+   A D D   N  ++Y +  G++            +  L+A     +  + + +VA D+G P LST
Sbjct: 1360 FMVDRLRGDVYLVRELDYEKGSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAPQFSEDPVTIVIPENKEP-GASIYAFQAGDQDGSGPNSELRYSIEHQWPQT----------SDLLALDPLSGVLTIRQQLDRESTPFLYLVVRATDQAVDLSQRRWGSVTA-RLFVKDENDNPPVFSSPSAIS--------VMEDQPVGFVILHVMAHDADEGENGRVSYRIQSGNNAGRFSLSPNTGSLSILKALDREEQEVFNLTIVAEDHGIPQLST 1615          

HSP 17 Score: 75.8702 bits (185), Expect = 1.915e-26
Identity = 81/273 (29.67%), Postives = 133/273 (48.72%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANI--LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLG-ENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-----------EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIREGHYLIKLV 2421
            S ++  F+ID   G L   +    D E+   + +++ A D G P + ++ TTV + I+D+NDN P V +  + +   +E+T P   L   +A D DL  EN    F I             + N   +F I+           +  G L + + LD E    Y L ++V D+G PQ +S  A  +T+ D+NDNPP + +P  ++  ++  +V   +  II   A+DPDS PNA + Y ++ GD+  L  ID   G LR ++++   H    +V
Sbjct: 2395 SSTQEGFYIDPSNGTLFINHRAEFDPER-PSVNIVIEASDGGSP-ALSSLTTVQVHISDINDNAP-VFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIA------------NGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRP-EYTVALSEGAVSGTE--IIRLTATDPDSTPNAEVQYTISSGDEMNLFSIDQWTGALRLQRALDREHQSTHVV 2649          

HSP 18 Score: 64.3142 bits (155), Expect = 1.915e-26
Identity = 83/355 (23.38%), Postives = 148/355 (41.69%), Query Frame = 2
Query:  551 KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVC-TYFMHGFNDTFNITFS-NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVL--DINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGR---DIYT--LQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            +F+++   + I E    G  ++   A  PD     +  + F       F I+ S   +++   N LD+E     +  + A       +     +A +++  D+NDN P F  + Y   +KE       +  V A D+D G  GQV Y    +Q  S+   F I   TG I    I++ + I     L + A+D GS    G AT+ V + D N+  P I      P  ++  + EN  + +   ++  +D D           +  A ++ L    T  G+     YT  +      D E  + + V +  +D    +  TE  IT+ ++D+N+ +P F    Y +++ E++  G
Sbjct: 2045 RFSKNARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNKKHLFKISSSTGEIWVESSNGLDFEETPRLRLVVKAET-----VSSTSFMAFNLVLQDVNDNLPRFQLQNYVAFMKEAQGYEMPIIQVVAEDVDQGQNGQVTY---SIQSSSMSGLFKIDPVTGSITTTAIMD-REIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTI------PLPQEIRIPENTLIGTEITLVTGNDVD-----------SSPALSYSLLLDPTALGKFGIHRYTGGVSITGPLDFEEKTWYTVTVQATDS---QHQTEANITIVVEDINDNAPLFTHDLYQISLPEHTPPG 2370          

HSP 19 Score: 112.079 bits (279), Expect = 2.290e-24
Identity = 109/431 (25.29%), Postives = 184/431 (42.69%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTS---FTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNI-------------TFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGY---ATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNR-------VFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F ++ S G L I  R + +   P+      A D     L+    +      + I D+ND+ P F +S Y+  +SE    G  + +  A D D+   N    F     +  N+              F  +  L++   LD+ET+  Y  T+V  D G+P    +    I++ D+NDN PVFS+ EY V + E A+ G  +  +TA D DS    +V+Y      +   ++ F I  +TG ++LQR L+ ++ +    + I+A+DG      GY     V V +KDVN+  P   + +L        ++EN    S   ++   D D GV  ++  ++            ++  GRD + ++ N         FD E  + F    +  D G    T   ++ V  +D  E+ P F   ++   V E +  G
Sbjct: 2401 FYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQ-----VHISDINDNAPVFHQSEYRAMVSEDTFPGSTLLIFEAFDNDLSRENCGFDFAIANGNEGNVFQIESSVRFLEGRGFQTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQRSSSVAALITIGDVNDNPPVFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDE---MNLFSIDQWTGALRLQRALDREHQSTHVVI-IQATDG-----QGYFALVPVIVDVKDVNDNHPYFPVETL-----TATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMM----------ERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVAVAVDSGNHSATVTVQVFVTGED--EYDPLFTSTDFAFEVPEGAKKG 2800          

HSP 20 Score: 82.0333 bits (201), Expect = 4.013e-19
Identity = 78/280 (27.86%), Postives = 121/280 (43.21%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-------NPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            F ID   G +     LD E     EL+V A D    + +     V I + D NDN PT+          P++    +E   P  ++ +I   DPD GE   V   ++  + K  L  K           D I   + + + LDRE  DSY L +M  D G P L +  + T+ V D+NDNPP + Q    +   T   V+     ++   A D D  PN ++ Y + +G     ID I G +    ++    E    + ++A D G P LS+  K+++ +
Sbjct:  288 FVIDLKSGVITLNRPLDYELKRVHELVVQARDNAS-QPEVTNAFVTIHVRDFNDNQPTMTIIFLSEDGSPRI----SEGAQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTK-----------DSIIYLIYVDQVLDREERDSYDLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQ---QAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGKKWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVV 548          

HSP 21 Score: 33.8834 bits (76), Expect = 4.013e-19
Identity = 33/151 (21.85%), Postives = 63/151 (41.72%), Query Frame = 2
Query: 1151 VFVHLKDVNNQRPVININSLGPAKKDF-NVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVG--------AENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            V + + D+N+  P        P KK    + E+  + + F++      D   +A+ D   T G           FKL + ++        L  + + DRE  S + + +   D G+P+      + V + D+N+ +P F +  Y   +SE+
Sbjct:  112 VSITVNDINDHAPEF------PKKKALLKIPEHTVVGTRFSL------DPATDADKDQLTTQGYAIKEGNVGHMFKLESKRSANKVLYLDLVVSGLLDREKRSSYSLVIEAFDGGSPRRVGFMTLEVTVTDINDHAPVFNQSRYHAIISES 250          

HSP 22 Score: 82.4185 bits (202), Expect = 2.730e-15
Identity = 102/431 (23.67%), Postives = 175/431 (40.60%), Query Frame = 2
Query:  338 FKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPT---SFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTY---------FMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHL-TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDS--HFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTI 1585
              L   G +   F++ + TG+L  A  +DR++       + TA D   +   + V        + + D+ND++P F    Y + +S     G  +   TA+DPD   N   TY         F     DT  I+ S  L+          T I+   T V  D    P+  N  + +S++  + + PVF Q +Y   + E+ + G  V  V A    +G+   + Y      DP    YF + + +G I+    L+ +  +    L I+A  G S P  G + V + + D+N+  P    +S          K    +      I  +D D G N ++   L + GA     S+ Q   G D  + +   +     DS   + ++++  D G P+L++   + V IQ  +   P F    Y V + EN+ +
Sbjct:  597 LTLKSGGTVQTPFTINKQTGQLCTASALDRDEGLEKYDLTVTATDGGGLSSAVGV-------RVKVMDINDNRPTFYPVLYTVSLSTHSAPGTSVVKVTANDPDAGENGRITYRTVPGGSSPFFTLNKDTGVISLSRSLHSKA------NTVISMVITAVDGDGLTAPV--NARVNVSIVGGSTSSPVFEQAQYFFTVSEDVLRGTAVGVVRAA-TKTGVSKGIYYSISS-GDPD--GYFTVDSTSGTIRTALPLDHETCSS-LDLEIQARYG-SPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYR----IQATDKDSGHNGQLSFDLISAGAAG---SSGQRTFGIDRGSGEVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPL 999          

HSP 23 Score: 79.7221 bits (195), Expect = 1.693e-14
Identity = 67/237 (28.27%), Postives = 107/237 (45.15%), Query Frame = 1
Query: 1636 IAIPTRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP------MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVT 2328
             A+ T+     L ++DQ         +LDRE+ D  +L V+A D G P  +  ++       DVNDNPP          +   +T+P       F+ Q+ ARD D G NG VR+ + + +              K FSID I+G +T   +LD E   +  + ++  D G+P L+S   + + V D+NDN P +    ++  N++ K         +   A+D D      ITY +T
Sbjct:  395 FALTTKDSIIYLIYVDQ---------VLDREERDSYDLRVMATDSGTPPLRAESSFTIQVT-DVNDNPPL------FDQQAYRQTIPEVVYPGSFVLQVTARDKDQGPNGDVRYSLLKGK--------------KWFSIDPITGIITTATALDFESEPAPSVTVIATDGGRPPLSSTAKVDIVVQDVNDNAPVF---SSNFYNVSVKENTPAGTCFLEVSATDEDRGSFGTITYALT 598          

HSP 24 Score: 74.3294 bits (181), Expect = 7.679e-13
Identity = 99/410 (24.15%), Postives = 177/410 (43.17%), Query Frame = 2
Query:  371 YFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV--ITIQDVNDHQPKFAESYYQIQISEAV-QVGYRISLRTASDPDVEPNNVCTYFM-------HGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDS--------GLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSL--NIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRF 1540
            YF+++ ++G +  A  +D E  C    ++LD  +I+     P  Y I+   I+I D+ND+ P F  S  +  +   V ++G  I    A+D D   N   ++ +            TF I   +   + +I +L Y++   Y   ++A D G P L    TL + +   +   P F    Y+V ++ENA +      V A++ ++         +   + YR     D    + F I   +G + ++  L+ +  A+D  L   +  S      + G ATV V + D N+  P      L   +    V+EN    + F  +  +D D G+NA +   L    ++F++ NSQT +      +      DRE  S +Q+ ++  D GTP  +      + + D N+ +P F
Sbjct:  816 YFTVDSTSGTIRTALPLDHE-TC----SSLD-LEIQARYGSPPSYGISRVHISISDINDNAPTFLPSSSESLLLPEVTKMGTVIYRIQATDKDSGHNGQLSFDLISAGAAGSSGQRTFGIDRGSG-EVRLIGSLSYDSVPRYDLQVIAKDGGAPQLSSTFTLVVHIQAQDAQGPNFDTLTYRVELRENAPLNTRFLQVRALNREASGNGGSSSSISSSISYRLRPDGD---AAGFGIMPDSGWLFVRSSLDRE--AKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSP-----RLSQERVFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLLHADKHFQI-NSQTGE------ISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTF 1201          

HSP 25 Score: 70.0922 bits (170), Expect = 1.618e-11
Identity = 76/273 (27.84%), Postives = 119/273 (43.59%), Query Frame = 1
Query: 1693 GNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTN--ITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-DLVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPNLSTEIKINLYISSKS 2490
            G L   + LDRE  D   L VLA  +     +T + TV +T+TD NDN P +      L V+EN      F  ++ A D D G N  + + +   +              K F I+  +G ++   +LDRE   SY L+++V D G P  ++     ++VLD ND+ P  F  V   T      +  L     +    A DPD   N  + Y ++    +   ++   G+L+    +R      Y   L A D+G P LS+  +I + + S S
Sbjct: 1047 GWLFVRSSLDREAKDMYLLTVLATSRHSGTGRTGSATVRVTVTDENDNSPRLSQERVFLAVRENLVAGTGF-GRVSATDRDAGLNARLTYRLLHAD--------------KHFQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPT-FTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSS 1303          

HSP 26 Score: 69.3218 bits (168), Expect = 2.639e-11
Identity = 78/295 (26.44%), Postives = 141/295 (47.80%), Query Frame = 1
Query: 1684 QYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCD-QGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE----GDDLVYIDAIIGDLRAR-----QSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRV 2535
            Q +G L  A  LD E      L V+  D+G P+ ++++    ITI DVNDNPP V + P+  V  +E  +    + ++ A DPD   N  V++ I   ++              +FSID+ +G L + ++LDRE+  ++++ I   D QG   L     + + V D+NDN P +  PV  +   T +  L  +  + +  A D D+     + Y++ E    G D   I+   G++R++     + I   +++   VA D+G  N S  + + ++++ +  +  +   +D  F V
Sbjct: 2523 QTVGTLLLAEGLDFETKSLYNLTVVVSDRGVPQ-RSSSVAALITIGDVNDNPP-VFSRPEYTVALSEGAVSGTEIIRLTATDPDSTPNAEVQYTISSGDE------------MNLFSIDQWTGALRLQRALDREHQSTHVVIIQATDGQGYFALV---PVIVDVKDVNDNHPYF--PV-ETLTATIQENLPANSPVTVLHAIDHDTGVFGQLKYYMMERSGSGRDSFVIEQNSGEVRSKIPFDFEKINSFNFVA--VAVDSG--NHSATVTVQVFVTGEDEYDPLFTSTDFAFEV 2793          

HSP 27 Score: 68.9366 bits (167), Expect = 2.871e-11
Identity = 82/292 (28.08%), Postives = 127/292 (43.49%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVL---AQDQRIIIAQASDPDSRPNANITYHVT-EGDDLVYIDAIIGDLRARQSI-RE--GHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDD 2523
            F I+   G + T   LD E  +   L V A D G P    A   V + + DVNDN P        L+V EN+  + +    ++A DPD G  G + + I         A   D +    F +   +G L+    LDRE    Y L ++  D+G P L++   + + VLD+NDN P +      S N  T  VL    +  +++   A+D D   N  I Y ++ E D    +D   G +     + RE    Y  ++ A D     LS  + IN   SS     T+++++D+
Sbjct: 1678 FVINPLTGVITTTKELDAELQNHYVLTVYARDGGLP-PNFAKAVVRVEVQDVNDNAPVFAKMWYGLEVPENQPAVELCF--VKATDPDSGPGGELEYKIA--------AGDPDGD----FQLHSRTGALSTSHGLDREKKPKYTLEVVAVDRGSPALSATATVEVKVLDVNDNSPVF------SKNSYTVEVLENAEEGYQVLQVSATDVDEGLNGKILYFLSQEADGAFAVDEDTGRITTAAPLDREKLASYNFRVFAVD-----LSPSVPIN---SSAQVKVTILDVNDN 1940          

HSP 28 Score: 68.1662 bits (165), Expect = 5.227e-11
Identity = 78/281 (27.76%), Postives = 120/281 (42.70%), Query Frame = 1
Query: 1654 SKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-TEGDDLVYIDAIIGDL----RARQSIREGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            S    LF ID   G++ T  I+DRE   + +L+V A D+G PR      T+ + I D NDN PT+  P ++++ EN   +   +T +   D D     +    +    D   L +         F I   +G ++I   LD E    Y + +   D    Q  +   IT+ V DINDN P +   +     I+          +I   A+D DS  N  + Y V +   +  YID   G L    RA          I + A+D G+P LS+   + ++IS
Sbjct: 2191 SSMSGLFKIDPVTGSITTTAIMDREIFTQTKLVVTATDRGSPR-LAGLATLTVIIIDQNDNSPTIPLPQEIRIPENT-LIGTEITLVTGNDVDSSPALSYSLLL----DPTALGK---------FGIHRYTGGVSITGPLDFEEKTWYTVTVQATDS---QHQTEANITIVVEDINDNAPLFTHDLYQ---ISLPEHTPPGSAVITVTATDRDSGENGRVNYRVMSSTQEGFYIDPSNGTLFINHRAEFDPERPSVNIVIEASDGGSPALSSLTTVQVHIS 2450          

HSP 29 Score: 65.0846 bits (157), Expect = 5.402e-10
Identity = 107/420 (25.48%), Postives = 178/420 (42.38%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQ--------INYKTTLV--ACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRI--LNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            F+++E TG++  A  +DRE++   +F       ++L+  VPI+    V +TI DVND+ P F      IQ    ++V  R S R  +    E  +       G N +    F+  +    IN+L  E Q           + TL+  A D G P    +  + + V ++  N   FS+    V I+ENA  G  VA   A   D    G     F   +       F IS+ TGEI ++    L+ +   +   L ++A    +V    +    + L+DVN+  P   + +       F +KE Q        +   D D G N +V   +   + +  FK+     V G    ++    + DRE+ +  ++ +  +DRG+P+L     +TV I D N+ SP        + + EN+ IG
Sbjct: 1886 FAVDEDTGRITTAAPLDREKLASYNFRVF---AVDLSPSVPINSSAQVKVTILDVNDNAPFF------IQDPLIIEVSSRRSQRVLATMKAEDKDF------GANGSVFYRFATPVKGFSINSLTGEIQATEPLGSLTQAQRTLIVEAMDQGSPAQSAHGVVVVYVKEVEYNGIRFSKNARDVSIQENASKGTAVAQAQAEYPDGTRQGISYSLFSGNKK----HLFKISSSTGEIWVESSNGLDFEETPR-LRLVVKAE---TVSSTSFMAFNLVLQDVNDNLPRFQLQNY----VAF-MKEAQGYEMPIIQVVAEDVDQGQNGQVTYSIQSSSMSGLFKI---DPVTG----SITTTAIMDREIFTQTKLVVTATDRGSPRLAGLATLTVIIIDQNDNSPTIPLPQ-EIRIPENTLIG 2269          

HSP 30 Score: 60.8474 bits (146), Expect = 1.071e-8
Identity = 68/243 (27.98%), Postives = 105/243 (43.21%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV--INPPKLQVKENEETLP--MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRI-IIAQASDPDSRP-NANITYHVTEG---DDLVYIDAIIGDL 2373
            F I+   G + T   LDRE+    +L V+  D G P  ++AT T  I++ D ND+ PT   + P   ++ E  E LP    +  + A+DPD GENGTV +              +  +R + FS++  +G L     L       Y   +   D G P L+S   I + V+  + + PK   P   S  +      A    I  + Q   P+S      +TY V +G   D    +D + GD+
Sbjct: 1144 FQINSQTGEISTRLALDREQQSSYQLFVVVQDGGTP-PRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYY-------------SLSGSRVERFSLNPNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPK---PNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRDGTFMVDRLRGDV 1369          

HSP 31 Score: 59.3066 bits (142), Expect = 3.149e-8
Identity = 74/335 (22.09%), Postives = 132/335 (39.40%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPID---------YWINVITIQDVNDHQPKFA----ESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFN-DTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSG--LFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASD-GGSVPKVGYATVFVHLKDVNNQRP 1189
            +  AV+E +  G   G ++       +  + T++L       K+F +   TG++     +DREQ            Q    +FV +               I++ D NDH P F     ++    ++ E +  G  +    A DPD   N    Y + G   + F++   N   L   + L +  +  Y  TL A D G P L     + I V+  + + P  +     + + E    G ++ +V  VD      L GQV Y    G  +D      F +    G++ L R L+ +     ++L++E SD   + P      + ++++D N+  P
Sbjct: 1103 VFLAVRENLVAGTGFGRVSATDRDAGLNARLTYRLL---HADKHFQINSQTGEISTRLALDREQ------------QSSYQLFVVVQDGGTPPRSATGTAHISVLDENDHAPTFTHVRPDTERMFEVREGLPSGTMVGSVAAKDPDEGENGTVYYSLSGSRVERFSLN-PNTGELKTASPLRWAERAEYTFTLTAADHGTPGLSSTCQIRIQVISSSRSIPKPNVLSMTLNVVEGTAPGSIIGSVGQVDKPESNVLEGQVTYLVVDGTDRD----GTFMVDRLRGDVYLVRELDYEK-GSSYTLHVEVSDFSKAFPNSYLVKLEINVQDSNDHAP 1416          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: PCDH20 (protocadherin 20 [Source:NCBI gene;Acc:101155503])

HSP 1 Score: 157.918 bits (398), Expect = 8.202e-62
Identity = 134/461 (29.07%), Postives = 221/461 (47.94%), Query Frame = 2
Query:  236 RNIHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKSTFKLYDDGKLLKYFSLEESTGKLII-AQRIDREQVCPTSFTALDRCQIELTIFV-PIDYWINV---ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISL-RTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKD-FNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            + + Y +KE +  G F+G +  D N+ F ++P  +F L       +Y  L  STG+L   A  IDRE +CP +      C + L + V P  Y+  +   I I+DVND++PKF      + I E   V  R ++ ++A DPD+    V TY++      F +            +LIV+  LD E Q  Y T ++A D G PPL G  TL I + D+NDN P F++ +  V +  N+  G  +A + A D D G    + Y + +    +  + F++   TG IKL   ++       + L + A+  G +P V  ATV VH+  V    P +    + P K     +KE++   S  A   V + D+  N +VDCHL  G   F++   Q +K    Y L+     D E    +++ ++ ++  T  +  +  + V+I D N+ +P F++    +++ EN
Sbjct:   38 KELIYKIKEGLPKGTFIGAIGRDLNLNFTVEPPFSFNLPQKKVSDQYVKLNNSTGELYTSATEIDRETLCPDNSVRWG-CDLSLDVIVLPQQYFQLIKIKILIEDVNDNRPKFPTDEISMFIPENSPVNARYTVEQSAVDPDLGTYGVQTYWLVNDFGLFTLDVEENEGGELTPFLIVVEELDREVQDEYITDIIAEDGGTPPLLGAATLKIIITDVNDNCPQFTESQINVTLHGNSTKGVHLARLHAFDPDLGSNALISYTYSERVPRTTRTLFHLDKTTGLIKLAGKID-SGTHTFYKLTVLANGPGCIPAV--ATVTVHVIKVLTGPPAVISRYIAPEKDGVVTLKESEPAFSPIAFFTVKNMDL--NQKVDCHLE-GFGPFRIVPYQLLKNE--YLLETTEPLDYEKTQDYELIVVANN--THGVVIKTFLKVQILDENDNAPVFQQALVEISIEEN 487          

HSP 2 Score: 101.293 bits (251), Expect = 8.202e-62
Identity = 92/280 (32.86%), Postives = 131/280 (46.79%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMF--LTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE---GDDLVY-IDAIIGD--LRARQSIREGHYLIKLVANDNGNPN-LSTEIKINLYI 2478
            +F +DQ  G L  A  LDRE+ +K   IV AID G PR ++  T V   + D NDN P  IN      V EN    P +  +  +   D D  ENG V   I               N + IF ID   G L    SLDRE   +Y L+I   D GKP L+S+  +T+ +LD+NDNPP    P ++ + +           I    A D D+  NA I Y + +   G+   + ID   G+  L+   SIR G Y + +  +D+G P  L + + +N ++
Sbjct:  521 VFVVDQVTGVLTVATSLDREEKEKYRFIVRAIDHGTPRRESIATVVVTVL-DRNDNSPRFINKDFTFFVPEN---FPGYGEIGVLSVTDADAAENGWVALSIL--------------NGSDIFMIDTGRGALRAKTSLDREQQGTYQLWIEAVDGGKPALSSVTMVTVLLLDVNDNPPVVLFPQSNQSYMLVLPNTEPGTSITEVYAVDKDTGMNAVIAYSIIKRKGGEPGSFAIDPETGNITLQRELSIR-GLYSLLVKVSDHGQPEPLYSTVMVNFFV 781          

HSP 3 Score: 94.7449 bits (234), Expect = 2.757e-19
Identity = 80/264 (30.30%), Postives = 119/264 (45.08%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            L T   LD EK    ELIV+A            T + + I D NDN P V     +++   E  LP  FLTQ+QA D D G  G V + +    D  G           +F +D+++G LT+  SLDRE  + Y   +   D G P+  SI  + +TVLD NDN P++   +                 I +   +D D+  N  +   +  G D+  ID   G LRA+ S+   ++G Y + + A D G P LS+   + + +
Sbjct:  429 LETTEPLDYEKTQDYELIVVA---NNTHGVVIKTFLKVQILDENDNAP-VFQQALVEISIEENNLPNSFLTQLQATDQDSGSRGQVIYLLGG--DAPG-----------VFVVDQVTGVLTVATSLDREEKEKYRFIVRAIDHGTPRRESIATVVVTVLDRNDNSPRF---INKDFTFFVPENFPGYGEIGVLSVTDADAAENGWVALSILNGSDIFMIDTGRGALRAKTSLDREQQGTYQLWIEAVDGGKPALSSVTMVTVLL 672          

HSP 4 Score: 81.6481 bits (200), Expect = 3.416e-15
Identity = 86/294 (29.25%), Postives = 129/294 (43.88%), Query Frame = 2
Query:  671 MHGFNDTFNITFSNLL---YLI-VINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFN--VKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            + GF   F I    LL   YL+     LDYE   +Y+  +VA +     +     L + +LD NDN PVF Q   ++ I+EN +    +  + A D DSG  GQV Y  G    P V   F +   TG + +   L+ +   + +   + A D G+  +   ATV V + D N+  P   IN      KDF   V EN        ++ V+D D   N  V   +  G++ F +       GR    L+     DRE    +Q+ +   D G P L++   +TV + DVN+  P
Sbjct:  409 LEGFG-PFRIVPYQLLKNEYLLETTEPLDYEKTQDYELIVVANNTHG--VVIKTFLKVQILDENDNAPVFQQALVEISIEENNLPNSFLTQLQATDQDSGSRGQVIYLLGG-DAPGV---FVVDQVTGVLTVATSLD-REEKEKYRFIVRAIDHGTPRRESIATVVVTVLDRNDNSPRF-IN------KDFTFFVPENFPGYGEIGVLSVTDADAAENGWVALSILNGSDIFMIDT-----GRG--ALRAKTSLDREQQGTYQLWIEAVDGGKPALSSVTMVTVLLLDVNDNPP 680          

HSP 5 Score: 78.1814 bits (191), Expect = 3.328e-14
Identity = 75/270 (27.78%), Postives = 121/270 (44.81%), Query Frame = 2
Query:  374 FSLEESTGKLIIAQRIDREQVCPTSFT--ALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVF----SQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHL 1165
            F +++ TG L +A  +DRE+     F   A+D           +     V+T+ D ND+ P+F    +   + E       I + + +D D   N      +   +D F I  +    L    +LD E Q  Y+  + A D G P L     + + +LD+NDN PV     S + Y +++  N   G  +  V AVD D+G+   + Y   + +     S F I   TG I LQR L+ + +   +SL ++ SD G  P+  Y+TV V+ 
Sbjct:  522 FVVDQVTGVLTVATSLDREEKEKYRFIVRAIDHGTPRRESIATV-----VVTVLDRNDNSPRFINKDFTFFVPENFPGYGEIGVLSVTDADAAENGWVALSILNGSDIFMID-TGRGALRAKTSLDREQQGTYQLWIEAVDGGKPALSSVTMVTVLLLDVNDNPPVVLFPQSNQSYMLVLP-NTEPGTSITEVYAVDKDTGMNAVIAYSIIKRKGGEPGS-FAIDPETGNITLQRELSIRGL---YSLLVKVSDHGQ-PEPLYSTVMVNF 779          

HSP 6 Score: 66.2402 bits (160), Expect = 1.463e-10
Identity = 70/266 (26.32%), Postives = 106/266 (39.85%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKD--FNVKENQTLMSHFAIIWVSDGDIGVNA 1309
            + I D ND+ P F ++  +I I E       ++   A+D D        Y + G      +       L V  +LD E +  Y+  + A D G P      T+ ++VLD NDN P F  K++   + EN      +  ++  D D+   G V        D      F I T  G ++ +  L+ +     + L IEA DGG         V V L DVN+  PV+    L P        V  N    +    ++  D D G+NA
Sbjct:  463 VQILDENDNAPVFQQALVEISIEENNLPNSFLTQLQATDQDSGSRGQVIYLLGGDAPGVFVVDQVTGVLTVATSLDREEKEKYRFIVRAIDHGTPRRESIATVVVTVLDRNDNSPRFINKDFTFFVPENFPGYGEIGVLSVTDADAAENGWVALSILNGSD-----IFMIDTGRGALRAKTSLD-REQQGTYQLWIEAVDGGKPALSSVTMVTVLLLDVNDNPPVV----LFPQSNQSYMLVLPNTEPGTSITEVYAVDKDTGMNA 718          

HSP 7 Score: 64.6994 bits (156), Expect = 5.386e-10
Identity = 59/212 (27.83%), Postives = 90/212 (42.45%), Query Frame = 1
Query: 1822 DVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTE-----GDDLVYIDAIIGDLRARQSIREG-HYLIKLVANDNG 2436
            DVNDN P    +   + + EN      +  +  A DPDLG  G   +++  V D       ++EN        E++  L + + LDRE  D YI  I+  D G P L     + + + D+NDN P++ +      N+T      +   +    A DPD   NA I+Y  +E        L ++D   G ++    I  G H   KL    NG
Sbjct:  141 DVNDNRPKFPTDEISMFIPENSPVNARYTVEQSAVDPDLGTYGVQTYWL--VNDFGLFTLDVEENEG-----GELTPFLIVVEELDREVQDEYITDIIAEDGGTPPLLGAATLKIIITDVNDNCPQFTE---SQINVTLHGNSTKGVHLARLHAFDPDLGSNALISYTYSERVPRTTRTLFHLDKTTGLIKLAGKIDSGTHTFYKLTVLANG 342          

HSP 8 Score: 55.8398 bits (133), Expect = 2.739e-7
Identity = 88/372 (23.66%), Postives = 150/372 (40.32%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINAL-------DYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP------VFSQKEYKVIIKENAMVGEVVANVTAVDMD------SGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSEN 1576
            I I DVND+ P+F ES   + +      G  ++   A DPD+  N + +Y    +++    T   L +L     L       D  T   YK T++A   G  P     T+ + V+ +    P      +  +K+  V +KE+      +A  T  +MD        L G   +R    Q   +L   Y+   T  +  ++        QD+ L + A++   V  V    + V + D N+  PV        A  + +++EN    S    +  +D D G   +V   L   A    + +  T     + T+  +   DRE    ++  +   D GTP+  +   + V + D N+ SPRF  +++T  V EN
Sbjct:  248 IIITDVNDNCPQFTESQINVTLHGNSTKGVHLARLHAFDPDLGSNALISY---TYSERVPRTTRTLFHLDKTTGLIKLAGKIDSGTHTFYKLTVLANGPGCIPAVA--TVTVHVIKVLTGPPAVISRYIAPEKDGVVTLKESEPAFSPIAFFTVKNMDLNQKVDCHLEGFGPFRIVPYQ---LLKNEYLLETTEPLDYEK-------TQDYELIVVANNTHGV--VIKTFLKVQILDENDNAPVFQ-----QALVEISIEENNLPNSFLTQLQATDQDSGSRGQVIYLLGGDAPGVFVVDQVT----GVLTVATS--LDREEKEKYRFIVRAIDHGTPRRESIATVVVTVLDRNDNSPRFINKDFTFFVPEN 591          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000005220.2 (pep primary_assembly:ASM223467v1:10:15161680:15164187:-1 gene:ENSORLG00000004171.2 transcript:ENSORLT00000005220.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 8.676e-62
Identity = 147/457 (32.17%), Postives = 243/457 (53.17%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQ--IELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y + EE+D G  VG+L  D ++   Q +++      G L +YF ++  +G L +  RIDRE++CP       +C   IE ++  P       + I D+ND+ P F E    ++ISE+  VG R  L  A D DV  N+V TY +   N+ F++   +         L++   +D E Q +Y+  L A D G PP  G+  + ++VLD+NDN P FS   YKV + ENA++G  +  + A D+D G+ GQV Y F +    S    F+++  TGE+ ++  L+ +   Q + + ++A D G+ P+  ++ + V + DVN+  P I+++SL        V E+  + +  A + V+D D G N + +C + + +  F+L ++     ++ Y+L  +   DRE  S + + +L +D GTP L++   ITV++ DVN+  PRF      V V ENS IG
Sbjct:   28 ISYVIAEEVDKGTAVGSLAKDLHLSVQQLQTSGLQIKSGYLKRYFEVDRESGNLYVNDRIDREELCPNML----KCALNIEASLSNPRGLHRIEVVITDINDNAPAFVEEVTTVEISESSYVGERYPLARAHDADVGINSVKTYKLSP-NEHFSLDVQSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPLYKVQVVENAVLGTTLLRLAASDLDEGVNGQVVYTFTEKGRLSPDDTFFLNNETGEVTVKGSLDFEE-TQAYEIRVQARDKGNPPRSAHSKILVEVIDVNDNVPDISVSSLMSP-----VSEDAEIGTAVARVQVNDRDGGKNGKTNCKI-MNSVPFQLKSNY----KNYYSLSTSGSLDRETVSEYNITLLATDDGTPSLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIG 468          

HSP 2 Score: 95.1301 bits (235), Expect = 1.790e-19
Identity = 77/271 (28.41%), Postives = 142/271 (52.40%), Query Frame = 1
Query: 1696 NLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPP-KLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV-LAQDQRIIIAQ--ASDPDSRPNANITYHVTE--GDDLVYIDAIIGDLRARQSIRE----GHYLIKLVANDNGNPNLSTEIKINLYI 2478
            +L T+  LDRE   +  + +LA D G P S ++T  + + ++DVNDNPP  ++    + VKEN   +   + +++A D DL EN    + + +  + +          T + +I+  +G +T  KS D E + ++   +   D G P L+S   + + VLD NDN P    P +   ++ ++++  + +    +A+  A D DS  NA ++YH++E  G++L  I    G++R ++ + +     H L+ LV+ DNG P+LS  + I + +
Sbjct:  403 SLSTSGSLDRETVSEYNITLLATDDGTP-SLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSP-IGTTMYKLKAVDADLDENAKSTYQLIKTPNVKA-------QMTSLVTINSETGEITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLSEPKGNNLFRIGTSSGEIRTKRRMSDNDLKSHPLLVLVS-DNGEPSLSATVSIEVVV 663          

HSP 3 Score: 95.1301 bits (235), Expect = 2.015e-19
Identity = 94/344 (27.33%), Postives = 152/344 (44.19%), Query Frame = 2
Query:  515 VITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCT-YFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSV----LSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVS-----DGDIGVNAEVDCHLTVGAEN--FKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKI 1510
            ++ + DVND+ P  + S     +SE  ++G  ++    +D D   N       M+         + N   L    +LD ET   Y  TL+A D G P L     + + V D+NDN P F   +  V +KEN+ +G  +  + AVD D     +  Y+   ++ P+V     S   I++ TGEI   +  + + + + F   ++A+D G  P     TV V + D N+  P I    L P  +  +V       S  A  +V+     D D G NA +  HL+    N  F++  S      +I T +  R+ D ++ SH  + +L SD G P L+    I V +
Sbjct:  334 LVEVIDVNDNVPDISVSSLMSPVSEDAEIGTAVARVQVNDRDGGKNGKTNCKIMNSVPFQLKSNYKNYYSLSTSGSLDRETVSEYNITLLATDDGTPSLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQL--IKTPNVKAQMTSLVTINSETGEITSLKSFDFEEL-KTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSPSI----LAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLSEPKGNNLFRIGTSSG----EIRTKR--RMSDNDLKSH-PLLVLVSDNGEPSLSATVSIEVVV 663          

HSP 4 Score: 77.411 bits (189), Expect = 5.344e-14
Identity = 97/351 (27.64%), Postives = 154/351 (43.87%), Query Frame = 2
Query:  152 NFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFV---------GNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQ--DVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVIN----------ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHP--VFSQKEYKVIIKEN----AMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGG 1123
            N  RS+ + +LV +  I +  +V +    ++   V E+ ++G  V         G  N  +N  KI     F+L  + K   Y+SL  S         +DRE V   + T L           P     ++IT+Q  DVND+ P+F +S   + + E   +G  +    A D D++ N   TY +     T N+  + +  L+ IN          + D+E    ++  + A D G+PPL  N T+ + VLD NDN P  +    E+  +  EN    A  G  VA + AVD DSG    + Y   +   P   + F I T +GEI+ +R ++  N  +   L +  SD G
Sbjct:  324 NPPRSAHSKILVEV--IDVNDNVPDISVSSLMSPVSEDAEIGTAVARVQVNDRDGGKNGKTNC-KIMNSVPFQLKSNYK--NYYSLSTSGS-------LDRETVSEYNITLLATDD-----GTPSLSSTHIITVQVSDVNDNPPRFLDSQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQLI---KTPNVK-AQMTSLVTINSETGEITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFVLDENDNSPSILAPYSEHGSVNSENIPYSAEAGYFVAKIRAVDADSGYNALLSYHLSE---PKGNNLFRIGTSSGEIRTKRRMS-DNDLKSHPLLVLVSDNG 649          

HSP 5 Score: 76.6406 bits (187), Expect = 9.478e-14
Identity = 71/279 (25.45%), Postives = 124/279 (44.44%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHV-------TEGDDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
            FF++   G +     LD E+    E+ V A D+G P  ++A + + + + DVNDN P +     +     +  +   + ++Q  D D G+NG     I        +  ++  N    +S       L+   SLDRE +  Y + ++  D G P L+S   IT+ V D+NDNPP++        N+  K        +   +A D D   NA  TY +        +   LV I++  G++ + +S        +  K+ A D G P LS+ + +N+++
Sbjct:  290 FFLNNETGEVTVKGSLDFEETQAYEIRVQARDKGNP-PRSAHSKILVEVIDVNDNVPDISVSSLMSPVSEDAEIGTAVARVQVNDRDGGKNGKTNCKIMN-----SVPFQLKSNYKNYYS-------LSTSGSLDRETVSEYNITLLATDDGTPSLSSTHIITVQVSDVNDNPPRFLD---SQINVYVKENSPIGTTMYKLKAVDADLDENAKSTYQLIKTPNVKAQMTSLVTINSETGEITSLKSFDFEELKTFQFKVQATDFGVPPLSSNVTVNVFV 552          

HSP 6 Score: 61.6178 bits (148), Expect = 4.184e-9
Identity = 77/287 (26.83%), Postives = 122/287 (42.51%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINP-PKLQVKENE---ETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSID-------EISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEG-----DDLVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKI 2466
            K  F +D+  GNL   + +DRE+     L      +    +      + + ITD+NDN P  +     +++ E+    E  P+     +A D D+G N +V+ Y            K+  N    FS+D        +   L + K +DRE    Y L +   D GKP  T    I + VLD+NDN P +  P+ +   +   +VL     ++   ASD D   N  + Y  TE      DD  +++   G++  + S+       Y I++ A D GNP  S   KI
Sbjct:   69 KRYFEVDRESGNLYVNDRIDREELCPNMLKCALNIEASLSNPRGLHRIEVVITDINDNAPAFVEEVTTVEISESSYVGERYPL----ARAHDADVGIN-SVKTY------------KLSPNEH--FSLDVQSTGEQNVFAELVLQKVVDREKQPHYELILTALDGGKPPKTGSLLIKVNVLDVNDNSPAFSYPL-YKVQVVENAVLG--TTLLRLAASDLDEGVNGQVVYTFTEKGRLSPDDTFFLNNETGEVTVKGSLDFEETQAYEIRVQARDKGNPPRSAHSKI 333          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 221.476 bits (563), Expect = 7.483e-60
Identity = 151/457 (33.04%), Postives = 233/457 (50.98%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFV--PIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN------LLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I Y++ EE+  G  VGN   D  + K   K        G     F ++++ G L ++Q+IDRE+VC  + T    C I + I +  P++    +I + D+NDH P FAE+  +++ISE V  G RI L+ A DPD  P ++  Y +   ND F +   +      +  LI+  +LD E    +   L A D G PP  G  T+ ++VLD+NDN PVFS+  Y V ++EN+ +G  V  V A D+D G  G+V Y F    +P  L +F I+  TGEI +   ++ +     + ++I+ASD    P      V + + DVN+  P I I S   +     V E+    +  A+I ++D D G+N +V C +  G   F LS S  V+ R +Y+L      DRE  S + + ++  D G P  ++E+ I V I DVN+ +P F  + Y    SE +  G
Sbjct:   32 IRYSIAEEVKEGTAVGNTAKDLGLDKSSLKVRRYRIGSGGTDSLFHVDQTDGFLYVSQQIDREEVCERTRT----CVINVKIVLENPLEVHHVIIEVLDINDHSPTFAENETRLEISETVFPGTRILLKPARDPDAGPFSIQQYTLSS-NDHFRLDIKDTGEDGKIPVLIIQKSLDREACERHMLVLTAIDGGKPPKSGEVTIIVNVLDVNDNAPVFSRDVYSVTLEENSPIGSTVLKVNASDLDEGRNGEVVYSFSNSVNPKFLKFFEINANTGEITVIGSIDYEE-RDKYQIDIQASDKAVAPLASQKGVVISIIDVNDNVPEIEITSFSSS-----VPEDSKPGTTVALISINDQDSGLNGKVVCSVD-GETPFNLSPS--VQDR-MYSLVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVISDVNDNNPEFSIRPYIFYASEGNEPG 473          

HSP 2 Score: 96.6709 bits (239), Expect = 5.916e-20
Identity = 104/406 (25.62%), Postives = 179/406 (44.09%), Query Frame = 2
Query:  359 KLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIEL----TIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS---NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY---RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI--NINSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLS--NSQTVKGRDIYTLQPN--RVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNE 1525
            K LK+F +  +TG++ +   ID E+         D+ QI++        P+     V I+I DVND+ P+   + +   + E  + G  ++L + +D D   N      + G    FN++ S    +  L+  + LD E Q  Y  T+VA D G P     +T+ + + D+NDN+P FS + Y     E    G V+ ++ A D D     ++ Y   R G   +  ++S+  I++ +GE+   +  + +++ + F   + A+D GS P     TV V + D N+  PVI   ++S G A+    +  N         +   D DIG N         G   F L      ++   D YT Q    R F    ++  ++ +L  D G   L+    + VK+ +  E
Sbjct:  289 KFLKFFEINANTGEITVIGSIDYEE--------RDKYQIDIQASDKAVAPLASQKGVVISIIDVNDNVPEIEITSFSSSVPEDSKPGTTVALISINDQDSGLNGKVVCSVDG-ETPFNLSPSVQDRMYSLVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVISDVNDNNPEFSIRPYIFYASEGNEPGAVLFSIKAFDHDESENARITYHIVRDGN-DNSKLVSFLNINSDSGEVVALKSFDFESV-KTFQFYVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYN---------GWLLFSLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGNVSLSATATVIVKLVEPKE 674          

HSP 3 Score: 77.0258 bits (188), Expect = 7.603e-14
Identity = 82/285 (28.77%), Postives = 131/285 (45.96%), Query Frame = 1
Query: 1690 MGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSV------LAQDQRIIIAQASDPDSRPNANITYHVTEGDD--LVYIDAIIGDLRARQSIREG----HYLIKLVANDNGNPNLS-TEIKINLYISSKSTFST 2502
            M +L T + LDREK  +  + V+A D G+P + ++  T+ + I+DVNDN P   I P      E  E   +  + I+A D D  EN  + ++I R  +        +       +I+  SG +   KS D E + ++  Y++  D G P L+S   + + +LD NDN P    PV  S+N + + V      +     +   +A D D   N  + + + +  D  L  +D   G +R  +S  E     H L+ LV  DNGN +LS T   I   +  K  F+ 
Sbjct:  406 MYSLVTKSQLDREKQSQYSITVVAKDAGQP-AHSSEKTINVVISDVNDNNPEFSIRPYIFYASEGNEPGAVLFS-IKAFDHDESENARITYHIVRDGND-------NSKLVSFLNINSDSGEVVALKSFDFESVKTFQFYVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPV--SSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILV-KDNGNVSLSATATVIVKLVEPKEAFAA 678          

HSP 4 Score: 69.707 bits (169), Expect = 1.449e-11
Identity = 67/262 (25.57%), Postives = 120/262 (45.80%), Query Frame = 1
Query: 1717 LDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGD----LRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYIS 2481
            LDRE  ++  L++ AID G+P  ++   T+ + + DVNDN P           E    +   + ++ A D D G NG V +           +  ++    K F I+  +G +T+  S+D E  D Y + I   D+    L S + + ++++D+NDN P+  +  + S+++   S       + +   +D DS  N  +   V +G+    +   + D    L  +  +   ++  Y I +VA D G P  S+E  IN+ IS
Sbjct:  201 LDREACERHMLVLTAIDGGKP-PKSGEVTIIVNVLDVNDNAPVFSRDVYSVTLEENSPIGSTVLKVNASDLDEGRNGEVVY---------SFSNSVNPKFLKFFEINANTGEITVIGSIDYEERDKYQIDIQASDKAVAPLASQKGVVISIIDVNDNVPE-IEITSFSSSVPEDS--KPGTTVALISINDQDSGLNGKVVCSV-DGETPFNLSPSVQDRMYSLVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVIS 448          

HSP 5 Score: 51.9878 bits (123), Expect = 3.327e-6
Identity = 74/284 (26.06%), Postives = 128/284 (45.07%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQG-EPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLP-MFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQPVAHSTNITTKSVLAQDQRIIIA-QASDPDSRPNANITYH-VTEGDD------LVYIDAIIGDLRARQSI---REGHYLIKLVANDNGNPNLSTEIKINLYI 2478
             F I+   G +     +D E+ DK ++ + A D+   P +      + I   DVNDN P  I          E++ P   +  I   D D G NG V   +   E    L+  + +   +++S       L     LDRE    Y + ++  D G+P  +S + I + + D+NDN P++  +P      I   S   +   ++ + +A D D   NA ITYH V +G+D       + I++  G++ A +S        +   +VA D+G+P LS+ + +N++I
Sbjct:  293 FFEINANTGEITVIGSIDYEERDKYQIDIQASDKAVAPLASQKGVVISII--DVNDNVPE-IEITSFSSSVPEDSKPGTTVALISINDQDSGLNGKVVCSVDG-ETPFNLSPSVQD---RMYS-------LVTKSQLDREKQSQYSITVVAKDAGQPAHSSEKTINVVISDVNDNNPEFSIRPY-----IFYASEGNEPGAVLFSIKAFDHDESENARITYHIVRDGNDNSKLVSFLNINSDSGEVVALKSFDFESVKTFQFYVVATDSGSPPLSSNVTVNVFI 557          

HSP 6 Score: 51.2174 bits (121), Expect = 5.884e-6
Identity = 65/221 (29.41%), Postives = 97/221 (43.89%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREK---GDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY 2319
            LF +DQ  G L  +  +DRE+     +  +I + I    P        V I + D+ND+ PT   N  +L++ E        L +  ARDPD G      F IQ+         ++D   T     D     L I KSLDRE  + ++L +   D GKP  +    I + VLD+NDN P + + V +S  +   S +     ++   ASD D   N  + Y
Sbjct:   75 LFHVDQTDGFLYVSQQIDREEVCERTRTCVINVKIVLENP---LEVHHVIIEVLDINDHSPTFAENETRLEISETVFPGTRILLK-PARDPDAGP-----FSIQQYTLSSNDHFRLDIKDT---GEDGKIPVLIIQKSLDREACERHMLVLTAIDGGKPPKSGEVTIIVNVLDVNDNAPVFSRDV-YSVTLEENSPIG--STVLKVNASDLDEGRNGEVVY 280          
BLAST of Protocadherin-9 vs. Ensembl Medaka
Match: ENSORLT00000027706.1 (pep primary_assembly:ASM223467v1:10:15299304:15305147:-1 gene:ENSORLG00000028462.1 transcript:ENSORLT00000027706.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 214.927 bits (546), Expect = 8.127e-59
Identity = 150/456 (32.89%), Postives = 231/456 (50.66%), Query Frame = 2
Query:  245 HYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDD--GKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITF------SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            HY+V EE+D G+ V NL  D  I  ++  +  K+  D  G   KY  + + TG+L I + +DRE +CP   T     ++E TI  PI  +   + I D+ND+ P F     Q+ ISE+  VG R SL  A+DPDV  N+V  Y +   ++ F+I        S    LI+   LD E +  +  TL A D G+P   G  ++ + VLD+NDN P F +  Y V + EN+ +G +V  + A D+D G    V Y +         + F ++   GEI+++ ++N +++ Q + + + ASD G     G   V + + D+N+  P I+I S         VKEN    +  A++ VSD D G N  VD H+      FKL  S      + Y L  +   DRE    + +    +DRG+P L+  E +T+++ DVN+  P+F K  YT+ V EN+  G
Sbjct:   32 HYSVPEEMDEGSVVANLATDLGI-DVRSLNKRKMRVDVVGNK-KYLDINKETGELFILEGMDREFLCPLKTTTSCFIKLEATIENPIRMFNIEVEITDINDNAPHFRRGTMQLDISESSPVGERFSLNNAADPDVGTNSVKDYHLSA-SEHFSIEIQTGRDGSKFADLILKKPLDREQRAVHTLTLTAVDGGVPTRTGTASIIVRVLDVNDNAPSFDKDTYVVDVMENSPIGSLVIKLNATDLDEGSNADVVYSYSLYTSERTQNVFQLNPENGEIRVKEMINYEDL-QLYEMEVIASDKGLSSLSGQCKVKIQVTDMNDNHPEISIKSFQSP-----VKENVATDTVIAVVSVSDKDSGENGIVDLHIPDNMP-FKLRKSSD----NYYELVVSEALDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPQFPKSFYTIRVMENNAPG 473          

HSP 2 Score: 90.1225 bits (222), Expect = 5.218e-18
Identity = 77/293 (26.28%), Postives = 134/293 (45.73%), Query Frame = 2
Query:  335 TFKLYDDGKLLKYFSLEESTGKLIIAQRIDRE--QVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFS--NLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRF--GQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVI 1195
            ++ LY   +    F L    G++ + + I+ E  Q+      A D+    L+    +      I + D+ND+ P+ +   +Q  + E V     I++ + SD D   N +    +   N  F +  S  N   L+V  ALD E    Y  T    D G PPL  N+T+ + +LD+NDN P F +  Y + + EN   G ++ +++A D D      + Y     ++ + S+   F I+   G++   +  + + I ++F  +IEA D GS P     +V + + D N+  PVI
Sbjct:  282 SYSLYTSERTQNVFQLNPENGEIRVKEMINYEDLQLYEMEVIASDKGLSSLSGQCKVK-----IQVTDMNDNHPEISIKSFQSPVKENVATDTVIAVVSVSDKDSGENGIVDLHIPD-NMPFKLRKSSDNYYELVVSEALDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPQFPKSFYTIRVMENNAPGALLESLSAFDPDLHENQYLVYVIIEKEIANTSMSMLFSINPEDGKLHALKTFDYE-IEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNTPVI 567          

HSP 3 Score: 89.3521 bits (220), Expect = 8.044e-18
Identity = 108/417 (25.90%), Postives = 182/417 (43.65%), Query Frame = 2
Query:  368 KYFSLEESTGK-------LIIAQRIDREQ--VCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNN--VCTYFMHGFNDTFNITFSNLL--YLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRP----------VININSLGP-----AKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSP 1534
            ++FS+E  TG+       LI+ + +DREQ  V   + TA+D      T    I     ++ + DVND+ P F +  Y + + E   +G  +    A+D D   N   V +Y ++    T N+   N     + V   ++YE    Y+  ++A D G+  L G   + I V D+NDNHP  S K ++  +KEN     V+A V+  D DSG  G V      + D         S    E+ +   L+ + + + + +    +D GS P     T+ + L DVN+  P          V+  N+ G      +  D ++ ENQ L+  + II   + +I  N  +    ++  E+ KL   +T              FD E++  F   +   D G+P L++   + + I D N+ +P
Sbjct:  178 EHFSIEIQTGRDGSKFADLILKKPLDREQRAVHTLTLTAVDGGVPTRTGTASI-----IVRVLDVNDNAPSFDKDTYVVDVMENSPIGSLVIKLNATDLDEGSNADVVYSYSLYTSERTQNVFQLNPENGEIRVKEMINYEDLQLYEMEVIASDKGLSSLSGQCKVKIQVTDMNDNHPEISIKSFQSPVKENVATDTVIAVVSVSDKDSGENGIVDL---HIPDNMPFKLRKSSDNYYELVVSEALDREKVPE-YDITFTVTDRGSPPLSDNETMTLELLDVNDNVPQFPKSFYTIRVMENNAPGALLESLSAFDPDLHENQYLV--YVII---EKEIA-NTSMSMLFSINPEDGKLHALKT--------------FDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNTP 565          

HSP 4 Score: 72.0182 bits (175), Expect = 2.334e-12
Identity = 81/301 (26.91%), Postives = 137/301 (45.51%), Query Frame = 1
Query: 1648 TRSKSKCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV-INPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW---FQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-------DLVYIDAIIGDLRARQSIR---EGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVI 2508
            T  +++ +F ++   G +R   +++ E     E+ V+A D+G   S +    V I +TD+NDN P + I   +  VKEN  T    +  +   D D GENG V  +I             D    K+    +    L + ++LDRE +  Y +   V D+G P L+  E +TL +LD+NDN P++   F  +    N    ++L          A DPD   N  + Y + E +        L  I+   G L A ++     E  +L  + A D+G+P LS+ + +++ I  ++  + VI
Sbjct:  287 TSERTQNVFQLNPENGEIRVKEMINYEDLQLYEMEVIASDKG-LSSLSGQCKVKIQVTDMNDNHPEISIKSFQSPVKENVAT-DTVIAVVSVSDKDSGENGIVDLHIP------------DNMPFKLRKSSDNYYELVVSEALDREKVPEYDITFTVTDRGSPPLSDNETMTLELLDVNDNVPQFPKSFYTIRVMENNAPGALLES------LSAFDPDLHENQYLVYVIIEKEIANTSMSMLFSINPEDGKLHALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNTPVI 567          

HSP 5 Score: 55.8398 bits (133), Expect = 2.370e-7
Identity = 51/174 (29.31%), Postives = 81/174 (46.55%), Query Frame = 1
Query: 1699 LRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPK----LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQP 2208
            L  +  LDREK  + ++     D+G P   +   T+ + + DVNDN P     PK    ++V EN     + L  + A DPDL EN  + + I          E  + + + +FSI+   G L   K+ D E    ++ +I   D G P L+S  ++ + ++D NDN P    P
Sbjct:  409 LVVSEALDREKVPEYDITFTVTDRGSP-PLSDNETMTLELLDVNDNVPQF---PKSFYTIRVMENNAPGAL-LESLSAFDPDLHENQYLVYVIIE-------KEIANTSMSMLFSINPEDGKLHALKTFDYEIEKEFLFHIEARDSGSPPLSSNVSVHIIIVDQNDNTPVIVSP 570          

HSP 6 Score: 52.7582 bits (125), Expect = 1.782e-6
Identity = 59/236 (25.00%), Postives = 104/236 (44.07%), Query Frame = 1
Query: 1822 DVNDNPPTVI-NPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISG-------NLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITY----HVTEGDDLVY-IDAIIGDLRARQSIREGH---YLIKLVANDNGNPNLSTEIKINLYIS 2481
            D+NDN P       +L + E+      F     A DPD+G N    +++   E                FSI+  +G       +L + K LDRE    + L +   D G P  T   +I + VLD+NDN P  F    +  ++   S +     +I   A+D D   NA++ Y    + +E    V+ ++   G++R ++ I       Y ++++A+D G  +LS + K+ + ++
Sbjct:  127 DINDNAPHFRRGTMQLDISESSPVGERFSLN-NAADPDVGTNSVKDYHLSASEH---------------FSIEIQTGRDGSKFADLILKKPLDREQRAVHTLTLTAVDGGVPTRTGTASIIVRVLDVNDNAPS-FDKDTYVVDVMENSPIG--SLVIKLNATDLDEGSNADVVYSYSLYTSERTQNVFQLNPENGEIRVKEMINYEDLQLYEMEVIASDKGLSSLSGQCKVKIQVT 343          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 556/572 (97.20%), Postives = 557/572 (97.38%), Query Frame = 2
Query:    2 GKSPRNACYNENLLQSDWLTLGLYVMDLLS-------------IFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI-TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGXXXXXXXXXXXXXXXXXXYQLAPSQNAFF 1675
            GKSPRNACYNENLLQSDWLTLGLYVMDLLS             +FLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLL LHATDDDATAQLLYQLAPSQNAFF
Sbjct: 1217 GKSPRNACYNENLLQSDWLTLGLYVMDLLSSTSGLFSENAILTVFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFF 1788          

HSP 2 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 503/504 (99.80%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTXXXXXXXXXXXXXXXXKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNXXXXXXXXXXXXLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 3180
             FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI
Sbjct: 1787 FFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 2290          

HSP 3 Score: 102.064 bits (253), Expect = 1.928e-21
Identity = 115/473 (24.31%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNL---NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI--FVP-IDYWINVITIQDVNDHQP-----KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT-------LQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG 1588
            +KE   VG  V N+   ++DS +F  Q +  F    D  +L YF +   TG++ + QRI   +     F+      IE +    VP + Y    + ++DVN+ +P         +     + E   +    ++   SD D+  N      +    + F ++ S       +Y +  N   D E   +++  ++  D G P L   + + + + D+N+  P F ++ Y V + EN+ +G ++  + A D D+    Q+ Y+      PS  ++F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I++       L   +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S + 
Sbjct: 1528 IKENAMVGEVVANVTAVDMDSGLFG-QVRYRFGQVQDPSVLSYFYISTYTGEIKL-QRILNCKNIAQDFSL----NIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDAT--AQLLYQLA----PSQNAFFFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLA 1980          

HSP 4 Score: 60.4622 bits (145), Expect = 8.312e-9
Identity = 75/296 (25.34%), Postives = 134/296 (45.27%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-LVYIDAIIGDLRARQSI-REGHYLIKLV--ANDNGNPNLSTEIKINLYISSKSTFSTVINISDD 2523
            F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I++       L   +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S +     +++ Q    D    A + Y +    +   +ID  +G+LR    + RE    I+L+  A D G P   T        ++ + F T+ +++D+
Sbjct: 1570 FYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT-------LQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG----LLLLQLHATDDDATAQLLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQT--------ATTTVFITITDVNDN 1842          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 1097.8 bits (2838), Expect = 0.000e+0
Identity = 556/572 (97.20%), Postives = 557/572 (97.38%), Query Frame = 2
Query:    2 GKSPRNACYNENLLQSDWLTLGLYVMDLLS-------------IFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI-TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGXXXXXXXXXXXXXXXXXXYQLAPSQNAFF 1675
            GKSPRNACYNENLLQSDWLTLGLYVMDLLS             +FLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLL LHATDDDATAQLLYQLAPSQNAFF
Sbjct: 1195 GKSPRNACYNENLLQSDWLTLGLYVMDLLSSTSGLFSENAILTVFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFF 1766          

HSP 2 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 503/504 (99.80%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTXXXXXXXXXXXXXXXXKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNXXXXXXXXXXXXLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 3180
             FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI
Sbjct: 1765 FFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 2268          

HSP 3 Score: 102.064 bits (253), Expect = 1.940e-21
Identity = 115/473 (24.31%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNL---NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI--FVP-IDYWINVITIQDVNDHQP-----KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT-------LQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG 1588
            +KE   VG  V N+   ++DS +F  Q +  F    D  +L YF +   TG++ + QRI   +     F+      IE +    VP + Y    + ++DVN+ +P         +     + E   +    ++   SD D+  N      +    + F ++ S       +Y +  N   D E   +++  ++  D G P L   + + + + D+N+  P F ++ Y V + EN+ +G ++  + A D D+    Q+ Y+      PS  ++F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I++       L   +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S + 
Sbjct: 1506 IKENAMVGEVVANVTAVDMDSGLFG-QVRYRFGQVQDPSVLSYFYISTYTGEIKL-QRILNCKNIAQDFSL----NIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDAT--AQLLYQLA----PSQNAFFFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLA 1958          

HSP 4 Score: 60.4622 bits (145), Expect = 9.265e-9
Identity = 75/296 (25.34%), Postives = 134/296 (45.27%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-LVYIDAIIGDLRARQSI-REGHYLIKLV--ANDNGNPNLSTEIKINLYISSKSTFSTVINISDD 2523
            F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I++       L   +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S +     +++ Q    D    A + Y +    +   +ID  +G+LR    + RE    I+L+  A D G P   T        ++ + F T+ +++D+
Sbjct: 1548 FYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT-------LQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG----LLLLQLHATDDDATAQLLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQT--------ATTTVFITITDVNDN 1820          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 556/572 (97.20%), Postives = 557/572 (97.38%), Query Frame = 2
Query:    2 GKSPRNACYNENLLQSDWLTLGLYVMDLLS-------------IFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI-TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGXXXXXXXXXXXXXXXXXXYQLAPSQNAFF 1675
            GKSPRNACYNENLLQSDWLTLGLYVMDLLS             +FLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVI TIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLL LHATDDDATAQLLYQLAPSQNAFF
Sbjct:   80 GKSPRNACYNENLLQSDWLTLGLYVMDLLSSTSGLFSENAILTVFLMLNQYQLFQIIFGDLLVNFHRSSQAFLLVSLMQIQIQISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVIITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDATAQLLYQLAPSQNAFF 651          

HSP 2 Score: 951.429 bits (2458), Expect = 0.000e+0
Identity = 503/504 (99.80%), Postives = 503/504 (99.80%), Query Frame = 1
Query: 1669 LFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTXXXXXXXXXXXXXXXXKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNXXXXXXXXXXXXLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 3180
             FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI
Sbjct:  650 FFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTVINPPKLQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDDLVYIDAIIGDLRARQSIREGHYLIKLVANDNGNPNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVTMGGVVLLGLFIFLMFMKKRSVKMQNERKKFKSSEVGFGQSLDGFCSNDNRWADVMYSPVNNLWYGTANMHYDPNKYNLQESKSETSKIFCNDSIECSTNNNFGLANTRNSSSGLNFHEPLILRDLNISDPANFTPTINKFQPFIDSPQTIFHTQIPNYTNNSSSSLIYQTSSSLGCSYTSPHTYPSLDDSLPLGAHEMNDKYKTTKI 1153          

HSP 3 Score: 102.834 bits (255), Expect = 8.874e-22
Identity = 115/473 (24.31%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  254 VKEEIDVGNFVGNL---NIDSNIFKIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTI--FVP-IDYWINVITIQDVNDHQP-----KFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL-----LYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYT-------LQPNRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG 1588
            +KE   VG  V N+   ++DS +F  Q +  F    D  +L YF +   TG++ + QRI   +     F+      IE +    VP + Y    + ++DVN+ +P         +     + E   +    ++   SD D+  N      +    + F ++ S       +Y +  N   D E   +++  ++  D G P L   + + + + D+N+  P F ++ Y V + EN+ +G ++  + A D D+    Q+ Y+      PS  ++F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I++       L   +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S + 
Sbjct:  391 IKENAMVGEVVANVTAVDMDSGLFG-QVRYRFGQVQDPSVLSYFYISTYTGEIKL-QRILNCKNIAQDFS----LNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGLLLLQLHATDDDAT--AQLLYQLA----PSQNAFFFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQTATTTVFITITDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLA 843          

HSP 4 Score: 60.8474 bits (146), Expect = 5.185e-9
Identity = 74/296 (25.00%), Postives = 134/296 (45.27%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILD-REKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTV----INPPK--LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVC-DQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGDD-LVYIDAIIGDLRARQSI-REGHYLIKLV--ANDNGNPNLSTEIKINLYISSKSTFSTVINISDD 2523
            F+I  Y G ++   IL+ +       L + A D G    +    TVF+ + DVN+  P +    + P K    VKEN+  +  F   I   D D+G N  V  ++    +   L+         I+++          +  DRE +DS+    M+C D+G P+LT+ E IT+ + D+N+  P+ F+   ++ N++  S +     +++ Q    D    A + Y +    +   +ID  +G+LR    + RE    I+L+  A D G P   T        ++ + F T+ +++D+
Sbjct:  433 FYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAI-IWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQP-------NRVFDRE-VDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPR-FKKQNYTVNVSENSTIG----LLLLQLHATDDDATAQLLYQLAPSQNAFFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQT--------ATTTVFITITDVNDN 705          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000023091.1 (SMESG000023091.1)

HSP 1 Score: 276.944 bits (707), Expect = 1.349e-98
Identity = 171/479 (35.70%), Postives = 257/479 (53.65%), Query Frame = 2
Query:  212 ISVGNEFNRNIHYAVKEEIDVGNFVGNLNIDSNIFKIQPKS-TFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTAL--------DRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN--LLYLIVINALDYETQ--INYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRY----RFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKD--FNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIG 1588
            I + N+ ++++ Y+VKEE      +GN+  DS + +   +S TF++Y+D +   YF + E TG+  +A RIDRE +C  SF  +          C++ LT+FVP ++WINV ITI+D+NDH P F  ++  I+I E V + +   L  A D D+ PNN+  Y +   +D F + +    +L L + + LDY+     NY   L ACD G P  CG+Q L+I V D NDN P+F + EY V + E   VG  +  V A D DSGL+G + Y         +    + +F IS  +G I L R L+ K +   F + +EA D G  P +G A + + ++D+N+  P I+I    P   D   ++ EN    ++  +I V+DGDIG N +V C +    E   L  S     R IY++  N  FDRE +S F + + C D G P L+T + I + I DVNE  P        VN+SE+ +IG
Sbjct:   17 IHLTNQISQDLKYSVKEESPPNYLIGNIKKDSRLSEKNSESLTFQIYEDEEKKNYFRIVEKTGEFYVAGRIDRETIC--SFKEVGDSDPLKAQNCKLSLTVFVPKEHWINVEITIEDINDHVPVFEPNWKVIEIDERVSINFETPLALAKDLDIGPNNIQEYKLEQPSDIFGLNYEPPFILNLYLKSKLDYDVPDGKNYSLILRACDGGDPIQCGHQKLSIRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAK-LTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKP-KPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIG 491          

HSP 2 Score: 104.375 bits (259), Expect = 1.349e-98
Identity = 82/307 (26.71%), Postives = 150/307 (48.86%), Query Frame = 1
Query: 1663 KCLFFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXX-XXXXXXXDVNDNPPTVINPPK-LQVKENEETLPMFLTQIQARDPDLGENGTVRFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKWFQPVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD-----DLVYIDAIIGDLRARQSIREGHYLIKLVANDNGN-PNLSTEIKINLYISSKSTFSTVINISDDQFRVVIVIAMVT 2559
            K  F ID+  G ++  + LDREK D+  + ++  D  +  +Q  T+ ++ +++ D NDN P ++N  K + + E    +   + Q+ A D D+G N  V + I  ++ +  +       + K+F+I+  +G L    SLDRE  D Y + +++ D+G P  T  E I + ++D NDN P W  P   +  I    +    Q I    A D D+  NAN+TY +T+ +     ++  +    G ++  + +    +++ L A+DNGN P  S    + +      T S +       F +++ +A+VT
Sbjct:  518 KIYFSIDRKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGTQFTTSFSLTVSVMDANDNKPYLLNSSKVINIIEGNYGVKEKIFQVFALDNDIGSNAVVEYTINYIKYRNEII------KEKVFTINRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTKITYPGQIIATIHAYDNDTLENANVTYTLTKVEPPLNSNIFKLHETQGTIQVTEFLTLKMFVLHLQASDNGNTPLKSVPTTLTIRYWPMETGSLLSGHDSVSFNLIVTMAVVT 818          

HSP 3 Score: 79.337 bits (194), Expect = 1.401e-14
Identity = 105/437 (24.03%), Postives = 199/437 (45.54%), Query Frame = 2
Query:  365 LKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINVITIQDVNDHQPKFAESYY------QIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSN-----LLYLIVIN-ALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVF---VHLKDVNNQRP-------VININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNR---------VFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFK---KQNYTVNVSE 1573
            + +F + +++G++I+ +++D  ++ P+ F  L+      +    +   +  I I+D+NDH P+ +           + + E       I L   +D D+  N   +  ++   +   +  SN     ++Y I+ N   D E +  +  ++   D G PPL  +QT+ I + D+N++ PV +    +V I E+  +G+    V   D D+      R     +Q+     YF I    G+IK++  L+ + I + + + I   D   +    + T F   V + D N+ +P       VINI      + ++ VKE   +   FA+    D DIG NA V+  +     N+    ++ +K + ++T+  NR           DRE    +++ +L +D+G P  T EE I V I D N+ +P +K    QN  +N+++
Sbjct:  299 VPFFKISKNSGRIILNRKLD-AKLTPSFFMRLEAHDSGESPL--MGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESLFTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNIKEVNISEDVSIGQEFFTVEVEDKDA-----TRNISFLIQETINKIYFSIDRKFGKIKIKSNLDREKIDR-YIICIVVEDNKQL-GTQFTTSFSLTVSVMDANDNKPYLLNSSKVINI-----IEGNYGVKEK--IFQVFAL----DNDIGSNAVVEYTI-----NYIKYRNEIIKEK-VFTI--NRKNGELFALTSLDREKYDVYKISLLLTDKGNPPQTKEEIILVNIIDKNDNAPIWKFPSPQNDIINLTK 706          

HSP 4 Score: 74.3294 bits (181), Expect = 4.533e-13
Identity = 91/379 (24.01%), Postives = 149/379 (39.31%), Query Frame = 2
Query:  518 ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH----GFNDTFNITF----SNLLYLIVINALDYETQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVI------IKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLS----------YFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDR---GTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSE 1573
            I + D ND+ P F +S Y + +SE   VG  I    A+D D        YFM+        +  + F     N   +I+   LD +   ++   L A D G  PL G   + I + DIND+ P  S K    I      + EN      +  +   D D G  G+V     + ++  +L           Y  I+ +T + + + +         F+++I   D G  P     T+ + + DVN   PVIN N      K+ N+ E+ ++   F  + V D D   N       T+    F +        R    ++     DRE    + + ++  D    GT + TT   +TV + D N+  P     +  +N+ E
Sbjct:  235 IRVNDYNDNPPIFMKSEYMVNVSEKTAVGSEIFRVIATDRDSGLYGSINYFMYESVSNHKKSVEVPFFKISKNSGRIILNRKLDAKLTPSFFMRLEAHDSGESPLMGQAVMKIIIEDINDHTPQISIKPKPDIPDCMLSLPENNDKNAYIGLIIVTDGDIGQNGKVSCVINKDEEKILLKVSNNGDDRMIYSIIANHTFDREAESL---------FTISITCKDYGQPPLSTSQTIEICISDVNEHPPVINNNI-----KEVNISEDVSIGQEFFTVEVEDKDATRNISFLIQETINKIYFSID-------RKFGKIKIKSNLDREKIDRYIICIVVEDNKQLGT-QFTTSFSLTVSVMDANDNKPYLLNSSKVINIIE 591          
BLAST of Protocadherin-9 vs. Planmine SMEST
Match: SMESG000008751.1 (SMESG000008751.1)

HSP 1 Score: 251.136 bits (640), Expect = 1.227e-89
Identity = 173/491 (35.23%), Postives = 261/491 (53.16%), Query Frame = 2
Query:  242 IHYAVKEEIDVGNFVGNLNIDSNI-FKIQPKS--TFKLYD---DGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDRCQIELTIFVPIDYWINV-ITIQDVNDHQPKFAESYYQIQISEAVQVGYRISLRTASDPDVEPNNVCTYFMHGFNDTFNITFSNL--LYLIVINALDYE--TQINYKTTLVACDCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIKLQRILNCKNIAQDFSLNIEASDGGSV-PKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAIIWVSDGDIGVNAEVDCHLTVGAENF-KLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQNYTVNVSENSTIGXXXXXXXXXXXXXXXXXXYQLAPSQNAFF 1675
            + Y +KEE D+   +GN+  DS   +  +PK   T+K+Y    D  L K     +  G L++ +RIDRE +CP +   +D CQ+EL I    D+WI V I I+D+ND++PKF     +I++SE++ VG ++ L+TA D D+E   V +Y +      F++ +  +  L L+V+  LD+E  +   +  TL+ACD G P  C  Q L I V D NDN+P+F Q +    IKE+  +G V+    A D DSGLFG++ ++    +      YF ++  TGE+ L   LN K I   F L++EA D   V P      + + ++D NN  P++   SLG  ++   + EN     H  ++  SDGD+  N +V C L     N+  L  S  +K   IY L   RVFDRE+  +F + + C D G P   + +   V + D+NEF P F   NY++ +SE+  I   L+ + A D D T  L Y L PS N  F
Sbjct:   22 VKYRLKEESDINTLIGNIFEDSRSEYMRKPKENFTYKIYTTDIDSNLTKL----DFKGHLLVNKRIDREFLCP-NVDKIDDCQLELMIHAFPDHWIKVFIIIEDINDNKPKFPTKEKRIKVSESIAVGNQLPLQTAMDEDLEYFGVQSYNLEDSEPFFSLLYRPMFSLTLVVLKKLDFENISHRYFNLTLIACDGGTPVQCDKQKLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTKNKVYFNLNFNTGELVLITSLNAK-IVSKFILDVEARDENGVGPFSSQCQLTIRVQDENNHAPIL---SLG-DRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDRELLDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKTHSLNYHLDPSVNDKF 502          

HSP 2 Score: 100.523 bits (249), Expect = 1.227e-89
Identity = 98/313 (31.31%), Postives = 156/313 (49.84%), Query Frame = 1
Query: 1672 FFIDQYMGNLRTANILDREKGDKIELIVLAIDQGEPRSQXXXXXXXXXXXDVNDNPPTVINPPKLQVKENEETLPM--FLTQIQARDPDLGENGTV---RFYIQRVEDKRGLAEKIDENRTKIFSIDEISGNLTIYKSLDREYIDSYILYIMVCDQGKPQLTSIEAITLTVLDINDNPPKW-FQ--PVAHSTNITTKSVLAQDQRIIIAQASDPDSRPNANITYHVTEGD--DLVYIDAII------GDLRARQSIREGHYLIKLVANDNGNPNLSTEIK-INLYISSKSTFSTVINISDDQFRVVIVIAMVT 2559
            F ID   G L+     DRE   K  + V   DQ      T TTTV+IT+TDVNDN P +    +  ++EN + L     + ++Q +D D   N TV      +  + +       ++ +    F ID+   NL +  SLDRE ID Y L I++ D G P+ +++E IT+ V D NDN P W +Q    A+  N+T ++ L  +  II+ QA+D D++ N+NI+Y+    D   L Y           G   +R     G Y +K+ A DNG+P   +++  I + IS+    + +I  S   F +++V ++ +
Sbjct:  502 FQIDINKGILKNIVHFDREVIPKYIVPVFVTDQVRGTILTGTTTVYITVTDVNDNTPVMTGIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHS----FEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNL--NHPIILVQATDIDAKKNSNISYNFVNNDVNSLWYEKYFTILTRNGGIFMSRDLQESGTYYLKIQATDNGSPPRFSDVTIITVKISTAEKTNYLIKNSQISFTLIVVTSLAS 808          

HSP 3 Score: 88.9669 bits (219), Expect = 1.382e-17
Identity = 128/511 (25.05%), Postives = 215/511 (42.07%), Query Frame = 2
Query:  197 QIQIQISVGNE----FNRNIHYA-VKEEIDVGNFVGNLNI---DSNIF-----KIQPKSTFKLYDDGKLLKYFSLEESTGKLIIAQRIDREQVCPTSFTALDR---------CQIELTIFVPIDYWINVITIQDVNDHQPKFAESYYQ-IQISEAVQVGYRISLRTASDPDVEPNNVCTYFMH-------GFNDTFNITFSNLLYLIVINALDYETQINYKTTLVAC-DCGMPPLCGNQTLAISVLDINDNHPVFSQKEYKVIIKENAMVGEVVANVTAVDMDSGLFGQVRYRFGQVQDPSVLSYFYISTYTGEIK----LQRILNCKNIAQDFSLNIEASDGGSVPKVGYATVFVHLKDVNNQRPVININSLGPAKKDFNVKENQTLMSHFAII---WVSDGDIGVNAEVDCHL------TVGAENFKLSNSQTVKGRDIYTLQPNRVFDREVDSHFQVRMLCSDRGTPKLTTEEEITVKIQDVNEFSPRFKKQN----YTVNVSENSTI 1585
            ++QI+++  N+    F++  +Y  +KE   +G+ +   N    DS +F     K+ P  T K     K+  YF+L  +TG+L++   ++ + V         R          Q +LTI            +QD N+H P  +    + + I E    G  + +  ASD D+E N   T  +          + + N+    +  L+     D E  ++Y T +++C D G PP    Q   +SV DIN+  P F    Y + I E+  +   +  + A+D D      + Y      DPSV   F I    G +K      R +  K I   F   +     G++   G  TV++ + DVN+  PV+         K F ++EN  ++++  +I      D D   NA V C L      +      +L N      +    L      DRE    +++ ++ SD G PK +  E ITV ++D N+ SP ++ QN    Y VNV+  + +
Sbjct:  221 KLQIEVTDSNDNNPIFDQTQNYKFIKESTPIGSVIFIFNASDADSGLFGKINFKLLPARTTK----NKV--YFNLNFNTGELVLITSLNAKIVSKFILDVEARDENGVGPFSSQCQLTI-----------RVQDENNHAPILSLGDRESLTIMENSPAGEHVGMVIASDGDLEDNGKVTCVLLKNDSNYLALDRSHNMKDEIIYRLVTTRVFDREL-LDYFTIMISCQDYGNPPHRSFQLFNVSVGDINEFPPSFYHSNYSIFISEDIEINSALIQIKALDKDKT--HSLNYHL----DPSVNDKFQIDINKGILKNIVHFDREVIPKYIVPVF---VTDQVRGTI-LTGTTTVYITVTDVNDNTPVMT------GIKQFVIRENVQILTYGNLIGELQTQDLDNSYNATVVCDLLSVHVLSNHMSWIRLLNHSFEIDKYKCNLFVKSSLDREQIDKYKLNIIISDLGIPKRSNMEIITVMVEDENDNSPIWRYQNNQTAYQVNVTAETNL 697          
The following BLAST results are available for this feature:
BLAST of Protocadherin-9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH189.108e-6731.41protocadherin 18 [Source:HGNC Symbol;Acc:HGNC:1426... [more]
PCDH189.337e-6731.41protocadherin 18 [Source:HGNC Symbol;Acc:HGNC:1426... [more]
PCDHGB42.247e-6232.82protocadherin gamma subfamily B, 4 [Source:HGNC Sy... [more]
PCDHGB48.503e-6232.82protocadherin gamma subfamily B, 4 [Source:HGNC Sy... [more]
PCDH11Y3.822e-6029.21protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-15.228e-4029.71FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.048e-3929.71FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.138e-3429.86CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-44.056e-3224.13Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-16.856e-2426.00Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft2.347e-5427.74gene:FBgn0001075 transcript:FBtr0077478[more]
ds5.564e-5127.36gene:FBgn0284247 transcript:FBtr0078045[more]
ds5.564e-5127.36gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.141e-4026.76gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.209e-4026.76gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2ab25.855e-6534.50protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2ab25.855e-6534.50protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2ab25.855e-6534.50protocadherin 2 alpha b2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pcdh2ab111.095e-6333.92protocadherin 2 alpha b 11 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2ab91.249e-6333.92protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000027070.12.220e-6028.95pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
ENSXETT00000027726.11.066e-5831.96pep primary_assembly:Xenopus_tropicalis_v9.1:3:183... [more]
pcdh202.228e-5828.88protocadherin 20 [Source:NCBI gene;Acc:100101710][more]
ENSXETT00000039476.11.699e-5731.83protocadherin gamma-B2-like [Source:NCBI gene;Acc:... [more]
pcdh185.362e-5730.11protocadherin 18 [Source:NCBI gene;Acc:496568][more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhgb52.521e-6533.69protocadherin gamma subfamily B, 5 [Source:MGI Sym... [more]
Pcdhb144.454e-6232.45protocadherin beta 14 [Source:MGI Symbol;Acc:MGI:2... [more]
Pcdh187.218e-6131.12protocadherin 18 [Source:MGI Symbol;Acc:MGI:192042... [more]
Pcdhgb41.121e-6032.54protocadherin gamma subfamily B, 4 [Source:MGI Sym... [more]
Pcdhac22.328e-6029.78protocadherin alpha subfamily C, 2 [Source:MGI Sym... [more]
back to top
BLAST of Protocadherin-9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HCL0|PCD18_HUMAN4.128e-6631.41Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18... [more]
sp|A7MB46|PCD18_BOVIN9.491e-6530.98Protocadherin-18 OS=Bos taurus OX=9913 GN=PCDH18 P... [more]
sp|Q6PB90|PCDBE_MOUSE3.115e-6132.45Protocadherin beta-14 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9UN71|PCDGG_HUMAN4.084e-6132.82Protocadherin gamma-B4 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q5DRA8|PCDGG_PANTR1.191e-6032.82Protocadherin gamma-B4 OS=Pan troglodytes OX=9598 ... [more]
back to top
BLAST of Protocadherin-9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LP532.985e-10337.92Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A3R7FMR54.158e-10237.13Protocadherin alpha-4 OS=Clonorchis sinensis OX=79... [more]
G7YNN24.189e-10237.13Protocadherin alpha-4 OS=Clonorchis sinensis OX=79... [more]
A0A4E0R4754.782e-9936.24Protocadherin-1 OS=Fasciola hepatica OX=6192 GN=D9... [more]
A0A2H1C5377.072e-9936.24Cadherin domain protein OS=Fasciola hepatica OX=61... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034478.14.165e-6333.55pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
ENSAMXT00000050733.15.961e-6233.62pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
pcdh1gc57.097e-6231.04protocadherin 1 gamma c 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
pcdh2ab51.057e-6133.84protocadherin 2 alpha b 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000054364.11.834e-6033.41pep primary_assembly:Astyanax_mexicanus-2.0:20:107... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.976e-5929.92protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.11.581e-5431.32protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000008517.13.268e-5228.11pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000010725.11.126e-4427.50pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.14.296e-4230.15pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354124.363e-6028.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461895.391e-5528.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.962e-4526.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417679.099e-4426.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303641.953e-4228.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5