Tubulin monoglycylase TTLL3

Overview
NameTubulin monoglycylase TTLL3
Smed IDSMED30013779
Length (bp)3332
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin monoglycylase TTLL3 (SMED30013779) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin monoglycylase TTLL3 (SMED30013779) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin monoglycylase TTLL3 (SMED30013779) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin monoglycylase TTLL3 (SMED30013779) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013779

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013779h1SMcG0014119 dd_Smed_v4_10244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013779h1SMcG0014119 dd_Smed_v4_10244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013779h1SMcG0014119 dd_Smed_v4_10244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013779h1SMcG0014119 dd_Smed_v4_10244_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013779h1SMcG0014119 dd_Smed_v4_10244_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Match: TTLL3 (tubulin tyrosine ligase like 3 [Source:HGNC Symbol;Acc:HGNC:24483])

HSP 1 Score: 461.07 bits (1185), Expect = 5.331e-149
Identity = 235/533 (44.09%), Postives = 335/533 (62.85%), Query Frame = 3
Query:  675 SRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRN--DFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNA 2261
            SRM++N  P   WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + + FFPRCY +   ++K AFI+D+  TA   +LK V+++       E +S     PI+   +  + D    K  K              +   +S +F++ A+  CE  L    H DID++    ++     W  FL  YY+VVHEG ++   +  T ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC   L ++LK++  N ++  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ    N   R  +LP +NMW  ++F+  ++  G  NAWS II+PGMK++VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DR  ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP      +  RR   RP    +  R +
Sbjct:    1 SRMVQNEIPYFIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEVDANSFFPRCYCLGAEDDKKAFIEDFWLTAARNVLKLVVKS-------EWKS----YPIQAVEEEASGDKQPKKQEK--------------NPVLVSPEFVDEALCACEEYLSNLAHMDIDKDLEAPLYLTPEGWSLFLQRYYQVVHEGAELRHLD--TQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQKHLENSCHRHPLLPPDNMWSSQRFQAHLQEMGAPNAWSTIIVPGMKDAVIHALQTSQDTVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRMLDRNCDTGAFELIYKQPAVEVPQYVGIRLLVEGFTIKKPM----AMCHRRMGVRPAVPLLTQRGS 501          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Match: TTLL3 (tubulin tyrosine ligase like 3 [Source:HGNC Symbol;Acc:HGNC:24483])

HSP 1 Score: 438.728 bits (1127), Expect = 6.684e-142
Identity = 224/496 (45.16%), Postives = 322/496 (64.92%), Query Frame = 3
Query:  657 GIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRN--DFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQ-HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVP 2132
            G + +MSRM++N  P   WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + + FFPRCY +   ++K AFI+D+  TA   +LK V+++      I+         +E+       + S  K  KK       +E+ P     +S +F++ A+  CE  L    H DID++    ++     W  FL  YY+VVHEG ++   +  T ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC   L ++LK++  N ++  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ H  ++  R  +LP +NMW  ++F+  ++  G  NAWS II+PGMK++VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DR  ++ CDTG FEL++KQ   T P
Sbjct:   13 GTHALMSRMVQNEIPYFIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEVDANSFFPRCYCLGAEDDKKAFIEDFWLTAARNVLKLVVKSEWKSYPIQA--------VEE-------EASGDKQPKK-------QEKNP---VLVSPEFVDEALCACEEYLSNLAHMDIDKDLEAPLYLTPEGWSLFLQRYYQVVHEGAELRHLD--TQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQKHLENSCHRHPLLPPDNMWSSQRFQAHLQEMGAPNAWSTIIVPGMKDAVIHALQTSQDTVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRMLDRNCDTGAFELIYKQPVTTSP 480          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Match: TTLL8 (tubulin tyrosine ligase like 8 [Source:HGNC Symbol;Acc:HGNC:34000])

HSP 1 Score: 425.631 bits (1093), Expect = 9.423e-133
Identity = 232/603 (38.47%), Postives = 347/603 (57.55%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEK-FYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIF--CWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIF+I G Y  VR  LR +GWVEK F+F         K  P   +V+++    ND        +                       E+ D I+ +MSR++KN  P L WT+++  +DY +L  DQ++NH+ K   FTTK GL  ++  L W+    PD FFPRCY++ T  E+  F++D+  T    +LK V+           + PRDQ   E+ G S  +    ++N +  L  +      PG       + +++A   C+  L   +HEDID +          +WE+    YY +VH    I  +N      +C+ +   +  +  Q D++G RN+WI+KP AKSRGR I+C  ++ ++L++ + +  ++ + ++++QKYIE PLLIC+TKFDIRQWFLVTDWNPLTIW+YK+ YLRF +Q+F+LD L+ A+HL NN++Q    N   RS +LPA NMW   +F+E+++ +G    W  +I P MK+++  A+   QD +E RKNSFELYGADF++   D +PWLIEINSSP M PST +T++L + V ED  KV +DR     CD G FELL++Q  +  PP+ G DL +AG+S+++
Sbjct:   56 KIFSIYGHYPVVRAALRRKGWVEKKFHF-------LPKVIP---DVEDEGARVNDDTCAKVKENQEMAL------------------EKTDNIHDVMSRLVKNEMPYLLWTIKRDIIDYHSLTYDQMLNHYAKTASFTTKIGLCVNMRSLPWYVPANPDSFFPRCYSLCTESEQQEFLEDFRRTMASSILKWVVSHQSCSRSSRSK-PRDQR--EEAGSSDLSSRQDAENAEAKLRGL------PG-------QLVDIACKVCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVHGDAFI--SNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILELAAADHPLSRDNKWVVQKYIETPLLICDTKFDIRQWFLVTDWNPLTIWFYKESYLRFSTQRFSLDKLDSAIHLCNNAVQKYLKNDVGRSPLLPAHNMWTSTRFQEYLQRQGRGAVWGSVIYPSMKKAIAHAMKVAQDHVEPRKNSFELYGADFVLGR-DFRPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIKVAVDR----SCDIGNFELLWRQPVVEPPPFSGSDLCVAGVSVRR 607          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Match: TTLL3 (tubulin tyrosine ligase like 3 [Source:HGNC Symbol;Acc:HGNC:24483])

HSP 1 Score: 418.698 bits (1075), Expect = 1.889e-129
Identity = 214/496 (43.15%), Postives = 306/496 (61.69%), Query Frame = 3
Query:  786 GCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRN--DFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNA 2261
            G      GL  +L  L WFD+ + + FFPRCY +   ++K AFI+D+  TA   +LK V+++       E +S     PI+   +  + D    K  K              +   +S +F++ A+  CE  L    H DID++    ++     W  FL  YY+VVHEG ++   +  T ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC   L ++LK++  N ++  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ    N   R  +LP +NMW  ++F+  ++  G  NAWS II+PGMK++VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DR  ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP      +  RR   RP    +  R +
Sbjct:  243 GTHALMVGLCLNLRNLPWFDEVDANSFFPRCYCLGAEDDKKAFIEDFWLTAARNVLKLVVKS-------EWKS----YPIQAVEEEASGDKQPKKQEK--------------NPVLVSPEFVDEALCACEEYLSNLAHMDIDKDLEAPLYLTPEGWSLFLQRYYQVVHEGAELRHLD--TQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQKHLENSCHRHPLLPPDNMWSSQRFQAHLQEMGAPNAWSTIIVPGMKDAVIHALQTSQDTVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRMLDRNCDTGAFELIYKQPAVEVPQYVGIRLLVEGFTIKKPM----AMCHRRMGVRPAVPLLTQRGS 706          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Match: TTLL8 (tubulin tyrosine ligase like 8 [Source:HGNC Symbol;Acc:HGNC:34000])

HSP 1 Score: 413.305 bits (1061), Expect = 2.651e-128
Identity = 231/621 (37.20%), Postives = 346/621 (55.72%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEK-FYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIF--CWSCDWEEFLTNYYKVVHEG---------FKIEGA-----NHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRG----IMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIF+I G Y  VR  LR +GWVEK F+F   L             V++   A    ++                             E+ D I+ +MSR++KN  P L WT+++  +DY +L  DQ++NH+ K   FTTK GL  ++  L W+    PD FFPRCY++ T  E+  F++D+  T    +LK V+           + PRDQ   E+ G S  +    ++N +  L  +      PG       + +++A   C+  L   +HEDID +          +WE+    YY +V            FKI+             ++C+ +   +  +  Q D++G RN+WI+KP AKSRGRG    I+C  ++ ++L++ + +  ++ + ++++QKYIE PLLIC+TKFDIRQWFLVTDWNPLTIW+YK+ YLRF +Q+F+LD L+ A+HL NN++Q    N   RS +LPA NMW   +F+E+++ +G    W  +I P MK+++  A+   QD +E RKNSFELYGADF++   D +PWLIEINSSP M PST +T++L + V ED  KV +DR     CD G FELL++Q  +  PP+ G DL +AG+S+++
Sbjct:   20 KIFSIYGHYPVVRAALRRKGWVEKKFHF---LPKVIPDVEDEGARVNDDTCAKVKENQEMAL-------------------------EKTDNIHDVMSRLVKNEMPYLLWTIKRDIIDYHSLTYDQMLNHYAKTASFTTKIGLCVNMRSLPWYVPANPDSFFPRCYSLCTESEQQEFLEDFRRTMASSILKWVVSHQSCSRSSRSK-PRDQR--EEAGSSDLSSRQDAENAEAKLRGL------PG-------QLVDIACKVCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVQVPLGSSIVLCIFKIQKVMMSFEPPTARDRQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRGESPDIVCMDRVEEILELAAADHPLSRDNKWVVQKYIETPLLICDTKFDIRQWFLVTDWNPLTIWFYKESYLRFSTQRFSLDKLDSAIHLCNNAVQKYLKNDVGRSPLLPAHNMWTSTRFQEYLQRQGRGAVWGSVIYPSMKKAIAHAMKVAQDHVEPRKNSFELYGADFVLGR-DFRPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIKVAVDR----SCDIGNFELLWRQPVVEPPPFSGSDLCVAGVSVRR 591          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Match: ttll-9 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:Q564U4])

HSP 1 Score: 111.694 bits (278), Expect = 9.787e-26
Identity = 90/355 (25.35%), Postives = 161/355 (45.35%), Query Frame = 3
Query: 1140 HKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKV--VHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEA-VHLSNNSIQHKYHNGPRSNILPAENM-WDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRE--NKQCDTGQFELLFK--------QVQITVPPYIGIDLKL 2159
            HKF E  +  C F    R   ++ R DF+          + NY K     E   I+  +    +     +  E      +F    +  +WI+KP A ++G+GI  + KL  V +        +E   +++Q Y+  P L+   KFD+R + LVT + PL  W +++ + RF   +++ D +++A VHL+N ++         ++  P   + W   +   + K+   Q+  S   +  +   +I++L  VQ+ I    + FELYG D +  E +LKPWL+E+N+SP +  S+     L   +L  +  V+   ++    + + G F+LL K        +V     P+ G    L
Sbjct:   73 HKFSEKQMI-CHF----RNDFELTRKDFL----------IKNYKKARKAKEKSGIDVVSEFNFLPSSYVLPTEYHLFVEEFRKYPNDTIWIMKPVAGAQGKGIFLFRKLKHVQEWKKKDSSGSEALPYVVQCYVHNPYLVGGKKFDVRIYVLVTSFRPLNAWVHREGFARFSHSRYSTDSVDDAFVHLTNVAVAK-----TAADYDPERGLKWSLPKLFRFFKSVHGQSKLSK-TMNDLTNVIIESLKSVQNLIIQDNHCFELYGYDILFDE-NLKPWLLEVNASPSLTASSQEDFELKYRILNHMIDVLDIEKKLIGNENEVGGFDLLIKNSKPVELCKVDFHTQPFFGTQFNL 405          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 106.686 bits (265), Expect = 2.659e-23
Identity = 86/317 (27.13%), Postives = 155/317 (48.90%), Query Frame = 3
Query: 1173 EFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF----TLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENM---WDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEW--RKN------SFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKV----VLDRR 2066
            E   K R +E+I+R+  IF  S D   F+  +Y    E  K+E A     ++  +EIA    ++   F  E     +I+KP    +G+GI     + D         I  E   ++ +Y++ P L+ N KFD+R +  VT + PL  + Y +   R  S+ +    +  D NE VHL+N SI     +  R+  + +E++   W       +++ EG     + +++  +++ ++ +LL +Q+ +    R N      +FEL+G D +V +  LKPWL+E+N SP +A    + S L + ++ D+  +    +LDR+
Sbjct:  132 ELTKKDRLYENIERSKSIFGESFD---FIPEFYVTPRENRKMENA----FVRVAKEIAAAGGELC--FPGE-----FIVKPTNSRQGKGIFFANSMAD---------IPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKD---AKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQA-LKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRK 421          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 106.686 bits (265), Expect = 3.171e-23
Identity = 86/317 (27.13%), Postives = 155/317 (48.90%), Query Frame = 3
Query: 1173 EFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF----TLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENM---WDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEW--RKN------SFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKV----VLDRR 2066
            E   K R +E+I+R+  IF  S D   F+  +Y    E  K+E A     ++  +EIA    ++   F  E     +I+KP    +G+GI     + D         I  E   ++ +Y++ P L+ N KFD+R +  VT + PL  + Y +   R  S+ +    +  D NE VHL+N SI     +  R+  + +E++   W       +++ EG     + +++  +++ ++ +LL +Q+ +    R N      +FEL+G D +V +  LKPWL+E+N SP +A    + S L + ++ D+  +    +LDR+
Sbjct:  185 ELTKKDRLYENIERSKSIFGESFD---FIPEFYVTPRENRKMENA----FVRVAKEIAAAGGELC--FPGE-----FIVKPTNSRQGKGIFFANSMAD---------IPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKD---AKLLMLRIEDLIVKSLLSIQNSVATASRTNLRFACTNFELFGFDVLVDQA-LKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACVPLLDRK 474          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 84.7297 bits (208), Expect = 1.505e-16
Identity = 64/244 (26.23%), Postives = 112/244 (45.90%), Query Frame = 3
Query: 1341 IACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDD---LNEAVHLSNNSIQH-KYHNGPRSNILPAENMWD-WKQFEEW-IKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            +  + +++    + + SR+V I+KP A +RG GI    K  D                + Q YIERPL I   KFD+R +  V  + PL ++ Y    +RF S  ++       N+ +HL+N SI      +G  +  +P   +   W+ F+E  +  E  Q    ++I+     +       +   +E     +EL+G D ++ E D KPWL+E+N SP +   T +   + + + +DV  + 
Sbjct:  232 LPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKD---------FPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINKLAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDE-DYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLA 464          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Match: ttll-4 (Tubulin polyglutamylase ttll-4 [Source:UniProtKB/Swiss-Prot;Acc:Q09647])

HSP 1 Score: 84.3445 bits (207), Expect = 2.023e-16
Identity = 64/244 (26.23%), Postives = 112/244 (45.90%), Query Frame = 3
Query: 1341 IACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDD---LNEAVHLSNNSIQH-KYHNGPRSNILPAENMWD-WKQFEEW-IKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            +  + +++    + + SR+V I+KP A +RG GI    K  D                + Q YIERPL I   KFD+R +  V  + PL ++ Y    +RF S  ++       N+ +HL+N SI      +G  +  +P   +   W+ F+E  +  E  Q    ++I+     +       +   +E     +EL+G D ++ E D KPWL+E+N SP +   T +   + + + +DV  + 
Sbjct:  194 LPTDRQELLKYLETDASRHV-IVKPPASARGTGISVTRKPKD---------FPTTATLVAQHYIERPLTINRAKFDLRLYAYVPTFEPLRVYIYDQGLVRFASVPYSHSVSTISNKYMHLTNYSINKLAEADGVANKPVPKWTLHHLWEHFDEMGVDREKIQREIEEVIIKAFISTEKPIREHMSRFLEQEFICYELFGIDIILDE-DYKPWLLEVNISPSLHSGTPLDVSVKAPLAKDVLNLA 426          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Match: TTLL3A (gene:FBgn0031854 transcript:FBtr0079305)

HSP 1 Score: 350.517 bits (898), Expect = 7.644e-104
Identity = 187/508 (36.81%), Postives = 291/508 (57.28%), Query Frame = 3
Query:  669 IMSRMLKNIAPNLFWTLRKGQVDYKNLRKD--QIINHHGKAGCFTTKTGLAKSLNQLRWF-DDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIE---GANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISI 2174
            IMSR L+++  +  WT RK + DY +  K+    IN   +A  FT+K GL   L    WF ++   + +FPRCY + + EE   FI+++  TACV  L+ ++                     K G       S          KI Y      S    ++K L   I  C+       H DID  D    W  DW+ FL  + ++V+E  +I+   G      +K C  +  +++  + Q+ ++G +N+WI+KP  K RGRGI+    L  +L ++ N  I +++R+++QKYIERPL++  TKFDIRQWFL+T+  PL +W+Y++ YLRF SQ+++L + +E+VHL+N +IQ KY NG R   LP+ENMWD   F+ +++  G  N W + I PGM+++++  +L  Q+ ++ R N+FEL+GADFM+ E +  PWLIEINSSP +  +TS+T+R+    LEDV KVV+DRR + + + G FEL ++QV    P Y+G++L + G  +
Sbjct:  208 IMSRFLEHMPVDFLWTNRKEKCDYIDQAKNPGMTINKFHRAP-FTSKEGLCSQLRDFHWFFEEGTAEMYFPRCYNVWSPEELGEFIENFKLTACVAFLRAML-----------------CKYHKQGSDAVFSCSG---------KIPY------SAIDFAYKRLVEYIDSCQ-------HNDIDFEDPPKIWEHDWDAFLFQHQQLVNEDGRIQHDGGQRLEPMVKSCLSLVDKMKVHWPQYSLDGYQNMWIVKPANKCRGRGIILMDNLKKILGVV-NLSIASKSRYVVQKYIERPLILFQTKFDIRQWFLITNTQPLVVWFYRESYLRFSSQEYSLSNHHESVHLTNYAIQKKYTNGKRDKRLPSENMWDCYSFQAYLRQIGKYNMWLERIFPGMRKAIVGCMLASQENMDRRPNTFELFGADFMICE-NFYPWLIEINSSPDLGATTSVTARMCPQCLEDVVKVVIDRRTDPKAELGNFELAYRQVVPPTPAYMGLNLFVKGKQV 673          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Match: TTLL3B (gene:FBgn0031853 transcript:FBtr0300056)

HSP 1 Score: 237.654 bits (605), Expect = 1.349e-65
Identity = 158/454 (34.80%), Postives = 235/454 (51.76%), Query Frame = 3
Query:  792 FTTKTGLAKSLNQLRWF-DDKEPDEFFPRCYTIS--TVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGD-----SKTTDGSSSKNNKKILPKIHYR----ERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWN-PLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGP-RSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFK 2111
            F+TK GL     Q RW+ +D      +PR Y +    +EE+ AFI+DY  T    LL  V               R+  P E   +     S T D +  K  K +    HY       KP +   I      M            +  D+ +++  F  S   E+ +  Y ++   G  ++                ++  +   +  +GSRN+WILKPG +SRG GI+  + L D+L+  SN+      ++I+QKYIERPLLI  TKFDIRQ+ L+T  +  ++IW Y+DCYLRF SQ+FT+DDL E++HL+NNS+Q +Y N   R + LP  NMW   QF+ +++  G  +        G K++++  ++   D  E  +N+FELYG DFM+ E    P LIEINS+P ++PST IT+R+   VL+D  +VV+D  +N    TG FEL F+
Sbjct:  235 FSTKVGLVGCAEQERWYREDGVCGMSYPRFYRLGGNNLEERMAFIEDYQQTQARSLLLYV---------------REHQPAELISENGTIFSTTLDFALGKVKKMVRHAEHYSLDDARIKPPTPAEIVENQTFMV-----------QSTDVLKSNAKFKVS---EKVMAEYARLA--GLYLD----------------QIESLRPDYRWDGSRNLWILKPGYQSRGIGIVIRSSLDDILQWTSNN---QNKKYIVQKYIERPLLIYRTKFDIRQYMLLTITDTKVSIWTYRDCYLRFSSQEFTMDDLRESIHLTNNSVQKRYKNKTNRDSRLPKNNMWSLDQFKNYLRIMGAPDGSWSKTYNGFKQNLVAVVMASLDETELLQNAFELYGCDFMLDE-HYNPILIEINSTPDLSPSTEITARICPMVLKDCIRVVVDLPKNPTAATGLFELAFE 637          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Match: TTLL1A (gene:FBgn0030823 transcript:FBtr0074403)

HSP 1 Score: 122.479 bits (306), Expect = 8.756e-29
Identity = 77/240 (32.08%), Postives = 134/240 (55.83%), Query Frame = 3
Query: 1359 KIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLI----TNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDL-NEAVHLSNNSIQ--HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVL 2057
            ++F +       + WI+KP +KS+G GI    KL  + K   ++       N    +I KYI+ PLLI   KFD+R + LVT +NPL  + YK+ + RFC++++   ++ N  +HL+N SIQ  ++ +N       P +N+W    + + ++ EG     SD++   +  ++  +L  V   +   ++ FE+YG D ++ + +LKPWLIEIN+SP M  +T+    L S ++++V  VV+
Sbjct:  181 QMFVEVFHRNPASTWIVKPCSKSQGVGIYLVNKLSKLKKFAYDARTFYPQINRDTCVISKYIDNPLLIGGKKFDLRLFVLVTTFNPLKAYLYKEGFCRFCTEKYDETEIDNVFMHLTNVSIQKTNQEYNSIHGGKWPLQNLW---LYLDSLRGEGV----SDMLWSRITATIRHSLDAVAPVMANDRHCFEVYGYDIII-DNNLKPWLIEINTSPSMHSTTTNDRMLKSRLIDNVLDVVV 412          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Match: TTLL1B (gene:FBgn0052238 transcript:FBtr0073344)

HSP 1 Score: 103.219 bits (256), Expect = 1.483e-22
Identity = 76/256 (29.69%), Postives = 129/256 (50.39%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNS------LITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF--TLDDL-NEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVL------DRRENK--QCDT-GQFELLFKQ 2114
            WI+KP  KS+G GI    KL  + K    +       I  E+ ++I +YI+ PLLI   KFD+R + LV  + PL  + +K  + RFC+ ++  ++ +L N  VHL+N S+Q   H G  + +   +  W  +    +++    +   +D +   +   ++ +L  V   +   ++ FE YG D ++    LKPWL+E+N+SP +  +T     L   +++++  VVL      D R NK    D  G FELL  +
Sbjct:  211 WIMKPCGKSQGAGIFLINKLSKLKKWSREAKGPFHPQIAKES-YVISRYIDNPLLIGGKKFDLRLYVLVASFRPLKAYLFKQGFCRFCTVKYDTSVTELDNMYVHLTNVSVQK--HGGEYNTLHGGK--WSVQNLALYLEGTRGKEV-TDRLFGAISWLIVHSLRAVAPVMASDRHCFECYGYDIIIDNA-LKPWLVEVNASPSLTSTTVNDRILKYKLIDNILSVVLPPDGVPDVRWNKVPSADALGNFELLIDE 459          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Match: TTLL4B (gene:FBgn0031574 transcript:FBtr0077501)

HSP 1 Score: 103.605 bits (257), Expect = 5.787e-22
Identity = 74/254 (29.13%), Postives = 124/254 (48.82%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFT--LDDLNE-AVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWI----KAEGYQNAWS---DIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVP 2132
            WI+KP A +RG GI    K          S    +   ++QKYIERPLLI + KFD+R + ++T  NPL I+ YKD   RF S +++  L +L+E  +HL+N SI     N  ++    A     W     W     +    +  W+   ++++ G+           +  + +R N FEL+G D ++ E +L PWL+EIN SP +     +   +   +++ V    L +   K  +  Q ++L +++ +T P
Sbjct:  570 WIVKPPASARGTGIRIVNKW---------SQFPKDRPLVVQKYIERPLLINDNKFDMRLYVVLTSINPLRIYMYKDGLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQGHKWTLQSLWSCLENRGVNTKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFGFDVLLDE-NLVPWLLEINISPSLHSELPLDLHVKGPLIQAVLNTALYQVPPKLNERQQADIL-EELNLTGP 812          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 488.419 bits (1256), Expect = 1.050e-157
Identity = 256/603 (42.45%), Postives = 365/603 (60.53%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCD--WEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGP-RSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKP 2183
            K+F++ GPY  +R  LR+RGWVE+             S+P   + + +     D  + DD G++ + D                  +E + +Y +MSR++++  P  +WT R+  VD ++LRK+Q+ NH+ KAG FTTK GL   L  L+WFD  +PD FFPRCY +   +EKHAFIDD+  TAC  LL  V+E      + EG S       EK G+         +  +    K H  +R       I    ++ A+  C+  L   +H DID N        +  W+ FL NYY VVHEG  IEG ++   ++RC+ +  ++R++  Q + +G  N+WI+KPGAKSRGRGIMC  KL D+L ++  +  I  ++++++QKYIERPLL+ +TKFD+RQWFLVTDWNPLT+W+Y++CYLRF +Q ++   L+ +VHL NNSIQ  Y   P RS  LPAE MW   QF  W+ A G    W  +++PGM+++VI  LL  QD +E RK SFELYGADFM+   DL+PWL+EIN+SP MAPST +T+RL   V ED  +VVLDRR  +  DTG F+L++KQ  + VP Y+G++L + G SI++P
Sbjct:   44 KVFSVQGPYPVIRAGLRSRGWVERRLPRPSF------SQPRRHDHETETTDEGDSSDEDDSGEEVERD------------------DEAEDLYDLMSRLVRHETPYFYWTTRRDSVDCRSLRKEQMTNHYAKAGSFTTKVGLCMHLRNLQWFDAADPDTFFPRCYRLGAQDEKHAFIDDFRRTACTSLLLYVLE------KYEGDSEG-----EKMGEVHNAKSHGLRKTR----KQHITQR-------IETSVIDSALHVCQEYLNSLEHCDIDNNLETNSTISEQQWKVFLQNYYLVVHEGINIEGCDYY--VERCKCMLEQMRQVCPQMENDGICNIWIIKPGAKSRGRGIMCMNKLDDMLGLVDGDHCIMKDSKWVVQKYIERPLLVHDTKFDVRQWFLVTDWNPLTVWFYRECYLRFSTQPYSTHTLDSSVHLCNNSIQKHYQPSPDRSPSLPAECMWSCSQFRSWLAASGRAALWKTVVVPGMQKAVIQTLLTAQDSVEPRKASFELYGADFMLGR-DLRPWLLEINASPTMAPSTGVTARLCPAVQEDTLRVVLDRRSERNTDTGGFQLIYKQAAVDVPQYVGVNLLIEGTSIRRP 597          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 137.117 bits (344), Expect = 5.846e-34
Identity = 107/375 (28.53%), Postives = 177/375 (47.20%), Query Frame = 3
Query: 1131 SISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEA-VHLSNNSIQHKYHNGPRSNILPAENM-WDWKQFEEWIKAE-GYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRS 2219
            +  H ++E  +  C F    R H ++ R + +        + L  Y K +        A       R  E+  E      +F  +   N WI+KP A+S+G+GI  + KL D++    +   + E +       ++ Q+YIE P LI   KFD+R + LVT + PL  W Y+D + RF + +F+L  +++  VHL+N ++Q      P  +  P +   W  +Q   ++ A+ G++      +   +    I +LL VQ  I   K+ FELYG D ++ + DLKPWLIE+N+SP +  S+     L   +LED   +V    R   K+   G F+L++       P Y  + L+  G S     +++T L  R S
Sbjct:   70 NFDHSYMEEHVRICHF----RNHYELTRKNLMV-------KNLKRYRKTLEREVGRLEAAKCDFFPRTFELPSEYHIFVEEFK-KSPGNTWIMKPVARSQGKGIFLFRKLKDIIDWRKDGSRSEEQKDEAQVESYVAQRYIENPYLIAGRKFDLRVYVLVTSYIPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQ---KTAPDYD--PEKGCKWQMQQLRWYLTAKHGFETV--QTLFKEIDNVFIRSLLSVQKTIINDKHCFELYGYDILLDQ-DLKPWLIEVNASPSLTASSQEDYDLKYRLLEDTLHIVDMEGRLTGKEKRIGGFDLMWND----GPVYTDVGLEALGSSC---LVANTHLVVRAS 417          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 137.117 bits (344), Expect = 6.895e-34
Identity = 103/359 (28.69%), Postives = 170/359 (47.35%), Query Frame = 3
Query: 1131 SISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEA-VHLSNNSIQHKYHNGPRSNILPAENM-WDWKQFEEWIKAE-GYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGIS 2171
            +  H ++E  +  C F    R H ++ R + +        + L  Y K +        A       R  E+  E      +F  +   N WI+KP A+S+G+GI  + KL D++    +   + E +       ++ Q+YIE P LI   KFD+R + LVT + PL  W Y+D + RF + +F+L  +++  VHL+N ++Q      P  +  P +   W  +Q   ++ A+ G++      +   +    I +LL VQ  I   K+ FELYG D ++ + DLKPWLIE+N+SP +  S+     L   +LED   +V    R   K+   G F+L++       P Y  + L+  G S
Sbjct:   70 NFDHSYMEEHVRICHF----RNHYELTRKNLMV-------KNLKRYRKTLEREVGRLEAAKCDFFPRTFELPSEYHIFVEEFK-KSPGNTWIMKPVARSQGKGIFLFRKLKDIIDWRKDGSRSEEQKDEAQVESYVAQRYIENPYLIAGRKFDLRVYVLVTSYIPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQ---KTAPDYD--PEKGCKWQMQQLRWYLTAKHGFETV--QTLFKEIDNVFIRSLLSVQKTIINDKHCFELYGYDILLDQ-DLKPWLIEVNASPSLTASSQEDYDLKYRLLEDTLHIVDMEGRLTGKEKRIGGFDLMWND----GPVYTDVGLEALGSS 404          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Match: ttll5 (tubulin tyrosine ligase-like family, member 5 [Source:ZFIN;Acc:ZDB-GENE-100922-236])

HSP 1 Score: 114.005 bits (284), Expect = 4.824e-25
Identity = 74/276 (26.81%), Postives = 142/276 (51.45%), Query Frame = 3
Query: 1269 YKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF---TLDDLNEAVHLSNNSIQHK---YHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQ-----DC---IEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            YK +    +  G ++ + + +   +  E ++  + F  +  +  WI+KP A SRGRGI   + +         S I  +   ++ +YI  PLLI + KFD+R + LVT ++PL I+ Y++   RF + ++   T +  N+ +HL+N S+  K   Y +     +    N W       +++ EG     + +++  +++ +I A+L  +      C   +  R N FELYG D ++ + +LKPWL+E+N SP +A    +  ++ ++++ D+F +V
Sbjct:  130 YKNIQRMQQSHGFHNFSIVPQTFVLPAEYQEFSNSFSKD--KGPWIIKPVASSRGRGIYLVSNI---------SQIPLDENILVSRYISNPLLIDDFKFDVRLYVLVTSYDPLVIYLYEEGLARFATVKYDHATANIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKD---TTLLMGQIEDLIIKAVLSAEIHIATSCKMFVPHRCNCFELYGFDVLI-DSNLKPWLLEVNLSPSLACDAPLDLKVKASMISDMFSLV 390          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Match: ttll1 (tubulin tyrosine ligase-like family, member 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1326])

HSP 1 Score: 103.605 bits (257), Expect = 7.657e-23
Identity = 74/263 (28.14%), Postives = 129/263 (49.05%), Query Frame = 3
Query: 1395 NVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLIT-------NETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFT-----LDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQC---------DTGQFELLFKQVQ 2120
            + WI+KP  K++G+GI    KL  + K   +S  +        +  ++I  YI+ PLLI   KFD+R + LVT + PL  + YK  + RFC+ ++T     LD  N  VHL+N +IQ   H    +++   +  W       ++++    +  ++ +   +   ++ +L  V   +   K+ FE YG D ++ +  LKPWLIE+N+SP +  ST+    L  N++ D   +V    E   C           G +++L+ + Q
Sbjct:  133 STWIMKPCGKAQGKGIFLINKLSQIKKWSRDSRTSTFVAANSGKEAYVISLYIDNPLLIGGKKFDLRLYVLVTTYRPLKCYMYKLGFCRFCTVKYTPSTSELD--NMFVHLTNVAIQK--HGDDYNHVHGGK--WTVSNLRLYLESTRGPDV-TNHLFDQIHWIIVQSLKAVAPVMNNDKHCFECYGYDIIIDD-RLKPWLIEVNASPSLTSSTANDRILKYNLINDTLNIVTPNAEIPDCRWNRSLPKEALGHYQVLYDEEQ 387          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Match: ENSXETT00000053815.1 (uncharacterized LOC100158544 [Source:NCBI gene;Acc:100158544])

HSP 1 Score: 489.189 bits (1258), Expect = 7.974e-157
Identity = 270/629 (42.93%), Postives = 381/629 (60.57%), Query Frame = 3
Query:  321 TNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKIL----PKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCD--WEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKP 2183
            T ++ +R+K AK  V++A+K  KIFAI GPY  +R  LR+RGWVEK            K   + K   +K  AS++  E DD     + DDD +   +  N        + DG   +MSR+L+N  PN FWT ++  VD + L+KDQ++NH+ KAG FTTK GL  +L  L WFDD +PD FFPRCY +   +EK +F +D+  TA   +LK V               RD       G +K +      NN   L    P      RK     S+  + +  A+  CE  L   +H DID          D  WEEFL  YY+V+H+G  IE + +   + +C E+  +L  +  Q D+EG RN+WI+KPGAKSRGRGI+C  +L ++LK++  + +I  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLTIW+YK+CY+RF SQ F+L++L+ ++HL NNSIQ  Y N   R  ++P +NMW  +Q +  +   G  +AW  +I+PGMK ++I A+   QD +E+RK+SFELYGADFM  E +  PWLIEIN+SP MA ST++TSRL + V ED  ++VLDR+ ++ CD G FEL++KQ  + +P Y+GI+L + G  +KKP
Sbjct:   71 TAVNPDRLKHAKALVEKAIKQKKIFAIHGPYPVIRSCLRSRGWVEK------------KFPKSGKAKQKKEKASDEDMEDDDGDGSSNDDDDGENSDEEENG-------DPDGTCDLMSRLLRNEDPNFFWTTKRDAVDCRFLKKDQMLNHYAKAGSFTTKVGLCLNLRNLHWFDDADPDSFFPRCYRLGAEDEKQSFKEDFWHTAARSILKRVANR------------RDICSPAATGGAKASHREPGANNGAQLLDSSPVAKRGSRKRAE--SVPVQIILTALEACERYLNSLEHNDIDMETEATPAMTDTQWEEFLHGYYQVIHDGATIEHSEYY--VDQCSEVLHKLEAVNPQLDIEGGRNIWIVKPGAKSRGRGIICMDRLEEILKLVDCDPMIVKDGKWVVQKYIERPLLIFGTKFDVRQWFLVTDWNPLTIWFYKECYVRFSSQPFSLENLDTSIHLCNNSIQKHYENSQSRHPLVPTDNMWSSRQLQVHLHKLGAPHAWEAVIVPGMKAAIIHAMQSAQDIVEYRKSSFELYGADFMFGE-NFHPWLIEINASPTMAASTTVTSRLCAEVQEDTLRIVLDRKLDRNCDIGAFELIYKQCAVDIPQYLGINLLVEGSMVKKP 663          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Match: ENSXETT00000053821.1 (uncharacterized LOC100158544 [Source:NCBI gene;Acc:100158544])

HSP 1 Score: 489.574 bits (1259), Expect = 2.007e-156
Identity = 270/629 (42.93%), Postives = 381/629 (60.57%), Query Frame = 3
Query:  321 TNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKIL----PKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCD--WEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKP 2183
            T ++ +R+K AK  V++A+K  KIFAI GPY  +R  LR+RGWVEK            K   + K   +K  AS++  E DD     + DDD +   +  N        + DG   +MSR+L+N  PN FWT ++  VD + L+KDQ++NH+ KAG FTTK GL  +L  L WFDD +PD FFPRCY +   +EK +F +D+  TA   +LK V               RD       G +K +      NN   L    P      RK     S+  + +  A+  CE  L   +H DID          D  WEEFL  YY+V+H+G  IE + +   + +C E+  +L  +  Q D+EG RN+WI+KPGAKSRGRGI+C  +L ++LK++  + +I  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLTIW+YK+CY+RF SQ F+L++L+ ++HL NNSIQ  Y N   R  ++P +NMW  +Q +  +   G  +AW  +I+PGMK ++I A+   QD +E+RK+SFELYGADFM  E +  PWLIEIN+SP MA ST++TSRL + V ED  ++VLDR+ ++ CD G FEL++KQ  + +P Y+GI+L + G  +KKP
Sbjct:   71 TAVNPDRLKHAKALVEKAIKQKKIFAIHGPYPVIRSCLRSRGWVEK------------KFPKSGKAKQKKEKASDEDMEDDDGDGSSNDDDDGENSDEEENG-------DPDGTCDLMSRLLRNEDPNFFWTTKRDAVDCRFLKKDQMLNHYAKAGSFTTKVGLCLNLRNLHWFDDADPDSFFPRCYRLGAEDEKQSFKEDFWHTAARSILKRVANR------------RDICSPAATGGAKASHREPGANNGAQLLDSSPVAKRGSRKRAE--SVPVQIILTALEACERYLNSLEHNDIDMETEATPAMTDTQWEEFLHGYYQVIHDGATIEHSEYY--VDQCSEVLHKLEAVNPQLDIEGGRNIWIVKPGAKSRGRGIICMDRLEEILKLVDCDPMIVKDGKWVVQKYIERPLLIFGTKFDVRQWFLVTDWNPLTIWFYKECYVRFSSQPFSLENLDTSIHLCNNSIQKHYENSQSRHPLVPTDNMWSSRQLQVHLHKLGAPHAWEAVIVPGMKAAIIHAMQSAQDIVEYRKSSFELYGADFMFGE-NFHPWLIEINASPTMAASTTVTSRLCAEVQEDTLRIVLDRKLDRNCDIGAFELIYKQCAVDIPQYLGINLLVEGSMVKKP 663          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Match: ENSXETT00000002709.1 (tubulin tyrosine ligase like 3 [Source:NCBI gene;Acc:100497708])

HSP 1 Score: 416.001 bits (1068), Expect = 2.938e-130
Identity = 236/623 (37.88%), Postives = 345/623 (55.38%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSC---------DWEEFLTNYYKVVHEGFKI-EGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYH-NGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRS 2219
            KIF I G Y  +R  LR+RGWVEK +         HKS+                                              +++ +GI  + SR+L+N  PN  W      +D + L+ DQII +H     FTTK GL  +L  L WF D + + FFPRCY +   EEK AFI+D+  TA   +LK V          EG++  ++  ++K    + T     K  KK  P I           S+  + ++ A+  C+  L   +H+DID       W           +W+EFL  YY+ +H+   I E  N+V+   +C+++  +L+ +  Q D++G RN+WI+KPGA SRGRGI C   L + LK +  + L  N+ + ++QKYIERPLLI  TKFD+RQWF+VT+WNPLTIW+YK+CYLRF SQ F+L +L+ ++HL NN++Q  Y  +  R   LP ENMW   QF+++++  G  NAW +II PGMK ++I  + C QD  E RKNSF++YGADFM  E + +PWLIEIN++P M+ STS+TSRL   V ED+ +++LDR+++     G FEL++KQ  I +P      L + G  IKKP  +S ++T+ ++
Sbjct:   72 KIFTIQGYYPYIRSGLRSRGWVEKNF---------HKSQHDY-------------------------------------------FDDPEGICDLTSRLLRNQDPNFVWVPTYNSLDSRLLKNDQIIINHYSKSVFTTKVGLCLNLRNLHWFADADLNSFFPRCYRLGVKEEKEAFIEDFRLTAACSILKLVSR--------EGKNMPNRRDVKK----EITAALLLKYYKKAKPLI----------TSVPVQIIKTALKACKQYLNTSEHKDID-------WKLGSTNAITEDEWKEFLHGYYQAIHKNIIINEAENYVS---QCQDMLQKLKAVKPQLDIDGERNIWIVKPGASSRGRGITCIDYLEEALKYVDCDPLFINDDKLVVQKYIERPLLIYGTKFDVRQWFMVTNWNPLTIWYYKECYLRFSSQPFSLKNLHSSIHLCNNAVQKNYKISRSRHPQLPKENMWFKNQFQDYLQMTGATNAWKEIIEPGMKAAIIHTMQCSQDMEEGRKNSFQIYGADFMFGE-NFQPWLIEINANPDMSLSTSVTSRLVVRVQEDILRLILDRKQDADAYVGVFELIYKQPVIKIPLCERKQLLVKGNQIKKPLQTSPLMTDEKN 609          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Match: tlr5 (toll like receptor 5 [Source:Xenbase;Acc:XB-GENE-480679])

HSP 1 Score: 414.075 bits (1063), Expect = 9.704e-130
Identity = 235/618 (38.03%), Postives = 348/618 (56.31%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDID-RNDFIFCWSCD-WEEFLTNYYKVVHEGFKI-EGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYH-NGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSST 2225
            KIF I G Y  +R  LR+RGW+EK +         HKS+  +  VD+                                          +G+  + SR+L++  PN  W      +D + L+ D II +H     FTTK GL  +L  L WF D + + FFPRCY +   EE  AFI+D+  TA   +LK V          EG++  ++  ++K    + T       NKK  P +           S+  + ++ A+  C+  L   +HEDID +       + D W+EFL  YY+ +H+   I E  N+V+   RC+++  +L+ +  Q D++G RN+WI+KPGA SRGRGI C   L + L  +  +SL  N+ + ++QKYIE+PLLI  TKFDIRQWF+VT+WNPLTIW+Y++CYLRF SQ F+L +L+ ++HL NN++Q  Y  +  R   LP ENMW   QF+++++  G  NAW +II PGMK ++I  + C QD  E RKNSF++YGADFM  E D +PWLIEIN++P M+ STS+TSRL + V ED+ +++LDR+++     G FEL+++Q  I +P Y    L + G  IKKP  +S ++T+ ++ T
Sbjct:   72 KIFTIQGYYPYIRSGLRSRGWLEKNF---------HKSQ--HDYVDDP-----------------------------------------EGLCDLTSRLLRHQDPNFVWVPTYNSLDSRLLKNDDIIVNHYSKSMFTTKVGLCLNLRNLHWFADADLNSFFPRCYRLGAKEENQAFIEDFRLTAACSILKLVSR--------EGKNMPNRRGVKK----EITAVLQLNYNKKAKPLVA----------SVPVQVIKTALKACKQYLNTSEHEDIDWKPGSTHAITEDEWKEFLDGYYQAIHKNIIINEAENYVS---RCQDMLQKLKAVKPQLDIDGERNIWIVKPGASSRGRGITCVDCLEEALTFVDCDSLSINDDKLVVQKYIEKPLLIYGTKFDIRQWFVVTNWNPLTIWYYEECYLRFSSQPFSLKNLHSSIHLCNNAVQKNYEISRSRHPQLPKENMWFKNQFQDYLQMTGATNAWKEIIEPGMKAAIIHTMRCSQDVEEGRKNSFQIYGADFMFDE-DFQPWLIEINANPDMSLSTSVTSRLVNRVQEDILRLILDRKQDADAYVGAFELIYRQPVIKIPLYERKQLLVKGSEIKKPLQTSPLMTDEKNQT 611          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Match: ap1b1 (adaptor related protein complex 1 subunit beta 1 [Source:Xenbase;Acc:XB-GENE-984900])

HSP 1 Score: 407.527 bits (1046), Expect = 9.483e-128
Identity = 237/610 (38.85%), Postives = 335/610 (54.92%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSC---------DWEEFLTNYYKVVHEGFKI-EGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYH-NGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIF I G Y  +R  LR RGWVEK +         HKS+                                              +++ +GI  + SR+L+N  PN  W      +D + L+ DQII +H     FTTK GL  +L  L WF D + + FFPRCY +   EEK AFI+D+  TA   +LK V          EG++  ++  ++K    ++T     K NKK  P I            +    ++ A+  C+  L   +HEDID       W           +W+EFL  YY+V+H+   I E  N+V+   +C++I  +L+ +  Q D++G RN+WI+KPGA SRGRGI C   L + LK +  +    N  + ++QKYIERPLLI  TKFD+RQWF+VT+WNPLTIW+YK+CYLRF SQ F+L +L+ ++HL NN+IQ  Y  +  R   LP ENMW   QF+++++  G  NAW +II PGMK ++I  + C QD  E RKNSF++YGADFM  E + +PWLIEIN++P M+ STS+TSRL + V ED+  ++LDR+++   D G FEL++KQ  I +P      L + G  IKK
Sbjct:   26 KIFTIQGYYPYIRSGLRIRGWVEKNF---------HKSQHDY-------------------------------------------FDDPEGICDLTSRLLRNQDPNFVWVPTYNCLDSRLLKNDQIIMNHYSKSVFTTKVGLCLNLRNLHWFADADLNSFFPRCYRLGVKEEKQAFIEDFRLTAACSILKLVSR--------EGKNMPNRRDVKK----ESTPALLLKYNKKAQPLI------TSVNTGVPVHIIKTALKACKQYLNTLEHEDID-------WKLGSTNAITEDEWKEFLDGYYQVIHKNRIINEAENYVS---QCQDILQKLKAVKPQLDIDGERNIWIVKPGASSRGRGITCIDYLEEALKFVDCDPPFINHDKLVVQKYIERPLLIYGTKFDVRQWFVVTNWNPLTIWYYKECYLRFSSQPFSLKNLHSSIHLCNNAIQKNYSISQSRHPQLPKENMWFKNQFQDYLQMTGATNAWKEIIEPGMKAAIIHTMQCSQDMEEGRKNSFQIYGADFMFGE-NFQPWLIEINANPDMSLSTSVTSRLVARVQEDLLCLILDRKQHADADVGVFELIYKQPVIKIPLCYTKQLLVKGNEIKK 554          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Match: Ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:MGI Symbol;Acc:MGI:2141418])

HSP 1 Score: 491.115 bits (1263), Expect = 2.376e-159
Identity = 259/616 (42.05%), Postives = 378/616 (61.36%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDR--NDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQ-HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSS 2222
            KIF I G Y  +R +LR RGWVEK   +            T     +K++ S+   + D   D+ + +++        +  G   +++ DGI+ +MSRM++N  P L WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + D FFPRCY +   ++K AFI+D+  TA   +LK V++       I  Q+  +++P          D    K  KK++              ++S  F++ A++ C+  L    H+DID+  N  ++    DW +FL  YY++VHEG ++        ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC  +L ++LK++  N ++  + ++I+QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ H   +  R  +LP +NMW  ++F+  ++      AWS +I+PGMK +VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DRR ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP       T  RSS
Sbjct:   15 KIFMIHGRYPVIRCLLRQRGWVEKKMVH---------PPGTALPAPQKDLDSSMLGDSDATEDEDEEENEMFRESQLLDLDGFLEFDDLDGIHALMSRMVRNETPYLIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEADADSFFPRCYRLGAEDDKKAFIEDFWLTAARNVLKLVVKLEEKSQSISIQAREEEAP---------EDTQPKKQEKKLV--------------TVSSDFVDEALSACQEHLSSIAHKDIDKDPNSPLYLSPDDWSQFLQRYYQIVHEGAELRYLE--VQVQRCEDILQQLQNVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMNRLDEMLKLVDCNPMLMKDGKWIVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQRHLEASCHRHPMLPPDNMWSSQRFQAHLQEVDAPKAWSSVIVPGMKAAVIHALQTSQDNVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRRLDRSCDTGAFELIYKQPAVEVPQYVGIRLLVEGSTIKKPVPVGHRRTGVRSS 595          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Match: Ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:MGI Symbol;Acc:MGI:2141418])

HSP 1 Score: 492.271 bits (1266), Expect = 2.931e-157
Identity = 259/616 (42.05%), Postives = 378/616 (61.36%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDR--NDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQ-HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSS 2222
            KIF I G Y  +R +LR RGWVEK   +            T     +K++ S+   + D   D+ + +++        +  G   +++ DGI+ +MSRM++N  P L WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + D FFPRCY +   ++K AFI+D+  TA   +LK V++       I  Q+  +++P          D    K  KK++              ++S  F++ A++ C+  L    H+DID+  N  ++    DW +FL  YY++VHEG ++        ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC  +L ++LK++  N ++  + ++I+QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ H   +  R  +LP +NMW  ++F+  ++      AWS +I+PGMK +VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DRR ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP       T  RSS
Sbjct:  167 KIFMIHGRYPVIRCLLRQRGWVEKKMVH---------PPGTALPAPQKDLDSSMLGDSDATEDEDEEENEMFRESQLLDLDGFLEFDDLDGIHALMSRMVRNETPYLIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEADADSFFPRCYRLGAEDDKKAFIEDFWLTAARNVLKLVVKLEEKSQSISIQAREEEAP---------EDTQPKKQEKKLV--------------TVSSDFVDEALSACQEHLSSIAHKDIDKDPNSPLYLSPDDWSQFLQRYYQIVHEGAELRYLE--VQVQRCEDILQQLQNVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMNRLDEMLKLVDCNPMLMKDGKWIVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQRHLEASCHRHPMLPPDNMWSSQRFQAHLQEVDAPKAWSSVIVPGMKAAVIHALQTSQDNVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRRLDRSCDTGAFELIYKQPAVEVPQYVGIRLLVEGSTIKKPVPVGHRRTGVRSS 747          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Match: Ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:MGI Symbol;Acc:MGI:2141418])

HSP 1 Score: 487.649 bits (1254), Expect = 1.724e-155
Identity = 259/617 (41.98%), Postives = 378/617 (61.26%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFI-DDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDR--NDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQ-HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSS 2222
            KIF I G Y  +R +LR RGWVEK   +            T     +K++ S+   + D   D+ + +++        +  G   +++ DGI+ +MSRM++N  P L WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + D FFPRCY +   ++K AFI +D+  TA   +LK V++       I  Q+  +++P          D    K  KK++              ++S  F++ A++ C+  L    H+DID+  N  ++    DW +FL  YY++VHEG ++        ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC  +L ++LK++  N ++  + ++I+QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ H   +  R  +LP +NMW  ++F+  ++      AWS +I+PGMK +VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DRR ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP       T  RSS
Sbjct:  167 KIFMIHGRYPVIRCLLRQRGWVEKKMVH---------PPGTALPAPQKDLDSSMLGDSDATEDEDEEENEMFRESQLLDLDGFLEFDDLDGIHALMSRMVRNETPYLIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEADADSFFPRCYRLGAEDDKKAFIAEDFWLTAARNVLKLVVKLEEKSQSISIQAREEEAP---------EDTQPKKQEKKLV--------------TVSSDFVDEALSACQEHLSSIAHKDIDKDPNSPLYLSPDDWSQFLQRYYQIVHEGAELRYLE--VQVQRCEDILQQLQNVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMNRLDEMLKLVDCNPMLMKDGKWIVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQRHLEASCHRHPMLPPDNMWSSQRFQAHLQEVDAPKAWSSVIVPGMKAAVIHALQTSQDNVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRRLDRSCDTGAFELIYKQPAVEVPQYVGIRLLVEGSTIKKPVPVGHRRTGVRSS 748          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Match: Ttll8 (tubulin tyrosine ligase-like family, member 8 [Source:MGI Symbol;Acc:MGI:1922902])

HSP 1 Score: 437.958 bits (1125), Expect = 1.039e-137
Identity = 242/621 (38.97%), Postives = 359/621 (57.81%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEK---FYFNGDLNT-STHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFI--FCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK-----PFLSSTILTE 2210
            KIF+I G Y  +R  LR +GWVEK   F+     N  S  KS  T +N   + IA                                   E  D I+ +MSR++KN  P L WT+++  VDY +L  DQ++NH+GK   FTTK GL  ++  L W+    P+ FFPRCY + T  EK  F+DD+  T    +LK V+      ++++G+S ++++        K +D S  K+ +    K+           S+S + ++ A   C+  L   +HEDID ++         +W +    YY +VH    I  +   +   +C+ +  ++  +  Q +++G RN+WI+KP AKSRGR I+C  ++ ++L +++ +S  T + ++++QKYIE P+LI +TKFDIRQWFLVTDWNPLTIW+YK+ YLRF +Q+F+LD L+ A+HL NNSIQ +  N   RS +LP  NMW   +F+E+++  G    W  II P MK +V +A+   QD +E RKNSFELYGADF++   D KPWLIEINSSP M PST +T++L + V ED  KVV+DR+ ++ CD G FELL++Q  + +PP+ G DL + GIS+KK     P ++S  L+E
Sbjct:  107 KIFSIYGHYPVIRATLRRKGWVEKKFNFFPKALQNLGSEDKSAETKEN---QEIA----------------------------------LERFDDIHDVMSRLVKNEIPYLLWTIKRDVVDYHSLTCDQMLNHYGKTASFTTKIGLCLNMRSLPWYVQANPNTFFPRCYGLCTESEKQEFLDDFRRTVAASILKWVVLHQNYCSKVKGKSKKEEA--------KNSDPSPKKDPENPDLKLP----------SLSGQVVDTACKVCQAYLGQLEHEDIDVSEASTEALSEEEWNDLTQQYYLLVHGNASITDSK--SYFAQCQALLSKISSVNPQTEIDGIRNIWIIKPAAKSRGRDIVCMDRVENILSLVAADSQTTKDNKWVVQKYIETPMLIYDTKFDIRQWFLVTDWNPLTIWFYKESYLRFSTQRFSLDKLDSAIHLCNNSIQRRLKNDKERSPLLPCHNMWTSTRFQEYLQKRGRGGTWGSIIYPSMKRAVTNAMRVAQDHVEARKNSFELYGADFILGR-DFKPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIKVVVDRKLDRNCDIGNFELLWRQPAVELPPFNGSDLCVEGISVKKAKKQMPPIASVGLSE 669          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Match: Ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:MGI Symbol;Acc:MGI:1913589])

HSP 1 Score: 124.405 bits (311), Expect = 2.072e-29
Identity = 86/295 (29.15%), Postives = 144/295 (48.81%), Query Frame = 3
Query: 1338 EIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVL-------------------KILSNSLITNETR-------------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEA-VHLSNNSIQH---KYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            E+ CE      +F  +     WI+KP A+S+G+GI  + +L D++                   +   N   +++TR             ++ Q+Y+E P LI   KFD+R + LV  + PL  W Y+D + RF + +FTL+ +++  VHL+N ++Q     YH       L     W  ++F +++ ++    A  + +   M    I +L  VQ  I   K+ FELYG D ++ + DLKPWL+E+N+SP +  S+     L + +LED   VV    R   K+   G F+L++
Sbjct:  126 EMPCEYHLFVEEF-RKNPGITWIMKPVARSQGKGIFLFRRLKDIMDWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQKTSPDYH-------LKKGCKWMLQRFRQYLASKHGPKA-VETLFSDMDNIFIKSLQSVQKVIISDKHCFELYGYDILIDQ-DLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVVDMEARLTGKEKRVGGFDLMW 410          
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Match: sp|Q1ECV4|TTLL3_DANRE (Tubulin monoglycylase TTLL3 OS=Danio rerio OX=7955 GN=ttll3 PE=2 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 1.346e-156
Identity = 256/603 (42.45%), Postives = 362/603 (60.03%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCD--WEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGP-RSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKP 2183
            K+F++ GPY  +R  LR RGWVE+             S+P   + + +     D  + DD G++ + D                  +E + +Y +MSR++++  P  +WT R+  VD ++LRK+Q+ NH+ KAG FTTK GL   L  L+WFD  +PD FFPRCY +   +EKHAFIDD+  TAC  LL  V+E      + EG S       EK G+         +           + RK  S   I    ++ A+  C+  L   +H DID N        +  W+ FL NYY VVHEG  IEG  +   ++RC+ +  ++R++  Q + +G  N+WI+KPGAKSRGRGIMC  KL D+L ++  +  I  ++++++QKYIERPLL+ +TKFD+RQWFLVTDWNPLT+W+Y++CYLRF +Q ++   L+ +VHL NNSIQ  Y   P RS  LPAE MW   QF  W+ A G    W  +++PGM+++VI  LL  QD +E RK SFELYGADFM+   DL+PWL+EIN+SP MAPST +T+RL   V ED  +VVLDRR  +  DTG F+L++KQ  + VP Y+G++L + G SI++P
Sbjct:   44 KVFSVQGPYPVIRAGLRARGWVERRLPRPSF------SQPRRHDHETETTDEGDSSDEDDLGEEVERD------------------DEAEDLYDLMSRLVRHETPYFYWTTRRDSVDCRSLRKEQMTNHYAKAGSFTTKVGLCMHLRNLQWFDAADPDTFFPRCYRLGAQDEKHAFIDDFRRTACTSLLLYVLE------KYEGDSEG-----EKMGEVHNAKSHGLR-----------KTRKQHSSQRIETSVIDSALHVCQEYLNSLEHCDIDNNLETNSTISEQQWKVFLQNYYLVVHEGINIEGCEYY--LERCKCMLEQMRQVCPQMENDGICNIWIIKPGAKSRGRGIMCMNKLDDMLGLVDGDHCIMKDSKWVVQKYIERPLLVHDTKFDVRQWFLVTDWNPLTVWFYRECYLRFSTQPYSTHTLDSSVHLCNNSIQKHYQPSPDRSPSLPAECMWSCSQFRSWLAASGRAALWKAVVVPGMQKAVIQTLLTAQDSVEPRKASFELYGADFMLGR-DLRPWLLEINASPTMAPSTGVTARLCPAVQEDTLRVVLDRRSERNTDTGGFQLIYKQAAVDVPQYVGVNLLIEGTSIRRP 597          
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Match: sp|A4Q9E5|TTLL3_MOUSE (Tubulin monoglycylase TTLL3 OS=Mus musculus OX=10090 GN=Ttll3 PE=1 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 2.050e-156
Identity = 259/616 (42.05%), Postives = 378/616 (61.36%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDR--NDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQ-HKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSS 2222
            KIF I G Y  +R +LR RGWVEK   +            T     +K++ S+   + D   D+ + +++        +  G   +++ DGI+ +MSRM++N  P L WT R+  +D + L KDQ+INH+ +AG FTTK GL  +L  L WFD+ + D FFPRCY +   ++K AFI+D+  TA   +LK V++       I  Q+  +++P          D    K  KK++              ++S  F++ A++ C+  L    H+DID+  N  ++    DW +FL  YY++VHEG ++        ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC  +L ++LK++  N ++  + ++I+QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ H   +  R  +LP +NMW  ++F+  ++      AWS +I+PGMK +VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DRR ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP       T  RSS
Sbjct:  167 KIFMIHGRYPVIRCLLRQRGWVEKKMVH---------PPGTALPAPQKDLDSSMLGDSDATEDEDEEENEMFRESQLLDLDGFLEFDDLDGIHALMSRMVRNETPYLIWTTRRDVLDCRFLSKDQMINHYARAGSFTTKVGLCLNLRNLPWFDEADADSFFPRCYRLGAEDDKKAFIEDFWLTAARNVLKLVVKLEEKSQSISIQAREEEAP---------EDTQPKKQEKKLV--------------TVSSDFVDEALSACQEHLSSIAHKDIDKDPNSPLYLSPDDWSQFLQRYYQIVHEGAELRYLE--VQVQRCEDILQQLQNVVPQLDMEGDRNIWIVKPGAKSRGRGIMCMNRLDEMLKLVDCNPMLMKDGKWIVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQRHLEASCHRHPMLPPDNMWSSQRFQAHLQEVDAPKAWSSVIVPGMKAAVIHALQTSQDNVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRRLDRSCDTGAFELIYKQPAVEVPQYVGIRLLVEGSTIKKPVPVGHRRTGVRSS 747          
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Match: sp|A4Q9F1|TTLL8_MOUSE (Protein monoglycylase TTLL8 OS=Mus musculus OX=10090 GN=Ttll8 PE=1 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 7.265e-137
Identity = 242/621 (38.97%), Postives = 359/621 (57.81%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEK---FYFNGDLNT-STHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFI--FCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK-----PFLSSTILTE 2210
            KIF+I G Y  +R  LR +GWVEK   F+     N  S  KS  T +N   + IA                                   E  D I+ +MSR++KN  P L WT+++  VDY +L  DQ++NH+GK   FTTK GL  ++  L W+    P+ FFPRCY + T  EK  F+DD+  T    +LK V+      ++++G+S ++++        K +D S  K+ +    K+           S+S + ++ A   C+  L   +HEDID ++         +W +    YY +VH    I  +   +   +C+ +  ++  +  Q +++G RN+WI+KP AKSRGR I+C  ++ ++L +++ +S  T + ++++QKYIE P+LI +TKFDIRQWFLVTDWNPLTIW+YK+ YLRF +Q+F+LD L+ A+HL NNSIQ +  N   RS +LP  NMW   +F+E+++  G    W  II P MK +V +A+   QD +E RKNSFELYGADF++   D KPWLIEINSSP M PST +T++L + V ED  KVV+DR+ ++ CD G FELL++Q  + +PP+ G DL + GIS+KK     P ++S  L+E
Sbjct:  107 KIFSIYGHYPVIRATLRRKGWVEKKFNFFPKALQNLGSEDKSAETKEN---QEIA----------------------------------LERFDDIHDVMSRLVKNEIPYLLWTIKRDVVDYHSLTCDQMLNHYGKTASFTTKIGLCLNMRSLPWYVQANPNTFFPRCYGLCTESEKQEFLDDFRRTVAASILKWVVLHQNYCSKVKGKSKKEEA--------KNSDPSPKKDPENPDLKLP----------SLSGQVVDTACKVCQAYLGQLEHEDIDVSEASTEALSEEEWNDLTQQYYLLVHGNASITDSK--SYFAQCQALLSKISSVNPQTEIDGIRNIWIIKPAAKSRGRDIVCMDRVENILSLVAADSQTTKDNKWVVQKYIETPMLIYDTKFDIRQWFLVTDWNPLTIWFYKESYLRFSTQRFSLDKLDSAIHLCNNSIQRRLKNDKERSPLLPCHNMWTSTRFQEYLQKRGRGGTWGSIIYPSMKRAVTNAMRVAQDHVEARKNSFELYGADFILGR-DFKPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIKVVVDRKLDRNCDIGNFELLWRQPAVELPPFNGSDLCVEGISVKKAKKQMPPIASVGLSE 669          
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Match: sp|A6PVC2|TTLL8_HUMAN (Protein monoglycylase TTLL8 OS=Homo sapiens OX=9606 GN=TTLL8 PE=2 SV=4)

HSP 1 Score: 425.631 bits (1093), Expect = 4.693e-132
Identity = 232/603 (38.47%), Postives = 347/603 (57.55%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEK-FYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIF--CWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILS-NSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIF+I G Y  VR  LR +GWVEK F+F         K  P   +V+++    ND        +                       E+ D I+ +MSR++KN  P L WT+++  +DY +L  DQ++NH+ K   FTTK GL  ++  L W+    PD FFPRCY++ T  E+  F++D+  T    +LK V+           + PRDQ   E+ G S  +    ++N +  L  +      PG       + +++A   C+  L   +HEDID +          +WE+    YY +VH    I  +N      +C+ +   +  +  Q D++G RN+WI+KP AKSRGR I+C  ++ ++L++ + +  ++ + ++++QKYIE PLLIC+TKFDIRQWFLVTDWNPLTIW+YK+ YLRF +Q+F+LD L+ A+HL NN++Q    N   RS +LPA NMW   +F+E+++ +G    W  +I P MK+++  A+   QD +E RKNSFELYGADF++   D +PWLIEINSSP M PST +T++L + V ED  KV +DR     CD G FELL++Q  +  PP+ G DL +AG+S+++
Sbjct:   56 KIFSIYGHYPVVRAALRRKGWVEKKFHF-------LPKVIP---DVEDEGARVNDDTCAKVKENQEMAL------------------EKTDNIHDVMSRLVKNEMPYLLWTIKRDIIDYHSLTYDQMLNHYAKTASFTTKIGLCVNMRSLPWYVPANPDSFFPRCYSLCTESEQQEFLEDFRRTMASSILKWVVSHQSCSRSSRSK-PRDQR--EEAGSSDLSSRQDAENAEAKLRGL------PG-------QLVDIACKVCQAYLGQLEHEDIDTSADAVEDLTEAEWEDLTQQYYSLVHGDAFI--SNSRNYFSQCQALLNRITSVNPQTDIDGLRNIWIIKPAAKSRGRDIVCMDRVEEILELAAADHPLSRDNKWVVQKYIETPLLICDTKFDIRQWFLVTDWNPLTIWFYKESYLRFSTQRFSLDKLDSAIHLCNNAVQKYLKNDVGRSPLLPAHNMWTSTRFQEYLQRQGRGAVWGSVIYPSMKKAIAHAMKVAQDHVEPRKNSFELYGADFVLGR-DFRPWLIEINSSPTMHPSTPVTAQLCAQVQEDTIKVAVDR----SCDIGNFELLWRQPVVEPPPFSGSDLCVAGVSVRR 607          
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Match: sp|Q9Y4R7|TTLL3_HUMAN (Tubulin monoglycylase TTLL3 OS=Homo sapiens OX=9606 GN=TTLL3 PE=1 SV=2)

HSP 1 Score: 417.927 bits (1073), Expect = 4.886e-130
Identity = 214/496 (43.15%), Postives = 306/496 (61.69%), Query Frame = 3
Query:  786 GCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRN--DFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGP-RSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNA 2261
            G      GL  +L  L WFD+ + + FFPRCY +   ++K AFI+D+  TA   +LK V+++       E +S     PI+   +  + D    K  K              +   +S +F++ A+  CE  L    H DID++    ++     W  FL  YY+VVHEG ++   +  T ++RCE+I  +L+ +  Q DMEG RN+WI+KPGAKSRGRGIMC   L ++LK++  N ++  + ++++QKYIERPLLI  TKFD+RQWFLVTDWNPLT+W+Y+D Y+RF +Q F+L +L+ +VHL NNSIQ    N   R  +LP +NMW  ++F+  ++  G  NAWS II+PGMK++VI AL   QD ++ RK SFELYGADF+  E D +PWLIEIN+SP MAPST++T+RL + V  D  +VV+DR  ++ CDTG FEL++KQ  + VP Y+GI L + G +IKKP      +  RR   RP    +  R +
Sbjct:  100 GTHALMVGLCLNLRNLPWFDEVDANSFFPRCYCLGAEDDKKAFIEDFWLTAARNVLKLVVKS-------EWKS----YPIQAVEEEASGDKQPKKQEK--------------NPVLVSPEFVDEALCACEEYLSNLAHMDIDKDLEAPLYLTPEGWSLFLQRYYQVVHEGAELRHLD--TQVQRCEDILQQLQAVVPQIDMEGDRNIWIVKPGAKSRGRGIMCMDHLEEMLKLVNGNPVVMKDGKWVVQKYIERPLLIFGTKFDLRQWFLVTDWNPLTVWFYRDSYIRFSTQPFSLKNLDNSVHLCNNSIQKHLENSCHRHPLLPPDNMWSSQRFQAHLQEMGAPNAWSTIIVPGMKDAVIHALQTSQDTVQCRKASFELYGADFVFGE-DFQPWLIEINASPTMAPSTAVTARLCAGVQADTLRVVIDRMLDRNCDTGAFELIYKQPAVEVPQYVGIRLLVEGFTIKKPM----AMCHRRMGVRPAVPLLTQRGS 563          
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Match: A0A267H1G7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003490g1 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 306/653 (46.86%), Postives = 421/653 (64.47%), Query Frame = 3
Query:  324 NISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE-------------TSGLQNQIEGQSPRDQ------------SPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWS-CDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL--SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHN-GPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSS 2195
            +IS +R++ AKE  +EA+++ KIF+ILGPY RVR  LR RGWVEKF+   +    T +          +  ++   D+ D DGD    D  D   G  P      PWEE+ G YG+MSR+++N  P L W+LRK QVD+K LR+DQ++NH GKAGCFTTK GL++SL +L WF  +  D F+PRCY +S+ EEK AF DDY  TAC+ LL+ V E              S  + + EGQS   +            SP +   D+    G   K+ K+I PKI ++  +P +   ++   LE AI  CE +++ R H+++D  D   C S  DW  FL +YY+V H G +I  A  + +  RC ++  ELR  + QFD++G RN WI+KPGAKSRGRGI C   L  VL++L   +++     + ++QKYIERPLL+  TKFDIRQWF+VTD+NPLTIWWYKDCY+RFCSQ FTL+D NEAVHLSNNSIQ+KY N   R   LP +N+WD    +  + + G  N + D+I PGM+++VI+++LC QD +E RKN FELYGADFM+ E + +PWL+EIN SP MAPST +T+RL  NV +D+ KVV+DRR+N+ C+TG+FEL++KQ Q+  P Y G+DL L G ++K+P+ +S
Sbjct:  194 SISDQRLRKAKELAEEAMRDKKIFSILGPYPRVRDSLRARGWVEKFFIKDEEKQQTLRRSMQGGGATGRQASAAADDDDDGDGDGDGDDMGDGDEGKVP------PWEEEGGFYGLMSRLVRNCQPTLIWSLRKDQVDFKFLRRDQLVNHFGKAGCFTTKIGLSRSLRELPWFHCESADAFYPRCYVLSSEEEKEAFKDDYRITACMSLLRLVGEDAILEPGSIEQDDASEAETKTEGQSETAKSSASAAAGGDGGSPKKSAADASPAKGGHHKDVKRIAPKIQFKSPRPATGDMVAKSVLETAITQCEQLIQNRNHDNLDDWDTASCMSESDWYSFLQSYYRVAHHGAQIRDAKSLKS--RCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPSAVGVTPNKLVVQKYIERPLLVHRTKFDIRQWFVVTDFNPLTIWWYKDCYVRFCSQHFTLNDFNEAVHLSNNSIQYKYINQANRHPDLPDDNIWDCITLQTHLSSIGQPNVYYDVIYPGMQKAVINSMLCSQDHVEMRKNCFELYGADFMIDE-NFRPWLLEINCSPTMAPSTEVTTRLCRNVQDDILKVVVDRRQNRACNTGRFELIYKQQQVNAPTYAGVDLTLLGQAVKRPWNAS 837          
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Match: A0A267H6M3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017329g2 PE=4 SV=1)

HSP 1 Score: 587.03 bits (1512), Expect = 0.000e+0
Identity = 293/632 (46.36%), Postives = 400/632 (63.29%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE-------------TSGLQNQIEGQSP------------RDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWS-CDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL--SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHN-GPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSS 2195
            KIF+ILGPY RVR  LR RGWVEKF+   +      K +   +++               D DD    D D           + PWEE+ G YG+MSR+++N  P L W+LRK QVD+K LR+DQ++NH GKAGCFTTK GL++SL +L WF  +  D F+PRCY +S+ EEK AF DDY  TAC+ LL+ V E              S  + + EGQS                SP +   D+    G   K+ K+I PKI ++  +P +   ++   LE AI  CE +++ R H+++D  D   C S  DW  FL +YY+V H G +I  A  + +  RC ++  ELR  + QFD++G RN WI+KPGAKSRGRGI C   L  VL++L   +++     + ++QKYIERPLL+  TKFDIRQWF+VTD+NPLTIWWYKDCY+RFCSQ FTL+D NEAVHLSNNSIQ+KY N   R   LP +N+WD    +  + + G  + + D+I PGM+++VI+++LC QD +E RKN FELYGADFM+ E + +PWL+EIN SP MAPST +T+RL  NV +D+ KVV+DRR+N+ C+TG+FEL++KQ Q+  P Y G+DL L G ++K+P+ +S
Sbjct:  215 KIFSILGPYPRVRDSLRARGWVEKFFIKDE-----EKQQTLRRSMQGGGATGRQASAAAADDDDDGDGDGDGDDMGDGEEGKVPPWEEEGGFYGLMSRLVRNCQPTLIWSLRKDQVDFKFLRRDQLVNHFGKAGCFTTKIGLSRSLRELPWFHCESADAFYPRCYVLSSEEEKEAFKDDYRITACMSLLRLVGEDAILEPGSIEQDDASEAETKTEGQSETAKSSASAAAGGGGGSPKKSAADASPAKGGHHKDVKRIAPKIQFKSPRPATDDMVAKSVLETAITQCEQLIQNRNHDNLDDWDTASCMSESDWYSFLQSYYRVAHHGARIRDAESLKS--RCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPSAVGVTPNKLVVQKYIERPLLVHRTKFDIRQWFVVTDFNPLTIWWYKDCYVRFCSQHFTLNDFNEAVHLSNNSIQYKYINQADRHPDLPDDNIWDCISLQTHLSSIGQPDVYYDVIYPGMQKAVINSMLCSQDHVEMRKNCFELYGADFMIDE-NFRPWLLEINCSPTMAPSTEVTTRLCRNVQDDILKVVVDRRQNRACNTGRFELIYKQQQVNAPTYAGVDLTLLGQAVKRPWNAS 838          
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Match: A0A1I8GTN0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 293/632 (46.36%), Postives = 400/632 (63.29%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE-------------TSGLQNQIEGQSP------------RDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWS-CDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL--SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHN-GPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSS 2195
            KIF+ILGPY RVR  LR RGWVEKF+   +      K +   +++               D DD    D D           + PWEE+ G YG+MSR+++N  P L W+LRK QVD+K LR+DQ++NH GKAGCFTTK GL++SL +L WF  +  D F+PRCY +S+ EEK AF DDY  TAC+ LL+ V E              S  + + EGQS                SP +   D+    G   K+ K+I PKI ++  +P +   ++   LE AI  CE +++ R H+++D  D   C S  DW  FL +YY+V H G +I  A  + +  RC ++  ELR  + QFD++G RN WI+KPGAKSRGRGI C   L  VL++L   +++     + ++QKYIERPLL+  TKFDIRQWF+VTD+NPLTIWWYKDCY+RFCSQ FTL+D NEAVHLSNNSIQ+KY N   R   LP +N+WD    +  + + G  + + D+I PGM+++VI+++LC QD +E RKN FELYGADFM+ E + +PWL+EIN SP MAPST +T+RL  NV +D+ KVV+DRR+N+ C+TG+FEL++KQ Q+  P Y G+DL L G ++K+P+ +S
Sbjct:   55 KIFSILGPYPRVRDSLRARGWVEKFFIKDE-----EKQQTLRRSMQGGGATGRQASAAAADDDDDGDGDGDGDDMGDGEEGKVPPWEEEGGFYGLMSRLVRNCQPTLIWSLRKDQVDFKFLRRDQLVNHFGKAGCFTTKIGLSRSLRELPWFHCESADAFYPRCYVLSSEEEKEAFKDDYRITACMSLLRLVGEDAILEPGSIEQDDASEAETKTEGQSETAKSSASAAAGGGGGSPKKSAADASPAKGGHHKDVKRIAPKIQFKSPRPATDDMVAKSVLETAITQCEQLIQNRNHDNLDDWDTASCMSESDWYSFLQSYYRVAHHGARIRDAESLKS--RCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPSAVGVTPNKLVVQKYIERPLLVHRTKFDIRQWFVVTDFNPLTIWWYKDCYVRFCSQHFTLNDFNEAVHLSNNSIQYKYINQADRHPDLPDDNIWDCISLQTHLSSIGQPDVYYDVIYPGMQKAVINSMLCSQDHVEMRKNCFELYGADFMIDE-NFRPWLLEINCSPTMAPSTEVTTRLCRNVQDDILKVVVDRRQNRACNTGRFELIYKQQQVNAPTYAGVDLTLLGQAVKRPWNAS 678          
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Match: A0A267E3V8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011733g1 PE=4 SV=1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 268/550 (48.73%), Postives = 368/550 (66.91%), Query Frame = 3
Query:  633 LSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE-------------TSGLQNQIEGQSPRDQ------------SPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWS-CDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL--SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHN-GPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSS 2195
            + PWEE+ G YG+MSR+++N  P L W+LRK QVD+K LR+DQ++NH GKAGCFTTK GL++SL +L WF  +  D F+PRCY +S+ EEK AF DDY  TAC+ LL+ V E              S  + + EGQS   +            SP +   D+    G   K+ K+I PKI ++  +P +   ++   LE AI  CE +++ R H+++D  D   C S  DW  FL +YY+V H G +I  A  + +  RC ++  ELR  + QFD++G RN WI+KPGAKSRGRGI C   L  VL++L   +++     + ++QKYIERPLL+  TKFDIRQWF+VTD+NPLTIWWYKDCY+RFCSQ FTL+D NEAVHLSNNSIQ+KY N   R   LP +N+WD    +  + + G  N + D+I PGM+++VI+++LC QD +E RKN FELYGADFM+ E + +PWL+EIN SP MAPST +T+RL  NV +D+ KVV+DRR+N+ C+TG+FEL++KQ Q+  P Y G+DL L G ++K+P+ +S
Sbjct:   38 VPPWEEEGGFYGLMSRLVRNCQPTLIWSLRKDQVDFKFLRRDQLVNHFGKAGCFTTKIGLSRSLRELPWFHCESADAFYPRCYVLSSEEEKEAFKDDYRITACMSLLRLVGEDAILEPGSIEQDDASEAETKTEGQSETAKSSASAAAGGDGGSPKKSAADASPAKGGHHKDVKRIAPKIQFKSPRPATGDMVAKSVLETAITQCEQLIQNRNHDNLDDWDTASCMSESDWYSFLQSYYRVAHHGAQIRDAKSLKS--RCRQLCTELRSEYPQFDIDGCRNAWIVKPGAKSRGRGIFCVRTLESVLELLRQPSAVGVTPNKLVVQKYIERPLLVHRTKFDIRQWFVVTDFNPLTIWWYKDCYVRFCSQHFTLNDFNEAVHLSNNSIQYKYINQANRHPDLPDDNIWDCITLQTHLSSIGQPNVYYDVIYPGMQKAVINSMLCSQDHVEMRKNCFELYGADFMIDE-NFRPWLLEINCSPTMAPSTEVTTRLCRNVQDDILKVVVDRRQNRACNTGRFELIYKQQQVNAPTYAGVDLTLLGQAVKRPWNAS 584          
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Match: A0A2C9JEA5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055000 PE=4 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 7.796e-180
Identity = 305/653 (46.71%), Postives = 433/653 (66.31%), Query Frame = 3
Query:  267 RSVTLKDVSDFKLS-RKSGTNIS-FERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVI-ETSGLQNQI---EGQSPRDQSPIEKFGDS-KTTDGSSSKNNK---KILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRN-DFIFCWSCDWEEFLTNYYKVVHEGFKIEGA---NHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKP 2183
            RS T+  ++  K+S +K GTN +  ER+++AKE  + A K  K+F I G Y+ +RQ LR RGWVEKFY    +  +  KS    K     +   N+ D+ DDD    D DDDDD      +   + PWEE+DGIYGIMSR+++N+ P LFW L++  +DY+ L KDQ++NH+ KAG FTTK GL  ++  + WFD  + + FFPRCY +S  E+K AF+DDY  TAC+ ++K  + +TS   + I   E +      P  K GD  K  +  ++K  +    + P     +++  ++  I  + LE A+  CE  L  + HEDID            W++ +  YY++VHE    EG+     V  +K+CE +   L +   QF+M+G RNVWI+KPGAKSRGRGI+CY KL D+LK++S+ ++  + ++++QKYIERPLLI NTKFDIRQWFLVTDWNPLT+W+Y+D YLRFCSQQFTL+D ++++HLSNN+IQ  Y NGPRS  LP ENMW   +F++++K++   NAW ++I P MK+++I +LL  QD +E+RK+SFELYGADFM++E DL PWLIEINSSP M  ST++T++L + VL+D  KVV+DR+ ++ CD G FEL +KQ  +TVPPYIGI+L + G S++KP
Sbjct:  306 RSKTMPTLNRMKISPQKLGTNANEGERLRLAKEMAERATKYKKVFTIQGGYSTIRQSLRKRGWVEKFY---KIPLTLKKSNSLQKEKKNSDDDDNNNDDNDDDDAAIDDDDDDDVDDMDNDQPKVPPWEEEDGIYGIMSRLVRNVNPTLFWVLKRDAIDYRFLTKDQMVNHYCKAGSFTTKVGLCINMRNVVWFDSTDHNTFFPRCYRLSHDEDKDAFVDDYRLTACMCIVKVAVRQTSSFPDHISEDEEEIKISDPPAAKPGDDDKKKENENTKTEEVETPLNPMGMTNKKRKKTRAIIPVRVLETAVYQCEKFLASKDHEDIDMPIQTGVLTEQQWDDLIQWYYQLVHE----EGSFINVPVDLVKQCESLTRRLAQHCPQFEMDGIRNVWIVKPGAKSRGRGIICYEKLEDMLKLVSSQVVKKDGKYVVQKYIERPLLIYNTKFDIRQWFLVTDWNPLTLWFYRDSYLRFCSQQFTLEDFDQSIHLSNNAIQKHYKNGPRSPRLPDENMWTHYEFKDYLKSKKQPNAWDELIYPSMKKAIICSLLVTQDLVEYRKSSFELYGADFMLTE-DLSPWLIEINSSPSMESSTAVTAKLCAAVLDDTIKVVIDRKLDRNCDIGAFELAYKQALVTVPPYIGINLCVEGQSVRKP 950          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Match: ENSAMXT00000016034.2 (tubulin monoglycylase TTLL3 [Source:NCBI gene;Acc:103039118])

HSP 1 Score: 462.996 bits (1190), Expect = 8.483e-148
Identity = 255/621 (41.06%), Postives = 380/621 (61.19%), Query Frame = 3
Query:  327 ISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYS----ISHKFLEMAIAYCEFILKIRKHEDID--RNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNI-LPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAG 2165
            I+ ER+++AK +V++AVK  KIF+I GPY  VR  L+ RGWVE+           H+ RP     DE+    ++  + DD+ +    +D DD                   I+ IMSRM++N    L+WT R+  +D +NLRK+Q+ NH+ K+  FTTK GL  +L  LRWFD  +PD FFPRCY +   +EKHAFI+D+  TAC+ LL+ ++E +  +  +EG                 TD          LP      RK G +      +  + ++ A+  C+  L   +H DID   +         W EF+ +YY  VH+G +IE  N V  +  C+ + C+L++   Q D++G  N+WI+KPGAKSRGRGI+C  +L ++LK++ S+ ++  ++++++QKYIERP LI  TKFD+RQWFLVTDWNPLT+W+YK CYLRF +Q +++D L+ +VHL NNSIQ  +    + N  +P +NMW   QF  ++ +   ++ W+ +I+PGMK+++I+ L   QD +E RK SFELYGADFM+ + DL+PWLIE+N+SP MAPST++T+RL + V ED  +VVLDRR ++   TG F+L+FKQ  + VP Y+G++L + G
Sbjct:   48 INSERLRMAKVQVEKAVKMRKIFSIHGPYPVVRAALKARGWVERRLPRP--TQHVHRRRPKE---DEECSDGDESGDDDDEEEPEKEEDPDD-------------------IHDIMSRMVRNEITYLYWTTRRDSIDNRNLRKEQMTNHYAKSATFTTKVGLCVNLRNLRWFDAADPDTFFPRCYRLGAEDEKHAFIEDFRRTACMSLLQCIVERNH-RGTLEG---------------SVTD----------LPDQLLSSRKKGCKRQALSVVPSRMIDCALQVCQDYLDSFEHNDIDIALDSKPTLTDQQWSEFMHHYYLTVHDGAEIE--NSVNYVDSCQAMLCKLQEACPQLDIDGIHNIWIIKPGAKSRGRGIVCIKQLDEILKLVDSDPMLIKDSKWVVQKYIERPFLIHETKFDLRQWFLVTDWNPLTVWFYKKCYLRFSTQPYSVDTLDSSVHLCNNSIQKHFRPSQQRNPEVPEDNMWSCDQFRSFLSSRNQEDQWAGVIVPGMKKAIINTLQTAQDLVESRKASFELYGADFMLGQ-DLRPWLIEVNASPTMAPSTAVTTRLCAAVQEDTLRVVLDRRLDRGAHTGGFQLIFKQTAVEVPQYVGMNLLIEG 615          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Match: ttll9 (tubulin tyrosine ligase-like family, member 9 [Source:ZFIN;Acc:ZDB-GENE-030131-1582])

HSP 1 Score: 135.961 bits (341), Expect = 1.460e-33
Identity = 104/346 (30.06%), Postives = 172/346 (49.71%), Query Frame = 3
Query: 1131 SISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVV-HEGFKIEGANHVTTIKRCEEIAC--ELRKIFSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVL---KILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDL-NEAVHLSNNSIQHKYHNGPRSNILPAENM-WDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            +  H ++E  +  C F    R H ++ R + +        + L  Y K +  E  ++EGA       +C+   C  EL   +  F  E  R+   +WI+KP A+S+G+GI  + KL D++   K+   SL   + R       ++ Q+YIE P LI   KFD+R + LVT + PL  W Y+D + RF + +F+L  + ++ VHL+N ++Q      P  +  P +   W  +Q   ++ A+    A  + +   +    I +LL VQ  I   K+ FELYG D ++ +  LKPWLIE+N+SP +  S+     +   +LED   VV    R   K+   G ++L++
Sbjct:   74 NFDHSYMEEHVRICHF----RNHYELTRKNLMV-------KNLKRYRKTLDREVGRLEGA-------KCDFFPCTFELPSEYHLFVEEFKRSPGSIWIMKPVARSQGKGIFLFRKLKDIMEWKKVQRFSLNFEDQRDEAPVESYVAQRYIENPYLIGGRKFDLRVYVLVTSYLPLKAWLYRDGFARFSNTRFSLSSIDDQYVHLTNVAVQ---KTAPDYD--PEKGCKWQMQQLRRYLTAKHGSEA-VETLFKDIDNIFIRSLLSVQKVIINDKHCFELYGYDILLDQ-HLKPWLIEVNASPSLTASSQEDYEMKYRLLEDTLNVVDMEGRLTGKEKRVGGYDLMW 394          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 114.005 bits (284), Expect = 4.613e-25
Identity = 68/229 (29.69%), Postives = 119/229 (51.97%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF--TLDDL-NEAVHLSNNSIQHK---YHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAW-----SDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            WI+KP A SRGRGI           + S S I  E   ++ +YI  PLLI + KFD+R + LVT ++P+ I+ Y++   RF + ++   + ++ N+ +HL+N S+  K   Y +     +    N W       +++ EG           D+I+  +  + I      +  +  R N FELYG D ++ + +LKPWL+E+N SP +A    +  ++ ++++ D+F +V
Sbjct:  172 WIIKPVASSRGRGIYL---------VSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLI-DSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 114.005 bits (284), Expect = 5.142e-25
Identity = 68/229 (29.69%), Postives = 119/229 (51.97%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF--TLDDL-NEAVHLSNNSIQHK---YHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAW-----SDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            WI+KP A SRGRGI           + S S I  E   ++ +YI  PLLI + KFD+R + LVT ++P+ I+ Y++   RF + ++   + ++ N+ +HL+N S+  K   Y +     +    N W       +++ EG           D+I+  +  + I      +  +  R N FELYG D ++ + +LKPWL+E+N SP +A    +  ++ ++++ D+F +V
Sbjct:  172 WIIKPVASSRGRGIYL---------VSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLI-DSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Match: ttll5 (tubulin tyrosine ligase like 5 [Source:NCBI gene;Acc:103033767])

HSP 1 Score: 114.005 bits (284), Expect = 5.272e-25
Identity = 68/229 (29.69%), Postives = 119/229 (51.97%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQF--TLDDL-NEAVHLSNNSIQHK---YHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAW-----SDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            WI+KP A SRGRGI           + S S I  E   ++ +YI  PLLI + KFD+R + LVT ++P+ I+ Y++   RF + ++   + ++ N+ +HL+N S+  K   Y +     +    N W       +++ EG           D+I+  +  + I      +  +  R N FELYG D ++ + +LKPWL+E+N SP +A    +  ++ ++++ D+F +V
Sbjct:  172 WIIKPVASSRGRGIYL---------VSSPSQIPMEENLLVSRYINNPLLIDDFKFDVRLYVLVTSYDPIIIYVYEEGLARFATVKYDHAMKNIKNQFMHLTNYSVNKKSSDYVSCDDPEVEDYGNKWSMSAMLRYLRQEGKDTTLLMGQIEDLIIKAVLSAEIQIATACKMFVPHRNNCFELYGFDVLI-DSNLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFSLV 390          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 415.231 bits (1066), Expect = 2.733e-133
Identity = 235/619 (37.96%), Postives = 346/619 (55.90%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRW---FDDKEPDEF-----FPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQN---QIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDID----RNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGR----GIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIFA+LGPY  +R  LR RGWVE   +      +T +S  + ++                                  N +G    E+    + ++SR+++N  P L WT R G VD K LRK+Q++NH  +AG FTTK  L K L  LR+   F    P+         RC    TV    ++ +D+  TA   LLK V+E  G  +   ++EG   +   P      S    G  +    + L                    L+ A+A CE  L+ ++HEDID    R +     S DW+ FL  YY+ VH G ++ G   +    +C ++   LR    Q DMEG+RN W++KPGA SRGR    G++C  +L ++L+++  ++ +  + R+I+QKY+ERPLLI  TKFDIRQWFLVTDWNPLT+W+Y+DCYLRF +Q F LD+L+ ++HL NNSIQ  + N   RS  LP +N+W  +QF  ++++ G   AW  +++PGMK+++I AL   QD ++ R+ SFELYGADF++ E D +PWL+EINSSP M+PST +T+ L + V +D+ +VVLDRR ++   TG F L+ KQ  + VP Y+G++L + G  +K+
Sbjct:    5 KIFAVLGPYPVIRACLRRRGWVEMRLW-ALAEGATPQSGASRRS--------------------------------RANETGKENCEQHGVSHELLSRLVRNEVPYLIWTTRCGSVDTKLLRKEQMLNHFARAGSFTTKL-LGKCLPPLRFVPSFHAVAPNFLSCCCHHSRCLATCTVS---SWAEDFRLTAATSLLKLVVERHGAMDGVGRLEGTEAQRGGPGGHPTFSPHPAGVEAPQRDRWL--------------------LDRAMAACETFLRSQEHEDIDGTASRPE-----SPDWDAFLQRYYRFVHGGERLRGVAELA--PQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDTSIHLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGE-DQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLDRRVDRSAHTGGFYLIHKQPAVEVPQYLGVNLSVEGERVKR 558          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 412.149 bits (1058), Expect = 1.519e-131
Identity = 238/626 (38.02%), Postives = 351/626 (56.07%), Query Frame = 3
Query:  387 KIFAILGPYNRVRQVLRNRGWVE-KFYFNGDLNT----STHKSRP--TNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRW---FDDKEPDEF-----FPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQN---QIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDID----RNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGR----GIMCYTKLHDVLKIL-SNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNG-PRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK 2180
            KIFA+LGPY  +R  LR RGWVE + +   +  T    ++ +SR   T K   E++  S++   I               +                    I SR+++N  P L WT R G VD K LRK+Q++NH  +AG FTTK  L K L  LR+   F    P+         RC    TV    ++ +D+  TA   LLK V+E  G  +   ++EG   +   P    G   T   +  +  ++                      L+ A+A CE  L+ ++HEDID    R +     S DW+ FL  YY+ VH G ++ G   +    +C ++   LR    Q DMEG+RN W++KPGA SRGR    G++C  +L ++L+++  ++ +  + R+I+QKY+ERPLLI  TKFDIRQWFLVTDWNPLT+W+Y+DCYLRF +Q F LD+L+ ++HL NNSIQ  + N   RS  LP +N+W  +QF  ++++ G   AW  +++PGMK+++I AL   QD ++ R+ SFELYGADF++ E D +PWL+EINSSP M+PST +T+ L + V +D+ +VVLDRR ++   TG F L+ KQ  + VP Y+G++L + G  +K+
Sbjct:   14 KIFAVLGPYPVIRACLRRRGWVEMRLWALAEGATPQSGASRRSRANETGKENCEQHGVSHELLYISGAVVRCAHTHSHHRL--------------------ITSRLVRNEVPYLIWTTRCGSVDTKLLRKEQMLNHFARAGSFTTKL-LGKCLPPLRFVPSFHAVAPNFLSCCCHHSRCLATCTVS---SWAEDFRLTAATSLLKLVVERHGAMDGVGRLEGTEAQRGGP----GGHPTPHPAGVEAPQR------------------DRWLLDRAMAACETFLRSQEHEDIDGTASRPE-----SPDWDAFLQRYYRFVHGGERLRGVAELA--PQCRDLLARLRAARPQLDMEGTRNTWVVKPGAMSRGRVTPPGVLCMNRLCEMLRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDNLDTSIHLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLESLGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRGSFELYGADFLLGE-DQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLDRRVDRSAHTGGFYLIHKQPAVEVPQYLGVNLSVEGERVKR 585          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 83.1889 bits (204), Expect = 6.080e-17
Identity = 58/246 (23.58%), Postives = 104/246 (42.28%), Query Frame = 3
Query: 1374 FDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNET-----------RFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKA-----EGYQNAWS-DIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLD 2060
            FD       WI KP   ++GRGI       DV  +    L+  +              I+Q+Y+  PLL+   KFD+R + L+    P  I  ++  Y R   Q ++ +  +   HL+N  +Q K    P    +  E +W   +F + +       +G    W        M++ +    L  +  +E +   F+L G DF++ E D K WL+E+N +P +  +  +   +   V+ +   + L+
Sbjct:  118 FDSYQEGEKWICKPTGLNQGRGIFLLRSAGDVAALRERLLLDADAGPRTPRAHVPQARIVQRYVTNPLLLDGRKFDVRSYMLIASAAP-PIVLFRHGYARLSCQSYSPESNDLTAHLTNQYMQKK---SPVYQEVKEETVWTMSRFNDHVNEHCAPHKGLPKDWVLTTFTKRMQQVMTHCFLATKSKLEGKLGLFDLIGCDFLIDE-DFKVWLLEMNCNPALQTNCMVLKEVIPQVVNETLDLALE 358          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 7.404e-14
Identity = 70/311 (22.51%), Postives = 127/311 (40.84%), Query Frame = 3
Query: 1119 GSQYSISHKFLEMAIAYCEFILKIRKHEDI--DRNDFIFCWSCDWEE-----FLTNYYKVVHEGFKIE------------------GANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDD---LNEAVHLSNNSIQHK---YHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIE--------WRKNSFELYGADFMV 1934
            G +Y +++KF+         IL      ++    NDF   W+    +      LT++ KV H     E                  G  H   I     +  E +   S    +  R  WI+KP A SRGRG+           + S + +T +   ++ +Y+  PLLI + KFD+R + LVT + PL I+ Y++   RF + ++  +     N+ +HL+N S+  K   Y +     +    N W        +K +G+    +  ++  +++ ++  +L V+  I          R N F + G   ++
Sbjct:   60 GERYHLAYKFVRTESRLVRNILGSHGFHEVHPSSNDFNLMWTGTHPKPFSLRSLTDFQKVNHFPRSYELTRKDRLCKNVQRMQQSHGHKHFNIIPATFLLPAEYQDFCSAHSKD--RGPWIVKPVASSRGRGVYL---------VNSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDRNSKFIKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHD---TTALMARIEDLIVKTILSVEQTIASSVRMFVPHRGNCFGMMGLGVLL 356          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010203.1 (pep scaffold:Pmarinus_7.0:GL479661:66:3454:1 gene:ENSPMAG00000009234.1 transcript:ENSPMAT00000010203.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 2.731e-7
Identity = 30/97 (30.93%), Postives = 53/97 (54.64%), Query Frame = 3
Query: 1851 VIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVL------DRRENK---QCDTGQFELLFKQ 2114
            V+ +L  V   +   K+ FE YG D ++ +  LKPWLIE+N+SP ++ +T+    +  N++ D   +V+      D R NK   +   G ++LL+ +
Sbjct:   40 VLHSLRAVAGVMANDKHCFECYGYDIIIDD-KLKPWLIEVNASPSLSSTTANDRIMKYNLINDTLNIVMPGADMPDPRWNKVPAREALGNYDLLYDE 135          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Match: EDO44351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW52])

HSP 1 Score: 466.077 bits (1198), Expect = 2.452e-152
Identity = 260/615 (42.28%), Postives = 369/615 (60.00%), Query Frame = 3
Query:  333 FERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKY-HNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISI 2174
            FE+++ AKE  D A+KN K+F   G Y  VR  LR RGWVEK +F G L +   K + TNK+ D  + + + GD+ D D                P+++               SRM++N  P+L WT+++  +D+K LRKDQI+NH+ KA  FTTK GL  +L  L W+++ +   FFPRC+ +   E+   F+DD+  T+ V L++  +     Q    G+S   QS  E   D++ T   +++++    P+             +S + L +A+  C   L  ++H DID       WS      L N+Y V+  G  I  AN     + C+    +LR+   QFD++G RNVWI+KPGAKSRGRGI+C  KL D++K+  N +   E R+++QKYIERPLLI   KFDIRQWFLVTDWNPLT+W+Y+DCYLRFCSQ F+L+D + ++HL+NNSIQ  Y +N  R   LP ENMW   +F+ ++K     + W  +I PGMK+ V++ L   Q+ +E RKNSFELYGADF++   D KPWLIEIN SP M  ST++T +L + VLED  KV+LDR+E+K C TG+FEL +KQ  ++ PPYIGI++ + G  I
Sbjct:    8 FEKVRQAKEVADIAIKNKKVFICHGTYPIVRATLRRRGWVEK-HFKGSLISKKAKRKQTNKDYDSDDDSCDSGDDSDADT---------------PSSN---------------SRMVRNAVPSLIWTVKRDDIDFKFLRKDQIVNHYSKAHSFTTKVGLCMNLRNLLWYENTDAMSFFPRCHRLGAEEDILDFVDDFRLTSAVALVRWAV-----QRHENGRSSH-QSSSET--DTQGTHDMAAQSDSDHSPR-----------NVLSVRALTLALEACREFLHCKEHLDIDDTTSTVSWSA----ILVNFYLVLSSGAVI--ANASPFARECQSTLNQLREHLPQFDIDGVRNVWIVKPGAKSRGRGIVCMDKLEDIMKLTGNIVGQKEGRWVVQKYIERPLLIYGVKFDIRQWFLVTDWNPLTLWFYEDCYLRFCSQNFSLEDFHVSIHLANNSIQKNYDNNSTRDKRLPDENMWSSDEFKAYLKKRDLGHMWDSVIYPGMKQGVMNVLQSCQEVVECRKNSFELYGADFIIGV-DYKPWLIEINCSPTMGASTAVTRKLCAQVLEDTMKVILDRKEDKNCGTGRFELAYKQAHVSAPPYIGINMSVEGTGI 565          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Match: EDO40528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S719])

HSP 1 Score: 124.79 bits (312), Expect = 6.755e-31
Identity = 80/253 (31.62%), Postives = 129/253 (50.99%), Query Frame = 3
Query: 1350 ELRKIFSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVL----------KILSNSLITNETR----FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEA-VHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            EL   +  F  E  RN    WI+KP +KS+G+GI  + KL D++          + L+   I ++      +I+Q+YIE P L+   KFD+R + LVT ++PL +W Y++ + RF + +F+LD +++  VHL+N +IQ                            A  Y     + ++  + + +I +L  VQ  +   K+ FELYG D M  + +LKPWLIE+N+SP +  S+     L   +LEDV  V+
Sbjct:  128 ELPMEYHIFVEEFKRNPGTTWIMKPVSKSQGKGIFLFRKLKDIMDWKKEDPYRTQQLAEERIKDDKEPIETYIVQRYIENPFLVGGRKFDLRIYVLVTSYSPLCVWLYREGFARFSNTRFSLDSIDDTYVHLTNVAIQKT--------------------------APDYDPEKVEQVMRNIDQMIIKSLQAVQKVMINDKHCFELYGYDIMF-DSNLKPWLIEVNASPSLTASSQTDYELKFRLLEDVVYVI 353          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Match: EDO42060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K6])

HSP 1 Score: 114.005 bits (284), Expect = 2.291e-27
Identity = 77/244 (31.56%), Postives = 129/244 (52.87%), Query Frame = 3
Query: 1350 ELRKIFSQFDM--EGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDL-NEAVHLSNNSIQHKYHNGPRSNI----LPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQ--DCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            + RK  +++    + ++N+WI KP   SRGRGI  +  L D         +T ++  ++Q+YI  PLLIC  KFD+R + LVT ++PL I+ Y +  +RF +++F L  L N   HL+N+SI  +   GP  ++    +     W   Q    ++A  +Q+   D +L     ++I   L  Q  +  +   N FELYG D ++ E +LKPWL+E+N SP +     +   +   +L D F+++
Sbjct:  105 DYRKFVAEYSKKKDATKNIWICKPADLSRGRGIFLFENLLD---------LTYDSAAVVQRYISSPLLICGYKFDLRLYVLVTSFHPLCIYVYHEGMVRFSTEKFDLSTLSNLFSHLTNSSINKQ---GPSYSLDKERIGTGCKWTLSQ----LRAYFHQHNIGDGMLWHRINTIIILTLLTQAPEVSKSCTNCFELYGFDILIDE-NLKPWLLEVNFSPSLGSDCLVDLTIKKPLLNDTFELL 331          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Match: EDO38145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP2])

HSP 1 Score: 100.138 bits (248), Expect = 5.571e-22
Identity = 74/244 (30.33%), Postives = 123/244 (50.41%), Query Frame = 3
Query: 1374 FDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRF--CSQQFTLDDL-NEAVHLSNNSIQHKYHNGPRSNI---LPAENMWDW-KQFEEWIKAEGYQNA--W---SDIILPGM--KESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDR 2063
            +D  GSR  WILKP A +RG GI    K          + I  +   I+QKY+ +P LI  +KFD+R +  VT ++PL I+ ++D  +RF  C    ++  L N  +HL+N S+  K     +SN    L   + W + K    + K  G  +A  W    D+I+  +   +S ++ L  ++  +  R    EL+G D M+ E +LKPWL+E+N SP +  ++ +   +   ++ D+  +   R
Sbjct:  139 WDEGGSRQKWILKPPASARGIGIRVIHKW---------TQIPRKRPVIVQKYLHKPFLINGSKFDLRIYVYVTSYDPLRIYIFEDGLVRFATCKYSSSVKSLSNRFMHLTNYSVNKKNEGAYQSNADDSLCQGHKWYYLKSLWGYFKRMGINHAQVWDSVKDVIVKAIIASDSFVNTL--IKQNVRHRSCCHELFGCDVMLDE-NLKPWLLEVNISPSLHSNSQLDRNIKGQMIRDLMNLAAFR 370          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Match: EDO40146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W3])

HSP 1 Score: 92.4337 bits (228), Expect = 1.567e-19
Identity = 73/282 (25.89%), Postives = 125/282 (44.33%), Query Frame = 3
Query: 1269 YKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLI---------CNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDD---LNEAVHLSNNSIQHKYHNGPRSNILPAE---NMWDWKQFEEWIKAEGYQNAW-----SDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV 2054
            YK +      +G  H   I     +  E  + ++ F  E  R  WI+KP A SRGRGI           I   S +  +   ++ +YI  PLLI            KFD+R +  VT ++PL I+ Y++   RF + ++        N  +HL+N S+  K  N         E   N W       +IK +G           D+++  +    +      +  +    N FE+YG D ++ E +L+PWL+E+N SP +A  + +  ++ S+++ D+F ++
Sbjct:   78 YKNIQRLQHSKGLKHFDFIPNSFVLPEEYNEFYAAFMKE--RGHWIVKPVASSRGRGIFL---------ISHPSQVPLDDHLLVCRYITNPLLIDGNIYCFNFIGFKFDVRLYVGVTCYDPLRIYLYEEGLSRFATVKYDKSGKNIRNSCMHLTNYSVNKKSENFVSCQDPEVEDYGNKWSMSAMLRFIKHKGIDTTALMMRIEDVVVKTIIAGELPIASACKMFMPHPGNCFEIYGFDILIDE-NLRPWLLEVNLSPSLACDSPLDLKIKSHLVTDMFNLI 347          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 122.865 bits (307), Expect = 1.819e-29
Identity = 86/264 (32.58%), Postives = 136/264 (51.52%), Query Frame = 3
Query: 1365 FSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCY---LRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAEN-MWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            +  F  E +RN    WI+KP AKS+G+GI  + KL D++    +   + E +       +++Q+YIE P LI   KFD+R + LVT + PL +W Y+D +           T+DD  + +HL+N S+Q      P  +  P +   W  +Q   ++ A+ Y     + +   M   +I +L  VQ  I   K+ FELYG D ++   +LKPWLIE+N+SP  APS+     +   +LED   VV    R   ++   G F+L++
Sbjct:   92 YHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFRKLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDD--KYMHLTNVSVQ---KTAPDYD--PEKGCKWQMQQLRRYLTAK-YGREVVETLFGDMDNIIIRSLQSVQKVIINDKHCFELYGYDILLDH-NLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVVDMEGRLTGQEKRVGGFDLMW 346          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 122.865 bits (307), Expect = 2.050e-29
Identity = 86/264 (32.58%), Postives = 136/264 (51.52%), Query Frame = 3
Query: 1365 FSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYL---RFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAEN-MWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            +  F  E +RN    WI+KP AKS+G+GI  + KL D++    +   + E +       +++Q+YIE P LI   KFD+R + LVT + PL +W Y+D +           T+DD  + +HL+N S+Q      P  +  P +   W  +Q   ++ A+ Y     + +   M   +I +L  VQ  I   K+ FELYG D ++   +LKPWLIE+N+SP  APS+     +   +LED   VV    R   ++   G F+L++
Sbjct:  106 YHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFRKLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDD--KYMHLTNVSVQ---KTAPDYD--PEKGCKWQMQQLRRYLTAK-YGREVVETLFGDMDNIIIRSLQSVQKVIINDKHCFELYGYDILLDH-NLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVVDMEGRLTGQEKRVGGFDLMW 360          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 123.25 bits (308), Expect = 2.566e-29
Identity = 86/264 (32.58%), Postives = 136/264 (51.52%), Query Frame = 3
Query: 1365 FSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYL---RFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENM-WDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            +  F  E +RN    WI+KP AKS+G+GI  + KL D++    +   + E +       +++Q+YIE P LI   KFD+R + LVT + PL +W Y+D +           T+DD  + +HL+N S+Q      P  +  P +   W  +Q   ++ A+ Y     + +   M   +I +L  VQ  I   K+ FELYG D ++   +LKPWLIE+N+SP  APS+     +   +LED   VV    R   ++   G F+L++
Sbjct:  137 YHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFRKLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDD--KYMHLTNVSVQ---KTAPDYD--PEKGCKWQMQQLRRYLTAK-YGREVVETLFGDMDNIIIRSLQSVQKVIINDKHCFELYGYDILLDH-NLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVVDMEGRLTGQEKRVGGFDLMW 391          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Match: ttll9 (tubulin tyrosine ligase like 9 [Source:NCBI gene;Acc:101172578])

HSP 1 Score: 122.479 bits (306), Expect = 2.606e-29
Identity = 86/264 (32.58%), Postives = 136/264 (51.52%), Query Frame = 3
Query: 1365 FSQFDMEGSRN---VWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETR-------FIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCY---LRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAEN-MWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVV--LDRRENKQCDTGQFELLF 2108
            +  F  E +RN    WI+KP AKS+G+GI  + KL D++    +   + E +       +++Q+YIE P LI   KFD+R + LVT + PL +W Y+D +           T+DD  + +HL+N S+Q      P  +  P +   W  +Q   ++ A+ Y     + +   M   +I +L  VQ  I   K+ FELYG D ++   +LKPWLIE+N+SP  APS+     +   +LED   VV    R   ++   G F+L++
Sbjct:  103 YHLFVEEFNRNPGSTWIMKPVAKSQGKGIFLFRKLKDIIDWKKDRSRSEEQKDAAHLDSYVVQRYIENPYLINGRKFDLRVYVLVTSYVPLKVWLYRDGFARFSSSRFSLSTIDD--KYMHLTNVSVQ---KTAPDYD--PEKGCKWQMQQLRRYLTAK-YGREVVETLFGDMDNIIIRSLQSVQKVIINDKHCFELYGYDILLDH-NLKPWLIEVNASPSHAPSSQEDYEMKYGLLEDTLNVVDMEGRLTGQEKRVGGFDLMW 357          
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Match: ttll1 (tubulin tyrosine ligase like 1 [Source:NCBI gene;Acc:101159875])

HSP 1 Score: 104.76 bits (260), Expect = 1.922e-23
Identity = 74/261 (28.35%), Postives = 128/261 (49.04%), Query Frame = 3
Query: 1401 WILKPGAKSRGRGIMCYTKLHDVLKILSNSLIT-------NETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFT-----LDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQC---------DTGQFELLFKQVQ 2120
            WI+KP  K++G+GI    KL  + K   +S  +        +  ++I  YI+ PLLI   KFD+R + LVT + PL  + YK  + RFC+ ++T     LD  N  VHL+N +IQ   H    +++   +  W       ++++   +   ++ +   +   V+ +L  V   +   K+ FE YG D ++ +  LKPWLIE+N+SP +  ST+    L  N++ D   +V    +   C           G +++L+ + Q
Sbjct:   97 WIMKPCGKAQGKGIFLINKLSQIKKWSRDSRTSTFVAASSGKEAYVISLYIDNPLLIGGKKFDLRLYVLVTTYRPLKCYMYKLGFCRFCTVKYTPSTSELD--NMFVHLTNVAIQK--HGDDYNHVHGGK--WTVSNLRLYLESTRGKEV-TNRLFDQIHWIVVQSLKAVAPVMNNDKHCFECYGYDIIIDD-KLKPWLIEVNASPSLTSSTANDRILKYNLINDTLNIVTPNGDIPDCRWNRSPPREAMGNYQVLYDEEQ 349          
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Match: SMESG000029205.1 (SMESG000029205.1)

HSP 1 Score: 1887.08 bits (4887), Expect = 0.000e+0
Identity = 1000/1017 (98.33%), Postives = 1000/1017 (98.33%), Query Frame = 3
Query:   81 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVXXXXXXXXXXXXQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEVVNFSMAKKMMNSSFKDHAXXXXXXXXXXXXXXXXTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREEXXXXXXXXXXTSPVL 3131
            MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE SGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVE                DHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREENNSNIILINLTSPVL
Sbjct:    1 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIENSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVE----------------DHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREENNSNIILINLTSPVL 1001          
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Match: SMESG000029205.1 (SMESG000029205.1)

HSP 1 Score: 1882.46 bits (4875), Expect = 0.000e+0
Identity = 998/1017 (98.13%), Postives = 998/1017 (98.13%), Query Frame = 3
Query:   81 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVXXXXXXXXXXXXQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEVVNFSMAKKMMNSSFKDHAXXXXXXXXXXXXXXXXTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREEXXXXXXXXXXTSPVL 3131
            MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE SGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT                  KDHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREENNSNIILINLTSPVL
Sbjct:    1 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIENSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT------------------KDHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREENNSNIILINLTSPVL 999          
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Match: SMESG000029205.1 (SMESG000029205.1)

HSP 1 Score: 1878.22 bits (4864), Expect = 0.000e+0
Identity = 983/1002 (98.10%), Postives = 983/1002 (98.10%), Query Frame = 3
Query:   81 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVXXXXXXXXXXXXQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEVVNFSMAKKMMNSSFKDHAXXXXXXXXXXXXXXXXTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREE 3086
            MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE SGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT                  KDHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREE
Sbjct:    1 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIENSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT------------------KDHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPSFNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKREE 984          
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Match: SMESG000029205.1 (SMESG000029205.1)

HSP 1 Score: 1759.96 bits (4557), Expect = 0.000e+0
Identity = 926/951 (97.37%), Postives = 929/951 (97.69%), Query Frame = 3
Query:   81 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVXXXXXXXXXXXXQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEVVNFSMAKKMMNSSFKDHAXXXXXXXXXXXXXXXXTQLFIQKYALTKSIPSF 2933
            MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE SGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVE                DHASKKKNKQNQQLKKSLNTQLFIQ  A+  +I S+
Sbjct:    1 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIENSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVE----------------DHASKKKNKQNQQLKKSLNTQLFIQSRAIDSTISSY 935          
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Match: SMESG000029205.1 (SMESG000029205.1)

HSP 1 Score: 1754.57 bits (4543), Expect = 0.000e+0
Identity = 924/951 (97.16%), Postives = 927/951 (97.48%), Query Frame = 3
Query:   81 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIXXXXXXXXXXXXNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNXXXXXXXXXXXXXXXXXXXXXXXXPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVXXXXXXXXXXXXQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEVVNFSMAKKMMNSSFKDHAXXXXXXXXXXXXXXXXTQLFIQKYALTKSIPSF 2933
            MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIE SGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT                  KDHASKKKNKQNQQLKKSLNTQLFIQ  A+  +I S+
Sbjct:    1 MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVKEKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVKNGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEKNIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSRMLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQLRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIENSGLQNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQYSISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVVHEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSRGRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQWFLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGPRSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQDCIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNVLEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKKPFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTIVPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQLQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVISTHIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPT------------------KDHASKKKNKQNQQLKKSLNTQLFIQSRAIDSTISSY 933          
The following BLAST results are available for this feature:
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL35.331e-14944.09tubulin tyrosine ligase like 3 [Source:HGNC Symbol... [more]
TTLL36.684e-14245.16tubulin tyrosine ligase like 3 [Source:HGNC Symbol... [more]
TTLL89.423e-13338.47tubulin tyrosine ligase like 8 [Source:HGNC Symbol... [more]
TTLL31.889e-12943.15tubulin tyrosine ligase like 3 [Source:HGNC Symbol... [more]
TTLL82.651e-12837.20tubulin tyrosine ligase like 8 [Source:HGNC Symbol... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-99.787e-2625.35Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-52.659e-2327.13Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-53.171e-2327.13Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-41.505e-1626.23Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
ttll-42.023e-1626.23Tubulin polyglutamylase ttll-4 [Source:UniProtKB/... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL3A7.644e-10436.81gene:FBgn0031854 transcript:FBtr0079305[more]
TTLL3B1.349e-6534.80gene:FBgn0031853 transcript:FBtr0300056[more]
TTLL1A8.756e-2932.08gene:FBgn0030823 transcript:FBtr0074403[more]
TTLL1B1.483e-2229.69gene:FBgn0052238 transcript:FBtr0073344[more]
TTLL4B5.787e-2229.13gene:FBgn0031574 transcript:FBtr0077501[more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll31.050e-15742.45tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll95.846e-3428.53tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll96.895e-3428.69tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll54.824e-2526.81tubulin tyrosine ligase-like family, member 5 [Sou... [more]
ttll17.657e-2328.14tubulin tyrosine ligase-like family, member 1 [Sou... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000053815.17.974e-15742.93uncharacterized LOC100158544 [Source:NCBI gene;Acc... [more]
ENSXETT00000053821.12.007e-15642.93uncharacterized LOC100158544 [Source:NCBI gene;Acc... [more]
ENSXETT00000002709.12.938e-13037.88tubulin tyrosine ligase like 3 [Source:NCBI gene;A... [more]
tlr59.704e-13038.03toll like receptor 5 [Source:Xenbase;Acc:XB-GENE-4... [more]
ap1b19.483e-12838.85adaptor related protein complex 1 subunit beta 1 [... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll32.376e-15942.05tubulin tyrosine ligase-like family, member 3 [Sou... [more]
Ttll32.931e-15742.05tubulin tyrosine ligase-like family, member 3 [Sou... [more]
Ttll31.724e-15541.98tubulin tyrosine ligase-like family, member 3 [Sou... [more]
Ttll81.039e-13738.97tubulin tyrosine ligase-like family, member 8 [Sou... [more]
Ttll92.072e-2929.15tubulin tyrosine ligase-like family, member 9 [Sou... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1ECV4|TTLL3_DANRE1.346e-15642.45Tubulin monoglycylase TTLL3 OS=Danio rerio OX=7955... [more]
sp|A4Q9E5|TTLL3_MOUSE2.050e-15642.05Tubulin monoglycylase TTLL3 OS=Mus musculus OX=100... [more]
sp|A4Q9F1|TTLL8_MOUSE7.265e-13738.97Protein monoglycylase TTLL8 OS=Mus musculus OX=100... [more]
sp|A6PVC2|TTLL8_HUMAN4.693e-13238.47Protein monoglycylase TTLL8 OS=Homo sapiens OX=960... [more]
sp|Q9Y4R7|TTLL3_HUMAN4.886e-13043.15Tubulin monoglycylase TTLL3 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H1G70.000e+046.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H6M30.000e+046.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GTN00.000e+046.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E3V80.000e+048.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9JEA57.796e-18046.71Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016034.28.483e-14841.06tubulin monoglycylase TTLL3 [Source:NCBI gene;Acc:... [more]
ttll91.460e-3330.06tubulin tyrosine ligase-like family, member 9 [Sou... [more]
ttll54.613e-2529.69tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll55.142e-2529.69tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
ttll55.272e-2529.69tubulin tyrosine ligase like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll32.733e-13337.96tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll31.519e-13138.02tubulin tyrosine ligase-like family, member 3 [Sou... [more]
TTLL106.080e-1723.58tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
ENSPMAT00000008895.17.404e-1422.51pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ENSPMAT00000010203.12.731e-730.93pep scaffold:Pmarinus_7.0:GL479661:66:3454:1 gene:... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443512.452e-15242.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405286.755e-3131.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420602.291e-2731.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381455.571e-2230.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401461.567e-1925.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll91.819e-2932.58tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll92.050e-2932.58tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll92.566e-2932.58tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll92.606e-2932.58tubulin tyrosine ligase like 9 [Source:NCBI gene;A... [more]
ttll11.922e-2328.35tubulin tyrosine ligase like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin monoglycylase TTLL3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029205.10.000e+098.33SMESG000029205.1[more]
SMESG000029205.10.000e+098.13SMESG000029205.1[more]
SMESG000029205.10.000e+098.10SMESG000029205.1[more]
SMESG000029205.10.000e+097.37SMESG000029205.1[more]
SMESG000029205.10.000e+097.16SMESG000029205.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013779 ID=SMED30013779|Name=Tubulin monoglycylase TTLL3|organism=Schmidtea mediterranea sexual|type=transcript|length=3332bp
TCTCAGATCCATGACTACCTTTCACTGAAAATGTTCAATATCATTATTTT
AATTATCTAATAAAACAGACACGCTAGACAATGGATGGAACTATTATTGA
CCAACAAAAAGACTCTGTTTTGGCAATAGAGCATAGCAGATCCCCAACAA
GTATTTCTCAGTTTTCAATGGACTATGGCCGAACATTAATTAAATCAATG
GAAAATATTTTAATCTCAGACATAGTGAAAGAAAAATCTCATAAGAAACA
AACAAATCATATGAGACGAAGTGTAACTTTGAAGGATGTATCGGATTTCA
AATTAAGTCGTAAATCCGGTACCAATATTTCATTCGAGCGAATCAAAGTA
GCAAAGGAAAAAGTTGACGAAGCTGTTAAAAATGGAAAGATTTTCGCAAT
ACTAGGACCCTATAATCGCGTGAGACAAGTTTTGAGAAATCGAGGATGGG
TTGAGAAATTTTATTTCAACGGTGATTTGAATACTTCAACTCATAAATCC
CGCCCAACTAATAAAAATGTTGACGAAAAGAATATAGCGTCTAATGATGG
AGATGAAATTGATGATGATGGAGATGATGGAGATATCGATGATGATGACG
ATACGATTGGCGATGGTCCGAATACTAGCGGTCTTTCACCTTGGGAAGAA
GATGATGGAATATACGGAATAATGTCGCGAATGTTAAAAAATATAGCCCC
TAATTTATTTTGGACCTTAAGGAAAGGTCAAGTAGATTATAAAAATCTTC
GCAAAGACCAAATTATAAACCATCATGGCAAGGCTGGCTGTTTTACAACT
AAAACTGGCCTTGCTAAAAGTCTAAATCAGCTAAGGTGGTTTGACGATAA
AGAGCCAGATGAATTTTTCCCGCGCTGCTACACTATATCAACAGTCGAAG
AAAAGCATGCTTTCATTGATGACTACCATTTTACTGCATGCGTTGGTCTT
TTGAAAGAAGTTATTGAAACCTCAGGATTGCAGAATCAAATAGAAGGACA
ATCTCCTAGAGATCAAAGCCCAATTGAAAAATTTGGCGACTCTAAAACAA
CAGATGGAAGTAGCAGTAAGAACAATAAAAAAATTTTGCCGAAAATTCAT
TACCGTGAAAGAAAGCCAGGCAGCCAATACTCGATCAGTCACAAGTTCCT
GGAAATGGCCATAGCTTATTGTGAATTCATTCTAAAAATTAGAAAACATG
AAGATATTGATCGTAATGATTTTATTTTTTGTTGGAGTTGCGATTGGGAA
GAATTCCTGACAAATTATTACAAAGTTGTACACGAAGGTTTCAAGATCGA
AGGAGCGAATCACGTAACAACTATTAAACGTTGCGAAGAAATTGCATGTG
AACTTCGGAAAATATTTTCGCAATTCGATATGGAAGGTTCTAGAAATGTG
TGGATATTAAAACCGGGTGCTAAGTCTAGAGGCCGAGGAATTATGTGCTA
CACTAAACTTCACGATGTGTTGAAAATTTTATCAAATAGTTTAATCACAA
ATGAAACTCGATTTATTATTCAAAAATACATTGAAAGACCCCTTTTAATA
TGCAATACAAAATTTGATATCAGACAATGGTTTCTTGTGACCGATTGGAA
CCCATTGACCATTTGGTGGTATAAGGACTGCTATCTCCGATTTTGTTCTC
AGCAGTTCACTTTGGACGATTTAAATGAAGCAGTGCATTTATCAAACAAT
TCAATTCAACATAAATACCACAATGGACCTCGATCAAATATTCTTCCAGC
AGAAAATATGTGGGACTGGAAACAATTTGAAGAATGGATTAAAGCGGAAG
GGTATCAGAATGCTTGGAGTGACATCATTTTGCCTGGAATGAAAGAATCA
GTAATAGATGCTTTACTTTGTGTTCAAGATTGCATTGAATGGAGAAAAAA
CTCTTTCGAACTTTATGGTGCAGATTTTATGGTGTCCGAAGGTGACCTTA
AACCTTGGCTCATTGAAATAAATTCTAGTCCTTGTATGGCTCCAAGTACA
TCTATTACTTCACGTCTAACTTCCAATGTTTTAGAAGATGTTTTTAAAGT
TGTTTTGGATCGGAGAGAAAACAAGCAATGTGATACCGGACAATTTGAGC
TGCTTTTCAAACAAGTTCAAATAACTGTCCCCCCGTATATTGGTATCGAT
TTGAAACTTGCTGGAATATCAATAAAAAAGCCCTTTCTTTCATCTACCAT
TTTAACTGAACGTCGTTCGTCCACTAGGCCAATAACAGATTCGATCATGA
TAAGAAACGCTGTTAGAAAAGATGACCGAATCGGTATTAGACGAAAAATT
CAAGACAACTCACTTGCAATTTCGACAATTGTTCCTCTTAAAGAAACAAC
AACCAAACCGACTGAAATAAAGTCAAACATATTACATAAAAGATCCAAAA
CATCAATTGTTATAAATAATGATCCAAGCAAATCTCGCAAATCGTTTTTG
ACTCATAATCGGGCTCCTGTTACGTCTCAGTTACAGAAATCTGCAAAACT
CATAATCACTAACTCCACGCCGAAGGATAATAAGGATTTAGTAAAGAAGA
CAAATGCCCCTATTCCGGAATTTGAGCAAGATGGTCTTGACGAAGATAGG
GATCTTATAACTGACACGGTGATATCGACTCACATTATCGATAGTACTAC
TAATGAATCGAATCTCAATCAAAATAATGAGAAACACAAAAACCAATCTT
TCCCCATTATTTCCAAACCTGGGATGATACCTAAATTAAACACAAATAGA
GAATATAAACTTCCCACCAAAGTAGAAGTTGTAAATTTTTCCATGGCTAA
AAAGATGATGAATTCCTCTTTCAAGGATCATGCTTCTAAAAAGAAAAACA
AACAGAATCAACAACTCAAAAAGTCTTTGAATACTCAATTATTTATTCAA
AAATACGCATTAACCAAATCTATACCTAGTTTTAATAACTTTCACAGATC
ATTTAATAAAAACTGCCAATATGGCCGATCGTACTCTCTCATGTGTGACG
ATTTTGGTTACGTGTTCAAACCGAAGACCTCTGTATCTGCTCGAGTTAAT
TCCAAAACTCTGAAAATCCTTTCTAAACGAGAAGAAAATAATAGTAATAT
CATTTTAATAAATCTAACATCTCCAGTATTGTAGTAAAAATGGAGTATTT
GTTTTTTTACATAATATTGAAATTGTGAAATTTTTCTTAACATTTATTTT
TTTATAAATTTGAACAAACTATTTTTTTTATTAGATTTTTTAGTCATTAA
CGGTTTTATTTTTATTCATTAGATTTAGGTTGTGGATTGAATTTACGGTG
TAATGAAGAGAAATGTGATATTTTATATAGCA
back to top

protein sequence of SMED30013779-orf-1

>SMED30013779-orf-1 ID=SMED30013779-orf-1|Name=SMED30013779-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1018bp
MDGTIIDQQKDSVLAIEHSRSPTSISQFSMDYGRTLIKSMENILISDIVK
EKSHKKQTNHMRRSVTLKDVSDFKLSRKSGTNISFERIKVAKEKVDEAVK
NGKIFAILGPYNRVRQVLRNRGWVEKFYFNGDLNTSTHKSRPTNKNVDEK
NIASNDGDEIDDDGDDGDIDDDDDTIGDGPNTSGLSPWEEDDGIYGIMSR
MLKNIAPNLFWTLRKGQVDYKNLRKDQIINHHGKAGCFTTKTGLAKSLNQ
LRWFDDKEPDEFFPRCYTISTVEEKHAFIDDYHFTACVGLLKEVIETSGL
QNQIEGQSPRDQSPIEKFGDSKTTDGSSSKNNKKILPKIHYRERKPGSQY
SISHKFLEMAIAYCEFILKIRKHEDIDRNDFIFCWSCDWEEFLTNYYKVV
HEGFKIEGANHVTTIKRCEEIACELRKIFSQFDMEGSRNVWILKPGAKSR
GRGIMCYTKLHDVLKILSNSLITNETRFIIQKYIERPLLICNTKFDIRQW
FLVTDWNPLTIWWYKDCYLRFCSQQFTLDDLNEAVHLSNNSIQHKYHNGP
RSNILPAENMWDWKQFEEWIKAEGYQNAWSDIILPGMKESVIDALLCVQD
CIEWRKNSFELYGADFMVSEGDLKPWLIEINSSPCMAPSTSITSRLTSNV
LEDVFKVVLDRRENKQCDTGQFELLFKQVQITVPPYIGIDLKLAGISIKK
PFLSSTILTERRSSTRPITDSIMIRNAVRKDDRIGIRRKIQDNSLAISTI
VPLKETTTKPTEIKSNILHKRSKTSIVINNDPSKSRKSFLTHNRAPVTSQ
LQKSAKLIITNSTPKDNKDLVKKTNAPIPEFEQDGLDEDRDLITDTVIST
HIIDSTTNESNLNQNNEKHKNQSFPIISKPGMIPKLNTNREYKLPTKVEV
VNFSMAKKMMNSSFKDHASKKKNKQNQQLKKSLNTQLFIQKYALTKSIPS
FNNFHRSFNKNCQYGRSYSLMCDDFGYVFKPKTSVSARVNSKTLKILSKR
EENNSNIILINLTSPVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR004344TTL/TTLL_fam
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 452..681
e-value: 1.1E-56
score: 193.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..330
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 138..164
NoneNo IPR availablePANTHERPTHR45870FAMILY NOT NAMEDcoord: 56..702
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 441..658
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 370..662
e-value: 3.4E-70
score: 236.5
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 317..670
score: 24.688