SMED30013787

Overview
NameSMED30013787
Smed IDSMED30013787
Uniprot Best hitSerine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1 (E=9.01952e-10)
Length (bp)469
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30013787SMESG000017258.1 dd_Smed_v4_5255_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013787 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002264:1714..2991 +2105
Homology
BLAST of SMED30013787 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 54.6842 bits (130), Expect = 7.206e-10
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   29 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 97          
BLAST of SMED30013787 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 55.8398 bits (133), Expect = 2.800e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 55.8398 bits (133), Expect = 2.866e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 55.8398 bits (133), Expect = 2.866e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Human
Match: ILK (integrin linked kinase [Source:HGNC Symbol;Acc:HGNC:6040])

HSP 1 Score: 55.8398 bits (133), Expect = 2.866e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 51.6026 bits (122), Expect = 3.783e-8
Identity = 21/70 (30.00%), Postives = 36/70 (51.43%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A + GH  V   L++R    +       + P+H A + GH +++ +L+ Q  +I   DQN W  +H
Sbjct: 1242 PLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLH 1311          

HSP 2 Score: 46.9802 bits (110), Expect = 1.520e-6
Identity = 21/73 (28.77%), Postives = 40/73 (54.79%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWR---PIH 467
            P+H A + GH  + + L+N+   ++A S + N  P+H A ++GH  ++ +LL +    +     +WR   P+H
Sbjct: 1208 PLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQ--HAKDWRGRTPLH 1278          
BLAST of SMED30013787 vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 47.7506 bits (112), Expect = 8.854e-7
Identity = 20/68 (29.41%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  243 ILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQ 446
            ++ W P+ +A    H +V   L+N K ++  I   +   P+  A  RG   I++ L+D  C + ACD+
Sbjct:  127 LMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDEEDGLTPLIVASGRGFSQIVERLIDSDCQVNACDK 194          
BLAST of SMED30013787 vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 47.7506 bits (112), Expect = 8.855e-7
Identity = 20/68 (29.41%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  243 ILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQ 446
            ++ W P+ +A    H +V   L+N K ++  I   +   P+  A  RG   I++ L+D  C + ACD+
Sbjct:  127 LMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDEEDGLTPLIVASGRGFSQIVERLIDSDCQVNACDK 194          
BLAST of SMED30013787 vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 47.7506 bits (112), Expect = 8.862e-7
Identity = 20/68 (29.41%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  243 ILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQ 446
            ++ W P+ +A    H +V   L+N K ++  I   +   P+  A  RG   I++ L+D  C + ACD+
Sbjct:  127 LMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDEEDGLTPLIVASGRGFSQIVERLIDSDCQVNACDK 194          
BLAST of SMED30013787 vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 47.7506 bits (112), Expect = 8.863e-7
Identity = 20/68 (29.41%), Postives = 35/68 (51.47%), Query Frame = 3
Query:  243 ILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQ 446
            ++ W P+ +A    H +V   L+N K ++  I   +   P+  A  RG   I++ L+D  C + ACD+
Sbjct:  127 LMGWSPLMWAVYKNHLDVVDLLVNAKAHVNLIDEEDGLTPLIVASGRGFSQIVERLIDSDCQVNACDK 194          
BLAST of SMED30013787 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0300012)

HSP 1 Score: 62.003 bits (149), Expect = 1.337e-11
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++P+H AC GGH  V   L++R   +      N +  +H A   GH  +++ILL Q  +I A D+N W P+H
Sbjct: 1011 YNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          
BLAST of SMED30013787 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0304843)

HSP 1 Score: 62.003 bits (149), Expect = 1.338e-11
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++P+H AC GGH  V   L++R   +      N +  +H A   GH  +++ILL Q  +I A D+N W P+H
Sbjct: 1011 YNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          
BLAST of SMED30013787 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0343224)

HSP 1 Score: 62.003 bits (149), Expect = 1.338e-11
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++P+H AC GGH  V   L++R   +      N +  +H A   GH  +++ILL Q  +I A D+N W P+H
Sbjct: 1011 YNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          
BLAST of SMED30013787 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347408)

HSP 1 Score: 62.003 bits (149), Expect = 1.339e-11
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++P+H AC GGH  V   L++R   +      N +  +H A   GH  +++ILL Q  +I A D+N W P+H
Sbjct: 1011 YNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          
BLAST of SMED30013787 vs. Ensembl Fly
Match: nompC (gene:FBgn0016920 transcript:FBtr0347409)

HSP 1 Score: 62.003 bits (149), Expect = 1.339e-11
Identity = 26/72 (36.11%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++P+H AC GGH  V   L++R   +      N +  +H A   GH  +++ILL Q  +I A D+N W P+H
Sbjct: 1011 YNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLH 1082          
BLAST of SMED30013787 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 59.6918 bits (143), Expect = 1.193e-10
Identity = 24/70 (34.29%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+A + G+ E+ K L+N+  N+ A S   +++PIH+A   GH +++K+L+ Q  D    D+  + P+H
Sbjct:  143 PLHHAAQSGYQEMVKLLLNKGANLSA-SDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLH 211          
BLAST of SMED30013787 vs. Ensembl Zebrafish
Match: ankrd52a (ankyrin repeat domain 52a [Source:NCBI gene;Acc:553206])

HSP 1 Score: 59.6918 bits (143), Expect = 1.195e-10
Identity = 24/70 (34.29%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+A + G+ E+ K L+N+  N+ A S   +++PIH+A   GH +++K+L+ Q  D    D+  + P+H
Sbjct:  143 PLHHAAQSGYQEMVKLLLNKGANLSA-SDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLH 211          
BLAST of SMED30013787 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 55.4546 bits (132), Expect = 3.163e-9
Identity = 25/86 (29.07%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  210 FRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            F S+Y+E         P+H A   GH EV +FL+     ++A    +++ P+H A   GHK+++K+L++ K + ++       P+H
Sbjct:  418 FSSDYVET--------PLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLH 494          

HSP 2 Score: 46.595 bits (109), Expect = 3.980e-6
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H   + +LL     +EA  ++   P+H
Sbjct:  324 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLH 392          
BLAST of SMED30013787 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 55.4546 bits (132), Expect = 3.165e-9
Identity = 25/86 (29.07%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  210 FRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            F S+Y+E         P+H A   GH EV +FL+     ++A    +++ P+H A   GHK+++K+L++ K + ++       P+H
Sbjct:  430 FSSDYVET--------PLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLH 506          

HSP 2 Score: 46.595 bits (109), Expect = 3.982e-6
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H   + +LL     +EA  ++   P+H
Sbjct:  336 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLH 404          
BLAST of SMED30013787 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 55.4546 bits (132), Expect = 3.166e-9
Identity = 25/86 (29.07%), Postives = 46/86 (53.49%), Query Frame = 3
Query:  210 FRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            F S+Y+E         P+H A   GH EV +FL+     ++A    +++ P+H A   GHK+++K+L++ K + ++       P+H
Sbjct:  446 FSSDYVET--------PLHMAARAGHCEVAQFLLQNNAQVDA-KAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLH 522          

HSP 2 Score: 49.2914 bits (116), Expect = 4.534e-7
Identity = 27/78 (34.62%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  234 KNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            KNGI    P+H A   G+  + + L++R   I+A +  +   P+H A   GH  +++ILLDQ   ++A  +N   PIH
Sbjct:  248 KNGIT---PLHIASRRGNVIMVRLLLDRGAQIDAKT-KDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIH 321          

HSP 3 Score: 46.595 bits (109), Expect = 3.984e-6
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H   + +LL     +EA  ++   P+H
Sbjct:  352 PLHVAAHCGHHRMVKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLH 420          
BLAST of SMED30013787 vs. Ensembl Xenopus
Match: ilk (integrin linked kinase [Source:NCBI gene;Acc:100145644])

HSP 1 Score: 53.5286 bits (127), Expect = 1.621e-8
Identity = 23/70 (32.86%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S +   LI R   I  ++  ++  P+H A   GH+DI++ L+  K D+ A +++   P+H
Sbjct:   37 PLHWACREGRSNIVDMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLIQYKADVNAVNEHGNAPLH 105          
BLAST of SMED30013787 vs. Ensembl Xenopus
Match: krit1 (KRIT1, ankyrin repeat containing [Source:NCBI gene;Acc:100158531])

HSP 1 Score: 53.5286 bits (127), Expect = 2.094e-8
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINR-KCNIEAISGSNNKRPIHYACERGHKDILKILLD-QKCDIEACDQNNWRPI 464
            QW PIHYAC  G  E T  L+ + KCN   ++G  +  P+H+A   GH +I++ILL   + D    DQ    P+
Sbjct:  321 QWAPIHYACWYGKVEATSMLLEKGKCNPNLLNGQLSS-PLHFAAGGGHAEIVQILLTHSETDRHISDQQGRSPL 393          
BLAST of SMED30013787 vs. Ensembl Xenopus
Match: krit1 (KRIT1, ankyrin repeat containing [Source:NCBI gene;Acc:100158531])

HSP 1 Score: 53.1434 bits (126), Expect = 2.382e-8
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINR-KCNIEAISGSNNKRPIHYACERGHKDILKILLD-QKCDIEACDQNNWRPI 464
            QW PIHYAC  G  E T  L+ + KCN   ++G  +  P+H+A   GH +I++ILL   + D    DQ    P+
Sbjct:  321 QWAPIHYACWYGKVEATSMLLEKGKCNPNLLNGQLSS-PLHFAAGGGHAEIVQILLTHSETDRHISDQQGRSPL 393          
BLAST of SMED30013787 vs. Ensembl Xenopus
Match: krit1 (KRIT1, ankyrin repeat containing [Source:NCBI gene;Acc:100158531])

HSP 1 Score: 53.1434 bits (126), Expect = 2.453e-8
Identity = 29/74 (39.19%), Postives = 41/74 (55.41%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINR-KCNIEAISGSNNKRPIHYACERGHKDILKILLD-QKCDIEACDQNNWRPI 464
            QW PIHYAC  G  E T  L+ + KCN   ++G  +  P+H+A   GH +I++ILL   + D    DQ    P+
Sbjct:  321 QWAPIHYACWYGKVEATSMLLEKGKCNPNLLNGQLSS-PLHFAAGGGHAEIVQILLTHSETDRHISDQQGRSPL 393          
BLAST of SMED30013787 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 52.7582 bits (125), Expect = 2.833e-8
Identity = 27/72 (37.50%), Postives = 37/72 (51.39%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSN--NKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+HYA   G SE+ K L+    N + +   N   K P+H A E GH D++ +LL     I A D N   P+H
Sbjct:  252 PMHYAAATGSSEIAKALLKAGKN-KNVDEKNVWRKTPLHLAAEHGHSDLINLLLQNGAAINALDNNRDTPLH 322          
BLAST of SMED30013787 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 55.8398 bits (133), Expect = 1.987e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 55.8398 bits (133), Expect = 1.987e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 55.0694 bits (131), Expect = 2.397e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Mouse
Match: Ilk (integrin linked kinase [Source:MGI Symbol;Acc:MGI:1195267])

HSP 1 Score: 55.4546 bits (132), Expect = 2.690e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. Ensembl Mouse
Match: Ankrd28 (ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MGI:2145661])

HSP 1 Score: 51.9878 bits (123), Expect = 1.637e-8
Identity = 22/70 (31.43%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
             +H+A   GH E+ K L++R  NI A     ++R IH+A   GH +++K+L+    ++   D+ ++ P+H
Sbjct:  115 ALHHAAFSGHGEMVKLLLSRGANINAFD-KKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLH 183          
BLAST of SMED30013787 vs. UniProt
Match: sp|Q502K3|ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio OX=7955 GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 9.020e-10
Identity = 24/70 (34.29%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+A + G+ E+ K L+N+  N+ A S   +++PIH+A   GH +++K+L+ Q  D    D+  + P+H
Sbjct:  143 PLHHAAQSGYQEMVKLLLNKGANLSA-SDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLH 211          
BLAST of SMED30013787 vs. UniProt
Match: sp|Q13418|ILK_HUMAN (Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 1.376e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. UniProt
Match: sp|Q99J82|ILK_RAT (Integrin-linked protein kinase OS=Rattus norvegicus OX=10116 GN=Ilk PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.390e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. UniProt
Match: sp|O55222|ILK_MOUSE (Integrin-linked protein kinase OS=Mus musculus OX=10090 GN=Ilk PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 1.390e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. UniProt
Match: sp|P57044|ILK_CAVPO (Integrin-linked protein kinase OS=Cavia porcellus OX=10141 GN=ILK PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.443e-8
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC  G S V + LI R   I  ++  ++  P+H A   GH+DI++ LL  K DI A +++   P+H
Sbjct:   37 PLHWACREGRSAVVEMLIMRGARINVMNRGDDT-PLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLH 105          
BLAST of SMED30013787 vs. TrEMBL
Match: gnl|BL_ORD_ID|16488909 (tr|A0A182GGY8|A0A182GGY8_AEDAL ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.744e-16
Identity = 39/97 (40.21%), Postives = 60/97 (61.86%), Query Frame = 3
Query:  177 QQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            Q    E VE   R +   +    + W P+H+AC  GH EV + LI  K NIEA++  +N  P+H +C  GHK++++IL+ +K +IEA +Q+NW P+H
Sbjct: 1408 QNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALN-QDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLH 1503          

HSP 2 Score: 80.4925 bits (197), Expect = 1.542e-14
Identity = 32/73 (43.84%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++ P+H AC+ GH EV + LI  K NI+A++      P+H AC+ GHK++++IL+ +K +IEA +Q+NW P+H
Sbjct: 1630 KFTPLHLACQNGHKEVVEILIGEKANIDALT-EKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLH 1701          

HSP 3 Score: 80.4925 bits (197), Expect = 1.666e-14
Identity = 34/70 (48.57%), Postives = 51/70 (72.86%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H AC+ GH EV + LI  K NIEA++  N   P+H+AC  GHK++++IL+ +K +IEA +Q+NW P+H
Sbjct: 1402 PLHLACQNGHKEVVEILIRGKANIEALNQVN-WTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLH 1470          

HSP 4 Score: 76.2554 bits (186), Expect = 4.435e-13
Identity = 31/72 (43.06%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W P+H AC+ GH EV + LI    NI+A++  +   P+H AC RGHK+ ++IL+ +K +I+A D+N + P+H
Sbjct: 1268 WTPLHLACQNGHKEVVEILIKENANIDALT-EHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLH 1338          

HSP 5 Score: 75.8702 bits (185), Expect = 5.981e-13
Identity = 31/73 (42.47%), Postives = 52/73 (71.23%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++ P+H+AC  G  EV + LI  K NI+A++  N   P+H+AC+ G K++++IL+ +K +IEA +Q+NW P+H
Sbjct: 1201 EYTPLHWACISGVKEVVEILIGGKANIDALA-KNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLH 1272          

HSP 6 Score: 75.8702 bits (185), Expect = 6.337e-13
Identity = 38/92 (41.30%), Postives = 53/92 (57.61%), Query Frame = 3
Query:  192 EFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            E VE   R E   +      + P+H A   GH +V + LI  K NIEA+ G  N  P+H AC  GHK++++IL+  K +IEA  Q+NW P+H
Sbjct: 1512 EVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEAL-GQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLH 1602          

HSP 7 Score: 75.485 bits (184), Expect = 8.547e-13
Identity = 32/70 (45.71%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H AC+ GH EV + L+  K NIEA++  +N  P+H ACE+GHK+++KIL+ +K +I+A  Q    P+H
Sbjct: 1666 PLHLACQNGHKEVVEILVGEKANIEALN-QDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLH 1734          

HSP 8 Score: 73.9442 bits (180), Expect = 2.399e-12
Identity = 32/72 (44.44%), Postives = 46/72 (63.89%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W P+H ACE GH EV K LI  K NI+A++   N  P+H AC+RGHK++++I L +  +I A D     P++
Sbjct: 1697 WTPLHLACEKGHKEVVKILIGEKANIDALTQKKN-TPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLN 1767          

HSP 9 Score: 72.7886 bits (177), Expect = 7.705e-12
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 3
Query:  192 EFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            + VE   R +   +  G   W P+H AC  GH EV + LI  K NIEA++  +N  P+H AC+ GH ++++IL+ +K +I+A  +  + P+H
Sbjct: 1545 KVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALT-QDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLH 1635          

HSP 10 Score: 68.9366 bits (167), Expect = 1.514e-10
Identity = 28/70 (40.00%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC+ G  EV + LI  K NIEA++  +N  P+H AC+ GHK++++IL+ +  +I+A  ++ + P+H
Sbjct: 1237 PLHFACQNGRKEVVEILIREKANIEALN-QHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLH 1305          

HSP 11 Score: 67.3958 bits (163), Expect = 4.540e-10
Identity = 27/73 (36.99%), Postives = 49/73 (67.12%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++ P+H AC+ GH+EV + L+  K NI+A++      P+H AC+ GHK++++IL+ +K +I+A  +    P+H
Sbjct: 1333 KFTPLHKACQNGHAEVVEILVKEKANIDALA-EKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLH 1404          

HSP 12 Score: 65.4698 bits (158), Expect = 2.181e-9
Identity = 27/73 (36.99%), Postives = 46/73 (63.01%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            ++ P+H AC  GH E  + LI  K NI+A+   N   P+H AC+ GH ++++IL+ +K +I+A  +  + P+H
Sbjct: 1300 KYTPLHLACARGHKEAVQILIGEKANIDALD-ENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLH 1371          
BLAST of SMED30013787 vs. TrEMBL
Match: gnl|BL_ORD_ID|21200039 (tr|A0A5E4MJ85|A0A5E4MJ85_9HEMI Ankyrin repeat-containing domain,Ankyrin repeat OS=Cinara cedri OX=506608 GN=CINCED_3A008370 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.010e-14
Identity = 32/73 (43.84%), Postives = 48/73 (65.75%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGS-NNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W P+HYA   GH  + KFL+N+  NI+A+S + + K+PIH A + GHKD+++ LL     I + D+N W P+H
Sbjct: 1460 WTPLHYAAWKGHFNIVKFLVNKGANIDAVSATIDRKKPIHAAAQGGHKDVIEFLLSNHAYINSVDRNGWTPLH 1532          

HSP 2 Score: 68.5514 bits (166), Expect = 2.341e-10
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGS-NNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W P+HYA + G+ ++ KFL+++   + A+S + N+ +PIH A + GHK+I++ LL+    +   D+N W P+H
Sbjct: 1123 WTPLHYAAQQGYLDIFKFLVSKGAYMNAVSTTANHDKPIHIAAKAGHKNIIEFLLNNGVSVNDPDRNGWTPLH 1195          

HSP 3 Score: 63.929 bits (154), Expect = 8.735e-9
Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = 3
Query:  177 QQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGS-NNKRPIHYACERGHKDILKILLDQKCDIEACDQNN-WRPIH 467
             +N IEF+     S     +NG   W P+H+A   GH  V KFL+    NI AIS   + ++PIH A +R H D++  LL+   ++   D+ N W P+H
Sbjct: 1169 HKNIIEFLLNNGVSVNDPDRNG---WTPLHWAAWQGHLNVVKFLVGEGANINAISTMVDCRKPIHMAAQRDHGDVIGFLLNIGMNVNDADKKNGWTPLH 1264          

HSP 4 Score: 63.929 bits (154), Expect = 8.735e-9
Identity = 27/73 (36.99%), Postives = 47/73 (64.38%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGS-NNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W P++YA   GH    KFL+++  NI A+S + ++ +PIH A + G K+I+++LL +  ++   DQN  +P+H
Sbjct: 1328 WTPLYYAALQGHLGSAKFLVSKGANINAVSTTPDHSKPIHIAAQYGRKNIIELLLSKGANVNDVDQNGGKPLH 1400          

HSP 5 Score: 62.7734 bits (151), Expect = 2.307e-8
Identity = 27/81 (33.33%), Postives = 51/81 (62.96%), Query Frame = 3
Query:  228 EKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAI-SGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +KKNG   W P+HYA   G     +FLI++  +I A+ S ++ ++PIH A +  +K+++ +LL++   ++  DQ+ W P++
Sbjct: 1255 DKKNG---WTPLHYAASRGSLRTAEFLIDKGADINAMDSSASYRKPIHVAAQYDNKNVIDLLLNKGASVDDVDQDGWTPLY 1332          

HSP 6 Score: 56.6102 bits (135), Expect = 3.150e-6
Identity = 28/100 (28.00%), Postives = 54/100 (54.00%), Query Frame = 3
Query:  177 QQNSIEFVEQFFRSEYLEKK-NGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSN-NKRPIHYACERGHKDILKILLDQKCDI-EACDQNNWRPIH 467
            ++ ++  V+ F   ++L+    G   W P+++A   G  +V K+L  +  NI A+  +  +K+PIH A + G+K+++  LL +   I +    N W P+H
Sbjct: 1028 EKGALNIVKYFIEEKHLDVNLKGNYHWTPLYFAAYSGKLDVVKYLTEKGANINAVDTTTYHKKPIHIATQYGNKNVIDFLLHKGVSIHDISTGNGWTPLH 1127          

HSP 7 Score: 55.4546 bits (132), Expect = 7.907e-6
Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+HYA   G     KFL++R  NI  +   +  + IH A + GHK I++ LL     I   D+N W P+H
Sbjct: 1398 PLHYAALQGRLSTVKFLVSRGANITTV---DCNKLIHVAVKEGHKSIVEFLLSNGALINTIDENGWTPLH 1464          
BLAST of SMED30013787 vs. TrEMBL
Match: gnl|BL_ORD_ID|21897806 (tr|A0A1X7UT91|A0A1X7UT91_AMPQE ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.066e-14
Identity = 44/112 (39.29%), Postives = 68/112 (60.71%), Query Frame = 3
Query:  144 MDG-FEFFVAVIQQNSIEFVEQFFRSEYLE-KKNGILQWHPIHYACEGGHSEVTKFLIN-RKCNIEAISGSNNKRPIHYACERGHKDILK-ILLDQKCDIEACDQNNWRPIH 467
            MDG F+  V   + N+IE V      ++ +    G     P+HYAC+ GH E+ KFLIN  +CN EA + SNN RP+H AC  G+ DI++ +++++ CD+ A  +N + P+H
Sbjct:    1 MDGDFKLLVDACESNNIEMVRHLVIDKHCDVNAKGRNGNTPLHYACQKGHFEIVKFLINCIECNAEAKNNSNN-RPLHGACFSGNVDIVRHLVIEKHCDVNAKGRNGYTPLH 111          

HSP 2 Score: 68.1662 bits (165), Expect = 2.829e-10
Identity = 35/80 (43.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:  234 KNGILQWHPIHYACEGGHSEVTKFLIN-RKCNIEAISGSNNKRPIHYACERGHKDILK-ILLDQKCDIEACDQNNWRPIH 467
            +NG   + P+HYACE GH E+ K L N  +CN EA   SN+ RP+H ACE G+  I++ +++D+ CD+ A  +N + P+H
Sbjct:  104 RNG---YTPLHYACEKGHFEIIKILTNYPQCNTEAEDNSND-RPLHKACESGNVYIVRHLVIDKHCDVNAKGRNGYTPLH 179          

HSP 3 Score: 64.6994 bits (156), Expect = 4.278e-9
Identity = 33/72 (45.83%), Postives = 49/72 (68.06%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFL-INRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQ-KCDIEACDQNNWRPIH 467
            P+H ACE G+  + + L I++ C++ A  G N   P+HYACE GH +I+KIL +  +C+IEA D+ N RP+H
Sbjct:  143 PLHKACESGNVYIVRHLVIDKHCDVNA-KGRNGYTPLHYACENGHFEIVKILNNHPQCNIEAEDKYNRRPLH 213          
BLAST of SMED30013787 vs. TrEMBL
Match: gnl|BL_ORD_ID|11121254 (tr|A0A1B8FHL1|A0A1B8FHL1_9PEZI ANK_REP_REGION domain-containing protein OS=Pseudogymnoascus sp. 03VT05 OX=1622148 GN=VE02_08771 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.782e-13
Identity = 31/73 (42.47%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            QW P+HYAC  G+ +V K LI R  ++ AI G     P+HYAC  G+ D+ K+L+D+  D+ A +   W P+H
Sbjct:   47 QWTPLHYACSNGNLDVAKLLIERGADVSAIEG-RQWTPLHYACSNGNLDVAKLLIDRGADVSAINGRPWTPLH 118          
BLAST of SMED30013787 vs. TrEMBL
Match: gnl|BL_ORD_ID|16509962 (tr|A0A182G8P5|A0A182G8P5_AEDAL Uncharacterized protein OS=Aedes albopictus OX=7160 GN=RP20_CCG005280 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.905e-12
Identity = 36/94 (38.30%), Postives = 59/94 (62.77%), Query Frame = 3
Query:  192 EFVEQFFRSEYLEKKNGILQWH--PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            E VE+F R++   K N I   +  P+H+AC+ GH+ + + LI +  NIEA++   N  P+H AC  GH ++++ILL +K +I+A    N+ P+H
Sbjct: 1197 EVVEKFTRNK--AKMNAISHKNSTPLHFACQNGHTNIVEILIEKNANIEALT-EENFTPLHLACHNGHIEVVEILLREKANIDALSHENFTPLH 1287          

HSP 2 Score: 60.8474 bits (146), Expect = 1.060e-7
Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H+AC   H EV +     K  + AIS  N+  P+H+AC+ GH +I++IL+++  +IEA  + N+ P+H
Sbjct: 1189 PLHWAC---HKEVVEKFTRNKAKMNAISHKNS-TPLHFACQNGHTNIVEILIEKNANIEALTEENFTPLH 1254          

HSP 3 Score: 58.151 bits (139), Expect = 9.200e-7
Identity = 27/56 (48.21%), Postives = 37/56 (66.07%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKC 425
            P+H AC  GH EV + L+  K NI+A+S  N   P+H+A E GHK+I++IL  QK 
Sbjct: 1252 PLHLACHNGHIEVVEILLREKANIDALSHENF-TPLHFAYESGHKEIVEILTKQKS 1306          
BLAST of SMED30013787 vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 53.9138 bits (128), Expect = 7.879e-9
Identity = 20/73 (27.40%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            Q+ P+H+A + G   +T+ L++R   +   + +  + PIH AC  G ++++++LL +  D  A  ++ W  +H
Sbjct:  500 QYTPLHFAAQNGDEALTRLLLDRAATMNE-ADAQGRTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTALH 571          
BLAST of SMED30013787 vs. Ensembl Cavefish
Match: ANKRD52 (ankyrin repeat domain 52 [Source:HGNC Symbol;Acc:HGNC:26614])

HSP 1 Score: 53.9138 bits (128), Expect = 8.133e-9
Identity = 22/69 (31.88%), Postives = 42/69 (60.87%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GH+E+   L+N+  N+ A S   +++ IH+A   GH +I+K+L+ +  D+   D+  + P+H
Sbjct:  132 LHHAAYSGHTEMVTLLLNKGANLSA-SDKKDRQAIHWAAYLGHLEIVKVLVSRNADVACRDKRGYTPLH 199          
BLAST of SMED30013787 vs. Ensembl Cavefish
Match: ripk4 (receptor interacting serine/threonine kinase 4 [Source:NCBI gene;Acc:103022568])

HSP 1 Score: 53.9138 bits (128), Expect = 8.704e-9
Identity = 20/73 (27.40%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            Q+ P+H+A + G   +T+ L++R   +   + +  + PIH AC  G ++++++LL +  D  A  ++ W  +H
Sbjct:  491 QYTPLHFAAQNGDEALTRLLLDRAATMNE-ADAQGRTPIHVACHHGRENVVRVLLSRGADAHARGKDEWTALH 562          
BLAST of SMED30013787 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 53.1434 bits (126), Expect = 1.570e-8
Identity = 22/70 (31.43%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH EV +FL+     ++A    +++ P+H A   GHK+++K+LL+ K + ++       P+H
Sbjct:  415 PLHMAARAGHCEVAQFLLQNLAQVDA-KAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLH 483          

HSP 2 Score: 50.8322 bits (120), Expect = 1.227e-7
Identity = 28/78 (35.90%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  234 KNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            KNGI    P+H A   G+  + + L++R   I+A +  +   P+H A   GH  +++ILLDQ   I+A  +N   PIH
Sbjct:  212 KNGIT---PLHIAARRGNVIMVRLLLDRGAQIDART-KDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIH 285          

HSP 3 Score: 46.595 bits (109), Expect = 3.327e-6
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H   + +LL     +EA  ++   P+H
Sbjct:  316 PLHVAAHCGHHRMAKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLH 384          

HSP 4 Score: 46.2098 bits (108), Expect = 4.385e-6
Identity = 21/70 (30.00%), Postives = 38/70 (54.29%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H AC+ G  +V + L+ R  N  A +G N   P+H A    + D++K+L+ +     +  +N + P+H
Sbjct:  514 PLHVACKYGKVDVAELLLERGANPNA-AGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLH 582          
BLAST of SMED30013787 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 51.2174 bits (121), Expect = 8.140e-8
Identity = 29/78 (37.18%), Postives = 43/78 (55.13%), Query Frame = 3
Query:  234 KNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            KNGI    P+H A   G+  + + L++R   I+A +  +   P+H A   GH  I++ILLDQ   I+A  +N   PIH
Sbjct:  209 KNGIT---PLHIASRRGNVIMVRLLLDRGATIDAKT-KDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIH 282          

HSP 2 Score: 48.521 bits (114), Expect = 7.749e-7
Identity = 21/70 (30.00%), Postives = 38/70 (54.29%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH EV +FL+     ++A    +++  +H A   GHK+++K+LL+ K +  +       P+H
Sbjct:  412 PLHMASRAGHCEVAEFLLQNAAPVDA-KAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLH 480          

HSP 3 Score: 47.3654 bits (111), Expect = 1.709e-6
Identity = 22/72 (30.56%), Postives = 39/72 (54.17%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H  ++ +LL     +EA  ++   P+H
Sbjct:  313 PLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFT---PLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLH 381          
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 3.656e-10
Identity = 23/69 (33.33%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GHSE+  FL+ +  NI A     ++R IH+A   GH +++K+L+    D+   D+  + P+H
Sbjct:  142 LHHAAFNGHSEMVNFLVAKGANINAFD-KKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLH 209          
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007334.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007334.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 5.748e-8
Identity = 24/71 (33.80%), Postives = 37/71 (52.11%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCN-IEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H AC+GGH+ V   L++R    +           +H A   GH + L++LL Q  DI A D++   P+H
Sbjct:   41 PLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLH 111          
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 5.787e-8
Identity = 24/71 (33.80%), Postives = 37/71 (52.11%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCN-IEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H AC+GGH+ V   L++R    +           +H A   GH + L++LL Q  DI A D++   P+H
Sbjct:   41 PLHLACQGGHAAVAGLLLSRAAPPLLRTLDQRGHSCLHLAATAGHVETLRLLLGQGADINATDKSGCTPLH 111          
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Match: ankdd1a (ankyrin repeat and death domain containing 1A [Source:ZFIN;Acc:ZDB-GENE-070615-8])

HSP 1 Score: 49.2914 bits (116), Expect = 7.262e-8
Identity = 24/71 (33.80%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRK--CNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H A EGGH E  + L++ +  C+I A++ + +   +H A + GH+ I K+L+D+  DI A       P+H
Sbjct:  211 LHLAAEGGHLECVRMLLDCEAICDINALN-NESMNALHMAAKHGHEQIAKLLIDETIDINAISTKQASPLH 280          
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Match: ankrd6b (ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE-030916-4])

HSP 1 Score: 47.7506 bits (112), Expect = 2.032e-7
Identity = 21/64 (32.81%), Postives = 35/64 (54.69%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQN 449
            P+H A   GH+EV + L +  CN++ +     +  +H A E G   +L +LLD+ C ++  D N
Sbjct:   45 PLHLAASRGHAEVVRLLASAGCNLD-LQDDGGQTALHRAVEAGSTAVLSVLLDEGCSLDRQDTN 107          
BLAST of SMED30013787 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 57.7658 bits (138), Expect = 2.213e-11
Identity = 27/75 (36.00%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSN--NKRPIHYACERGHKD-ILKILLDQKCDIEACDQNNWRPIH 467
            W PIH A   GH+E  + L+    +  A +G    N  P+HYA   GH D  +++L+++  D+EA  ++ WR IH
Sbjct:   31 WRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIH 105          
BLAST of SMED30013787 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 52.7582 bits (125), Expect = 3.568e-9
Identity = 37/126 (29.37%), Postives = 58/126 (46.03%), Query Frame = 3
Query:   90 ITSSDLPDLPLRFYL-KLHMDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            + S    D PL F   K H D  E  +A              RS  +E +     + P+ +A  GGH++V   L+ +   +   SGSNN  P+  AC +GH D++K+LL    +IE   ++   P+
Sbjct:   81 VESDSNKDSPLTFACWKGHCDVVELLLA--------------RSANIEHRTK-EGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPL 191          

HSP 2 Score: 43.8986 bits (102), Expect = 6.169e-6
Identity = 28/108 (25.93%), Postives = 51/108 (47.22%), Query Frame = 3
Query:  141 HMDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            H DG E   A +  N+     ++  ++ LE  N  +    +      GH +V   L++    I   S SN   P+ +AC +GH D++++LL +  +IE   +  + P+
Sbjct:   26 HRDGSELMKANVPTNT---NREYCHAKILEN-NKTMSRDAL-----AGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPL 124          
BLAST of SMED30013787 vs. Ensembl Nematostella
Match: EDO35987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ9])

HSP 1 Score: 49.6766 bits (117), Expect = 9.482e-9
Identity = 20/74 (27.03%), Postives = 40/74 (54.05%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSN-----NKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
             +HYA   G +++ + LI +  N+EA +  +      +  +HYA ++GH +++K+L+ +  DI   D     P+
Sbjct:    2 ALHYAVREGFADIARLLIKKGSNLEATTDMDAHDMFGRTALHYAAQQGHMEMIKLLVTRGADIHTRDSEGQTPL 75          
BLAST of SMED30013787 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 47.7506 bits (112), Expect = 5.003e-8
Identity = 23/59 (38.98%), Postives = 34/59 (57.63%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCD 428
            W P+H AC  G  EV K L+    ++ A S ++  RP+H A E GH ++L++LL    D
Sbjct:   21 WTPLHEACARGKLEVVKVLVQYGADVNAHS-NDGIRPLHDAAEGGHVEVLRLLLTYGAD 78          
BLAST of SMED30013787 vs. Ensembl Nematostella
Match: EDO45485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW0])

HSP 1 Score: 46.2098 bits (108), Expect = 9.188e-8
Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEAC 440
            P+H A   GH E+ K L++   ++EA +  N  +P+H A + GHK I++ILL +    +A 
Sbjct:    4 PLHIAVVYGHWEIVKLLLDEGADVEAQT-KNGYQPLHLAAQYGHKIIIEILLQRGAPPDAL 63          

HSP 2 Score: 42.3578 bits (98), Expect = 2.584e-6
Identity = 16/36 (44.44%), Postives = 26/36 (72.22%), Query Frame = 3
Query:  360 PIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH +I+K+LLD+  D+EA  +N ++P+H
Sbjct:    4 PLHIAVVYGHWEIVKLLLDEGADVEAQTKNGYQPLH 39          
BLAST of SMED30013787 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 55.4546 bits (132), Expect = 3.083e-9
Identity = 23/70 (32.86%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH EV +FL+     ++A    +++ P+H A   GHK+++K+LLD K + ++       P+H
Sbjct:  438 PLHMASRAGHCEVAQFLLQNAAQVDA-RAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLH 506          

HSP 2 Score: 47.7506 bits (112), Expect = 1.167e-6
Identity = 27/78 (34.62%), Postives = 42/78 (53.85%), Query Frame = 3
Query:  234 KNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            KNGI    P+H A   G+  + + L++R   I+A +  +   P+H A   GH  I++ILL+    I+A  +N   PIH
Sbjct:  235 KNGIT---PLHIASRRGNVMMVRLLLDRGAQIDAQT-KDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIH 308          

HSP 3 Score: 46.595 bits (109), Expect = 3.360e-6
Identity = 22/72 (30.56%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINR--KCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H A   GH  + K L+++  K N  A++G     P+H AC++ H   + +LL     +EA  ++   P+H
Sbjct:  339 PLHVAAHCGHHRMAKVLLDKGAKANARALNGFT---PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLH 407          
BLAST of SMED30013787 vs. Ensembl Medaka
Match: ENSORLT00000028696.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.9138 bits (128), Expect = 8.123e-9
Identity = 21/69 (30.43%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GH+E+ + L++R  NI A     ++R IH+A   GH +++K+L++   +++  D+  + P+H
Sbjct:  144 LHHAAFSGHTEMVRLLLSRGSNINAFD-KKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLH 211          
BLAST of SMED30013787 vs. Ensembl Medaka
Match: ENSORLT00000037670.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.9138 bits (128), Expect = 8.129e-9
Identity = 21/69 (30.43%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GH+E+ + L++R  NI A     ++R IH+A   GH +++K+L++   +++  D+  + P+H
Sbjct:  144 LHHAAFSGHTEMVRLLLSRGSNINAFD-KKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLH 211          
BLAST of SMED30013787 vs. Ensembl Medaka
Match: ENSORLT00000045754.1 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.9138 bits (128), Expect = 8.129e-9
Identity = 21/69 (30.43%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GH+E+ + L++R  NI A     ++R IH+A   GH +++K+L++   +++  D+  + P+H
Sbjct:  144 LHHAAFSGHTEMVRLLLSRGSNINAFD-KKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLH 211          
BLAST of SMED30013787 vs. Ensembl Medaka
Match: ENSORLT00000005069.2 (serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A [Source:NCBI gene;Acc:101168382])

HSP 1 Score: 53.9138 bits (128), Expect = 8.159e-9
Identity = 21/69 (30.43%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  261 IHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +H+A   GH+E+ + L++R  NI A     ++R IH+A   GH +++K+L++   +++  D+  + P+H
Sbjct:  187 LHHAAFSGHTEMVRLLLSRGSNINAFD-KKDRRAIHWAAYMGHLEVVKLLVESGAEVDCKDKKGYSPLH 254          
BLAST of SMED30013787 vs. Planmine SMEST
Match: SMESG000017258.1 (SMESG000017258.1)

HSP 1 Score: 231.106 bits (588), Expect = 1.255e-72
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 3
Query:  144 MDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            MDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH
Sbjct:    1 MDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 108          

HSP 2 Score: 113.62 bits (283), Expect = 1.018e-29
Identity = 47/71 (66.20%), Postives = 59/71 (83.10%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            W PIH+ACE GH  + K LI+RKC+IEA +G NN RPIH+ACERGHKDI K+L+D+KCD+ AC +N+WRPI
Sbjct:  237 WRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPI 307          

HSP 3 Score: 106.301 bits (264), Expect = 3.598e-27
Identity = 46/72 (63.89%), Postives = 58/72 (80.56%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W PIH+ACE GH ++ K L++  CNIEA +  +  RPIH ACERGHKDILK+LLD +CDIEAC+Q++WRPIH
Sbjct:  104 WRPIHFACEMGHKDIVKMLLDHHCNIEA-ADQDEWRPIHLACERGHKDILKMLLDSQCDIEACNQDSWRPIH 174          

HSP 4 Score: 105.916 bits (263), Expect = 4.584e-27
Identity = 44/72 (61.11%), Postives = 57/72 (79.17%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W PIH ACE G  E+ + LI+RKC+IEA  G NN RPIH+AC+ GH  I+++L+D+KCDIEAC ++NWRPIH
Sbjct:  170 WRPIHLACEKGDKEIVRMLIDRKCDIEACVGMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACIEDNWRPIH 241          

HSP 5 Score: 94.7449 bits (234), Expect = 3.542e-23
Identity = 43/77 (55.84%), Postives = 60/77 (77.92%), Query Frame = 3
Query:  240 GILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEA-CDQNNWRPIH 467
            G+  + PIH+AC+ GH+ + + L++RKC+IEA    +N RPIH+ACERGH++I K+L+D+KCDIEA    NNWRPIH
Sbjct:  200 GMNNYRPIHFACKWGHNVIVRMLMDRKCDIEACI-EDNWRPIHFACERGHRNIAKLLIDRKCDIEAGAGLNNWRPIH 275          

HSP 6 Score: 71.633 bits (174), Expect = 4.951e-15
Identity = 35/112 (31.25%), Postives = 55/112 (49.11%), Query Frame = 3
Query:  225 LEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNK--------------------------------RPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            +E   G+  W PIH+ACE GH ++ K L++RKC++ A   ++ +                                RP+H+ACERGH +I+K+L    CDIEA  +  + P+
Sbjct:  262 IEAGAGLNNWRPIHFACERGHKDIAKLLVDRKCDVNACVENDWRPIIWASERGYIEIVKILINQKCDIDACDRWQWRPLHWACERGHTEIVKLLTQAGCDIEALTREEYSPM 373          

HSP 7 Score: 47.7506 bits (112), Expect = 7.804e-7
Identity = 23/70 (32.86%), Postives = 40/70 (57.14%), Query Frame = 3
Query:  249 QWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWR 458
            QW P+H+ACE GH+E+ K L    C+IEA++      P+  A  +  K+I++I+   K + +   +  W+
Sbjct:  336 QWRPLHWACERGHTEIVKLLTQAGCDIEALT-REEYSPMKLAENKNWKEIIEIINKVKSERKGEKRLTWK 404          
BLAST of SMED30013787 vs. Planmine SMEST
Match: SMESG000017260.1 (SMESG000017260.1)

HSP 1 Score: 129.413 bits (324), Expect = 3.157e-35
Identity = 53/108 (49.07%), Postives = 77/108 (71.30%), Query Frame = 3
Query:  144 MDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            MD FE F++ ++  S E   ++F+ +YLE++ GI QW PIH ACE G +E+ + L+ RKCN++A++G  N+ PIH  C++G  D +K+L+D KCDIEACD  NWR IH
Sbjct:    1 MDEFELFISAVKAGSKELFNKYFKEKYLEQRFGIFQWLPIHLACEEGQAEIAEMLLTRKCNVDALAGLFNRCPIHLVCQKGQADFVKLLIDYKCDIEACDLKNWRAIH 108          

HSP 2 Score: 100.908 bits (250), Expect = 2.533e-25
Identity = 51/106 (48.11%), Postives = 72/106 (67.92%), Query Frame = 3
Query:  150 GFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            G+E  V ++       +EQ   +E  ++ N      PIH+AC+ GH EV K LIN+KCN+EA    NN+RP+H ACE+GH DI+++L+DQKC+I+A DQN+ RPIH
Sbjct:  147 GYEKIVKIL-------IEQKCDTEAYDENN----CRPIHFACKRGHKEVVKLLINQKCNLEACD-KNNQRPLHLACEKGHTDIVRLLIDQKCNIDANDQNSNRPIH 240          

HSP 3 Score: 96.2857 bits (238), Expect = 1.029e-23
Identity = 49/122 (40.16%), Postives = 75/122 (61.48%), Query Frame = 3
Query:  102 DLPDLPLRFYLKLHMDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            D+    L+ +  +H   FE    +++      + Q    E   +KN      PIH ACE G+ ++ K LI +KC+ EA    NN RPIH+AC+RGHK+++K+L++QKC++EACD+NN RP+H
Sbjct:   95 DIEACDLKNWRAIHFACFEGHADIVKM----LINQKCNFETCAEKN----QRPIHLACEKGYEKIVKILIEQKCDTEAYD-ENNCRPIHFACKRGHKEVVKLLINQKCNLEACDKNNQRPLH 207          

HSP 4 Score: 91.6633 bits (226), Expect = 4.339e-22
Identity = 39/74 (52.70%), Postives = 52/74 (70.27%), Query Frame = 3
Query:  246 LQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            + W PIH+AC  G  E+   LI +KC+IEA     N RPIH AC +GHK+I+++L++ KCDIEACD + WR IH
Sbjct:  267 INWRPIHFACWKGQKEIVNILITKKCDIEA-PEKKNLRPIHLACGKGHKEIVEVLINHKCDIEACDDDGWRAIH 339          

HSP 5 Score: 90.8929 bits (224), Expect = 9.494e-22
Identity = 39/70 (55.71%), Postives = 55/70 (78.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            P+H ACE GH+++ + LI++KCNI+A +  N+ RPIH AC++GH  I+K L +QKC+IEA +Q NWRPIH
Sbjct:  205 PLHLACEKGHTDIVRLLIDQKCNIDA-NDQNSNRPIHLACDKGHLKIVKALTNQKCNIEAANQINWRPIH 273          

HSP 6 Score: 87.4261 bits (215), Expect = 1.659e-20
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            PIHYACE GH+E+ + LI+  CNIEA    N +RPIHYA E GH +  KIL+ +KCDIEAC QN  R IH
Sbjct:  370 PIHYACEMGHTEIVQLLIDANCNIEACDKWN-RRPIHYASEAGHVECTKILMLKKCDIEACAQNERRAIH 438          

HSP 7 Score: 85.8853 bits (211), Expect = 4.532e-20
Identity = 37/72 (51.39%), Postives = 53/72 (73.61%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W  IH ACE G++++ + LI+  C+IE +    +KRPIHYACE GH +I+++L+D  C+IEACD+ N RPIH
Sbjct:  335 WRAIHLACEKGYADIAQLLIDNNCDIE-VCDQISKRPIHYACEMGHTEIVQLLIDANCNIEACDKWNRRPIH 405          

HSP 8 Score: 70.4774 bits (171), Expect = 1.324e-14
Identity = 34/69 (49.28%), Postives = 45/69 (65.22%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            PIHYA E GH E TK L+ +KC+IEA +  N +R IH ACE+GH +I+K+L+   C+ EA       PI
Sbjct:  403 PIHYASEAGHVECTKILMLKKCDIEACA-QNERRAIHLACEKGHAEIVKLLVRAHCNTEALTLKGNSPI 470          
BLAST of SMED30013787 vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.060e-29
Identity = 51/112 (45.54%), Postives = 77/112 (68.75%), Query Frame = 3
Query:  132 LKLHMDGFEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            +++  + F+ F+  I+  S E   ++F+ E+LE+K+  L+  PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D +NWRPIH
Sbjct:   65 IRIRNEEFKLFINAIKSGSAELFRRYFKEEFLERKDAGLR-RPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIH 174          

HSP 2 Score: 88.9669 bits (219), Expect = 4.520e-21
Identity = 39/72 (54.17%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D+   RPIH
Sbjct:  170 WRPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIH 240          

HSP 3 Score: 79.7221 bits (195), Expect = 7.776e-18
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = 3
Query:  246 LQWH---PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            L W    PIH AC  GHSE  K LI  KC+IEA+     +RPIH AC +GH + +K+L++  CDIEA D  N RPIH
Sbjct:  198 LDWRNRRPIHLACYHGHSEAVKLLIENKCDIEALD-EQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIH 273          

HSP 4 Score: 72.7886 bits (177), Expect = 2.036e-15
Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            PIH AC  GHSE  K LI   C+IEA+   N +RPIH+AC +GH + +K+L++ KCDI+A D++   P+
Sbjct:  238 PIHLACYQGHSEAVKLLIEHNCDIEALDWWN-QRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPM 305          
BLAST of SMED30013787 vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.754e-29
Identity = 51/105 (48.57%), Postives = 73/105 (69.52%), Query Frame = 3
Query:  153 FEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            F+ F+  I+  S E   ++F+ E+LE+K+  L+  PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D +NWRPIH
Sbjct:  113 FKLFINAIKSGSAELFRRYFKEEFLERKDAGLR-RPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIH 215          

HSP 2 Score: 88.1965 bits (217), Expect = 7.435e-21
Identity = 39/72 (54.17%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D+   RPIH
Sbjct:  211 WRPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIH 281          

HSP 3 Score: 79.337 bits (194), Expect = 9.334e-18
Identity = 38/70 (54.29%), Postives = 47/70 (67.14%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            PIH AC  GHSE  K LI  KC+IEA+     +RPIH AC +GH + +K+L++  CDIEA D  N RPIH
Sbjct:  246 PIHLACYHGHSEAVKLLIENKCDIEALD-EQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIH 314          

HSP 4 Score: 72.4034 bits (176), Expect = 2.590e-15
Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            PIH AC  GHSE  K LI   C+IEA+   N +RPIH+AC +GH + +K+L++ KCDI+A D++   P+
Sbjct:  279 PIHLACYQGHSEAVKLLIEHNCDIEALDWWN-QRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPM 346          
BLAST of SMED30013787 vs. Planmine SMEST
Match: SMESG000017274.1 (SMESG000017274.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.907e-29
Identity = 51/105 (48.57%), Postives = 73/105 (69.52%), Query Frame = 3
Query:  153 FEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            F+ F+  I+  S E   ++F+ E+LE+K+  L+  PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D +NWRPIH
Sbjct:   77 FKLFINAIKSGSAELFRRYFKEEFLERKDAGLR-RPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIEHKCDIEALDWDNWRPIH 179          

HSP 2 Score: 88.9669 bits (219), Expect = 4.485e-21
Identity = 39/72 (54.17%), Postives = 51/72 (70.83%), Query Frame = 3
Query:  252 WHPIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            W PIH+AC  GH+E+ K LI  KC+IEA+    N+RPIH AC  GH + +K+L++ KCDIEA D+   RPIH
Sbjct:  175 WRPIHHACIAGHAEIVKLLIEHKCDIEALDW-RNRRPIHLACYHGHSEAVKLLIENKCDIEALDEQKRRPIH 245          

HSP 3 Score: 79.7221 bits (195), Expect = 7.278e-18
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = 3
Query:  246 LQWH---PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPIH 467
            L W    PIH AC  GHSE  K LI  KC+IEA+     +RPIH AC +GH + +K+L++  CDIEA D  N RPIH
Sbjct:  203 LDWRNRRPIHLACYHGHSEAVKLLIENKCDIEALD-EQKRRPIHLACYQGHSEAVKLLIEHNCDIEALDWWNQRPIH 278          

HSP 4 Score: 72.4034 bits (176), Expect = 2.497e-15
Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 3
Query:  258 PIHYACEGGHSEVTKFLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNNWRPI 464
            PIH AC  GHSE  K LI   C+IEA+   N +RPIH+AC +GH + +K+L++ KCDI+A D++   P+
Sbjct:  243 PIHLACYQGHSEAVKLLIEHNCDIEALDWWN-QRPIHHACIQGHSEAVKLLIENKCDIDARDESGNSPM 310          
The following BLAST results are available for this feature:
BLAST of SMED30013787 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ILK7.206e-1037.14integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK2.800e-937.14integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK2.866e-937.14integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK2.866e-937.14integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
ILK2.866e-937.14integrin linked kinase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-43.783e-830.00TRP (Transient receptor potential) channel family ... [more]
kdin-18.854e-729.41KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-18.855e-729.41KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-18.862e-729.41KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-18.863e-729.41KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nompC1.337e-1136.11gene:FBgn0016920 transcript:FBtr0300012[more]
nompC1.338e-1136.11gene:FBgn0016920 transcript:FBtr0304843[more]
nompC1.338e-1136.11gene:FBgn0016920 transcript:FBtr0343224[more]
nompC1.339e-1136.11gene:FBgn0016920 transcript:FBtr0347408[more]
nompC1.339e-1136.11gene:FBgn0016920 transcript:FBtr0347409[more]
back to top
BLAST of SMED30013787 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ankrd52a1.193e-1034.29ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
ankrd52a1.195e-1034.29ankyrin repeat domain 52a [Source:NCBI gene;Acc:55... [more]
BX640476.13.163e-929.07ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.13.165e-929.07ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1b3.166e-929.07ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ilk1.621e-832.86integrin linked kinase [Source:NCBI gene;Acc:10014... [more]
krit12.094e-839.19KRIT1, ankyrin repeat containing [Source:NCBI gene... [more]
krit12.382e-839.19KRIT1, ankyrin repeat containing [Source:NCBI gene... [more]
krit12.453e-839.19KRIT1, ankyrin repeat containing [Source:NCBI gene... [more]
pan32.833e-837.50poly(A) specific ribonuclease subunit PAN3 [Source... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ilk1.987e-937.14integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk1.987e-937.14integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk2.397e-937.14integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ilk2.690e-937.14integrin linked kinase [Source:MGI Symbol;Acc:MGI:... [more]
Ankrd281.637e-831.43ankyrin repeat domain 28 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30013787 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q502K3|ANR52_DANRE9.020e-1034.29Serine/threonine-protein phosphatase 6 regulatory ... [more]
sp|Q13418|ILK_HUMAN1.376e-837.14Integrin-linked protein kinase OS=Homo sapiens OX=... [more]
sp|Q99J82|ILK_RAT1.390e-837.14Integrin-linked protein kinase OS=Rattus norvegicu... [more]
sp|O55222|ILK_MOUSE1.390e-837.14Integrin-linked protein kinase OS=Mus musculus OX=... [more]
sp|P57044|ILK_CAVPO1.443e-837.14Integrin-linked protein kinase OS=Cavia porcellus ... [more]
back to top
BLAST of SMED30013787 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|164889093.744e-1640.21tr|A0A182GGY8|A0A182GGY8_AEDAL ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|212000393.010e-1443.84tr|A0A5E4MJ85|A0A5E4MJ85_9HEMI Ankyrin repeat-cont... [more]
gnl|BL_ORD_ID|218978066.066e-1439.29tr|A0A1X7UT91|A0A1X7UT91_AMPQE ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|111212542.782e-1342.47tr|A0A1B8FHL1|A0A1B8FHL1_9PEZI ANK_REP_REGION doma... [more]
gnl|BL_ORD_ID|165099622.905e-1238.30tr|A0A182G8P5|A0A182G8P5_AEDAL Uncharacterized pro... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ripk47.879e-927.40receptor interacting serine/threonine kinase 4 [So... [more]
ANKRD528.133e-931.88ankyrin repeat domain 52 [Source:HGNC Symbol;Acc:H... [more]
ripk48.704e-927.40receptor interacting serine/threonine kinase 4 [So... [more]
ank1b1.570e-831.43ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1a8.140e-837.18ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003991.13.656e-1033.33pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
ENSPMAT00000007334.15.748e-833.80pep scaffold:Pmarinus_7.0:GL483392:1130:8888:1 gen... [more]
ENSPMAT00000007332.15.787e-833.80pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
ankdd1a7.262e-833.80ankyrin repeat and death domain containing 1A [Sou... [more]
ankrd6b2.032e-732.81ankyrin repeat domain 6b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013787 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460992.213e-1136.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281783.568e-929.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359879.482e-927.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341615.003e-838.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454859.188e-836.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013787 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b3.083e-932.86ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000028696.18.123e-930.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000037670.18.129e-930.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000045754.18.129e-930.43serine/threonine-protein phosphatase 6 regulatory ... [more]
ENSORLT00000005069.28.159e-930.43serine/threonine-protein phosphatase 6 regulatory ... [more]
back to top
BLAST of SMED30013787 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017258.11.255e-72100.00SMESG000017258.1[more]
SMESG000017260.13.157e-3549.07SMESG000017260.1[more]
SMESG000017274.11.060e-2945.54SMESG000017274.1[more]
SMESG000017274.11.754e-2948.57SMESG000017274.1[more]
SMESG000017274.11.907e-2948.57SMESG000017274.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013787 ID=SMED30013787|Name=SMED30013787|organism=Schmidtea mediterranea sexual|type=transcript|length=469bp
CGATTTGTGATTGGCAGAAATTATTTCAGTTATTTCAAACAACTAAAACA
TATAATCAAACTAAATATTTAGATCAAATTTTGTCACCAATCACAAGTTC
AGATCTTCCGGACCTTCCATTGAGATTTTATCTGAAATTGCACATGGACG
GATTCGAATTTTTTGTTGCCGTTATACAGCAAAATTCAATAGAATTTGTG
GAACAGTTTTTCAGGTCAGAATATTTGGAGAAAAAGAATGGAATATTACA
ATGGCATCCGATTCATTACGCCTGCGAGGGGGGTCATAGTGAAGTGACGA
AATTTCTCATAAATCGGAAATGTAATATTGAGGCGATCTCTGGATCTAAC
AATAAGCGTCCGATTCATTACGCTTGCGAAAGAGGTCACAAAGACATACT
CAAAATCCTTCTTGATCAAAAGTGTGACATTGAAGCATGTGACCAGAATA
ATTGGCGGCCGATTCATTT
back to top

protein sequence of SMED30013787-orf-1

>SMED30013787-orf-1 ID=SMED30013787-orf-1|Name=SMED30013787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
ICDWQKLFQLFQTTKTYNQTKYLDQILSPITSSDLPDLPLRFYLKLHMDG
FEFFVAVIQQNSIEFVEQFFRSEYLEKKNGILQWHPIHYACEGGHSEVTK
FLINRKCNIEAISGSNNKRPIHYACERGHKDILKILLDQKCDIEACDQNN
WRPIH
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 35..64
e-value: 0.0033
score: 26.7
coord: 69..98
e-value: 2.9E-4
score: 30.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 69..101
score: 11.247
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..108
e-value: 2.0E-21
score: 78.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 2..108
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 7..98
e-value: 1.9E-14
score: 54.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 39..108
score: 19.837
NoneNo IPR availablePANTHERPTHR24188ANKYRIN REPEAT PROTEINcoord: 36..108