Thyroglobulin

Overview
NameThyroglobulin
Smed IDSMED30013776
Length (bp)676
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thyroglobulin (SMED30013776) t-SNE clustered cells

Violin plots show distribution of expression levels for Thyroglobulin (SMED30013776) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thyroglobulin (SMED30013776) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thyroglobulin (SMED30013776) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013776

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013776SMESG000017076.1 SmedASXL_013204SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013776SMESG000010286.1 SMESG000017076.1 OX_Smed_1.0.09439ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thyroglobulin vs. Ensembl Human
Match: TG (thyroglobulin [Source:HGNC Symbol;Acc:HGNC:11764])

HSP 1 Score: 61.6178 bits (148), Expect = 2.078e-10
Identity = 33/99 (33.33%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGK------IFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            F P C T G Y  +QC  G+C C    G++L           C    +K   R   ++G       +FV  C S+G + PVQC  S C+CVD++G+ +P
Sbjct:  616 FVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIP 714          
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Match: tg (thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1])

HSP 1 Score: 55.0694 bits (131), Expect = 2.376e-8
Identity = 31/100 (31.00%), Postives = 47/100 (47.00%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGK--------IFV--CNSDGSYAPVQCLGSMCFCVDSDGKQL 616
            + P+C   G Y  +QC+  +C C   D   L  P +    +  +C    +  R++ I  K        +F+  C +DG+Y   QCLG  CFCVD  G +L
Sbjct:  605 YLPQCTEDGLYQDVQCQGSECWCV--DSRGLEVPGSRTTGSRPRCPSQCEKERQMAIAVKASSSAGSEVFIPKCETDGAYVARQCLGKSCFCVDRSGTKL 702          
BLAST of Thyroglobulin vs. Ensembl Xenopus
Match: amd1 (adenosylmethionine decarboxylase 1 [Source:Xenbase;Acc:XB-GENE-484611])

HSP 1 Score: 59.6918 bits (143), Expect = 8.175e-10
Identity = 29/99 (29.29%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGIL------GKIFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            + P C   G YN IQC   +C C    G ++ +         C    +K+ YR+  +        ++F+  C+ +G +  VQC G +CFCVD +G+ +P
Sbjct:  616 YIPACKEDGRYNDIQCSKAECWCVDDQGREIDRTRTQGTHPRCPTKCEKERYRQTAVRESLPPGAELFIPACDLEGHFLTVQCTGKLCFCVDLEGRIIP 714          
BLAST of Thyroglobulin vs. Ensembl Mouse
Match: Tg (thyroglobulin [Source:MGI Symbol;Acc:MGI:98733])

HSP 1 Score: 56.9954 bits (136), Expect = 4.554e-9
Identity = 32/99 (32.32%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQL--TKPIAARYSTNCKCARDKDDYRRLGIL----GKIFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            F P C   G Y  IQC  G+C C    G++L  ++    R     KC + +   + L          FV  C  +G + PVQC  S C+CVD++G+ +P
Sbjct:  616 FVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIP 714          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|F1RRV3|THYG_PIG (Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=5)

HSP 1 Score: 63.1586 bits (152), Expect = 2.787e-10
Identity = 38/115 (33.04%), Postives = 56/115 (48.70%), Query Frame = 2
Query:  305 DLAIAKRDCGGT--GCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGK------IFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            ++A++ + C  T    F P C   G Y  +QC  G+C C    G +L    A      C  A +K   R   +LG+      +FV  C  +G + PVQC  S C+CVD+DG+ +P
Sbjct:  601 EMALSSQGCEQTPGSLFVPSCTAEGSYEDVQCFAGECWCVDARGRELAGSRARGGRPRCPTACEKQRERMQSLLGRQPAGSSVFVPSCTREGHFLPVQCFSSDCYCVDADGQPIP 715          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|P01266|THYG_HUMAN (Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5)

HSP 1 Score: 61.6178 bits (148), Expect = 9.980e-10
Identity = 33/99 (33.33%), Postives = 48/99 (48.48%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGK------IFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            F P C T G Y  +QC  G+C C    G++L           C    +K   R   ++G       +FV  C S+G + PVQC  S C+CVD++G+ +P
Sbjct:  616 FVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIP 714          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|P01267|THYG_BOVIN (Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.957e-9
Identity = 35/115 (30.43%), Postives = 51/115 (44.35%), Query Frame = 2
Query:  305 DLAIAKRDCGGT--GCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGK------IFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            ++  + + CG      F P C   G Y  +QC  G C C    G +L           C    +K   R   +LG       +FV  C S G++ PVQC  S C+CVD++G+ +P
Sbjct:  599 EMVFSSQGCGQAPGSLFVPACTAEGSYEEVQCFAGDCWCVDAQGRELAGSRVRGGRPRCPTECEKQRARMQSLLGSQPAGSSLFVPACTSKGNFLPVQCFNSECYCVDTEGQPIP 713          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|P06882|THYG_RAT (Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg PE=1 SV=4)

HSP 1 Score: 58.9214 bits (141), Expect = 7.374e-9
Identity = 32/99 (32.32%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNC--KCARDKDDYRRLG---ILGKIF---VCNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            F P C   G Y  IQC  G+C C    G+++     +     C  KC + +   + L      G  F    C S+G + PVQC  S C+CVD++G+ +P
Sbjct:  616 FVPSCTAEGSYEDIQCYAGECWCVNSQGKEVEGSRVSGGHPRCPTKCEKQRAQMQNLAGAQPAGSSFFVPTCTSEGYFLPVQCFNSECYCVDAEGQVIP 714          
BLAST of Thyroglobulin vs. UniProt/SwissProt
Match: sp|O08710|THYG_MOUSE (Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 3.185e-8
Identity = 32/99 (32.32%), Postives = 47/99 (47.47%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQL--TKPIAARYSTNCKCARDKDDYRRLGIL----GKIFV--CNSDGSYAPVQCLGSMCFCVDSDGKQLP 619
            F P C   G Y  IQC  G+C C    G++L  ++    R     KC + +   + L          FV  C  +G + PVQC  S C+CVD++G+ +P
Sbjct:  616 FVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIP 714          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A1S3J5E7 (equistatin-like OS=Lingula unguis OX=7574 GN=LOC106170269 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.864e-20
Identity = 45/112 (40.18%), Postives = 66/112 (58.93%), Query Frame = 2
Query:  341 GCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARY----STNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            G   P CD  G Y+A QCK   C C  +DG++L    +AR+       C CARD+D+Y++ G++GK+++C  +G+Y   QC GS+C+CVD  G +L   P V I+    L C
Sbjct:   22 GATPPTCDADGTYSAKQCKEASCFCVNKDGDRLGD-YSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICKENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 132          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A210PY59 (Thyroglobulin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02202 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.795e-19
Identity = 56/160 (35.00%), Postives = 80/160 (50.00%), Query Frame = 2
Query:  188 ISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGG--TGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTK--PIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNL 655
            I++  +LL   IAF            +   DE + I      IA +  G    G   PRC   G Y   QC+   C C    G ++T+   I   Y ++C CARD+ DY  L I+GK+F C   GSY P+QC GS+C+CVD  G+Q+ +  A   ++D+L
Sbjct:    3 IAMLVLLLVIDIAFASVPPP------MSCRDELAAIEAEVALIAAKHNGMPPVGTVKPRCLEDGTYAPRQCRGSVCRCVSAQGTRITEDFSIGLAYQSDCSCARDEHDYSLLQIMGKMFFCTPIGSYHPIQCTGSVCYCVDKKGQQIGQETAHIGSQDSL 156          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A1S3IF36 (uncharacterized protein LOC106163748 OS=Lingula unguis OX=7574 GN=LOC106163748 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.793e-19
Identity = 44/108 (40.74%), Postives = 65/108 (60.19%), Query Frame = 2
Query:  353 PRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARY----STNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            P CD  G Y+A QC    C C  +DG++L    +AR+       C CARD+D+Y++ G++GK+++CN +G+Y   QC GS+C+CVD  G +L   P V I+    L C
Sbjct:  124 PTCDADGTYSAKQCIEASCFCVNKDGDRLGD-YSARFWEAKDMTCNCARDEDEYQKKGLIGKMYICNENGNYEKYQCTGSVCYCVDEKGSKLESTPPVSISAVKTLNC 230          
BLAST of Thyroglobulin vs. TrEMBL
Match: A0A194AKI3 (Uncharacterized protein OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 3.013e-18
Identity = 41/107 (38.32%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  353 PRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTN---CKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            P CD  GYY   QC+  +C+C  ++G++++   A  +      C+CARD+ +Y   G++GK F C SDGSY   QC G +CFC D++G ++   P+V I++   L C
Sbjct:  130 PSCDGEGYYQPKQCQGSQCYCVSKNGKEISGYTANVWEAQQMTCQCARDQAEYMASGLIGKFFYCTSDGSYQTYQCQGDVCFCADTNGVKMDHSPSVHISQVTKLNC 236          
BLAST of Thyroglobulin vs. TrEMBL
Match: V4AXA0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238761 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 7.802e-18
Identity = 44/111 (39.64%), Postives = 69/111 (62.16%), Query Frame = 2
Query:  302 RDLAIAKRDCGGT--GCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPI--AARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPE 622
            R + + ++  GG   G   P+CD+ G Y+A+QC   +CHC    G+ L  P+        +CKCARD+D Y + G++GK+F C  +G+Y   QC+GS+C+C DS+GKQ+ +
Sbjct:  108 RKVFLDQKQNGGILLGAEEPKCDSDGTYSAVQCIGSQCHCTSAGGKNLGYPVNRGLTQGMDCKCARDQDTYAKTGLIGKLFYCGPNGNYRNYQCVGSVCWCKDSNGKQVGQ 218          
BLAST of Thyroglobulin vs. Ensembl Cavefish
Match: tg (thyroglobulin [Source:NCBI gene;Acc:103037495])

HSP 1 Score: 57.3806 bits (137), Expect = 2.968e-9
Identity = 28/95 (29.47%), Postives = 46/95 (48.42%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILG------KIFV--CNSDGSYAPVQCLGSMCFCVDSDG 607
            + P+C   G Y A+QC+  +C CA   G+++    +  Y   C    +K+    + +        ++F+  C  DG Y  +QCLG  CFC+D  G
Sbjct:  625 YLPQCTEDGQYQAVQCQGSECWCADSQGQEVMGSRSIGYRPRCPSRCEKERMMAIAVKASSSAGSEVFIPKCEEDGEYVSLQCLGKSCFCLDQRG 719          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40373 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C4])

HSP 1 Score: 54.6842 bits (130), Expect = 1.868e-9
Identity = 38/127 (29.92%), Postives = 59/127 (46.46%), Query Frame = 2
Query:  299 KRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQC--KYGKCHCAGRDGEQLT------KPIAARYSTNCKCARDKDDYRRLGILGK------IFVCNSDGSYAPVQCLGSM--CFCVDSDGKQLPEPPA 631
            +R +AI        G F P+C + G Y+ +QC    G C C   DG ++       +P+    +   +C +++   R +G+LG       +  C S G Y  VQC  S   C+CVD  G++LP   A
Sbjct:   61 ERQIAIGWTGVAAPGSFVPKCKSSGDYDTVQCHGSTGFCWCVDDDGNEIPATRVRGRPMCGLLAGLSQCQQERQ--RHMGVLGIAPPGRFVPACTSTGQYERVQCHSSTGYCWCVDKFGRELPNTRA 185          

HSP 2 Score: 44.2838 bits (103), Expect = 8.597e-6
Identity = 36/109 (33.03%), Postives = 45/109 (41.28%), Query Frame = 2
Query:  338 TGCFFPRCDTHGYYNAIQCK--YGKCHCAGRDGEQL--TKPIAARYSTNCKCARDKDDYRRLGILGKIFV---------CNSDGSYAPVQCLGS--MCFCVDSDGKQLP 619
            TG + P C   G Y ++QC    G C C  R G +L  T+    R     K         R   +G   V         C S G Y  VQC GS   C+CVD DG ++P
Sbjct:    2 TGLWVPDCRPDGSYESVQCHALSGYCWCVDRSGHELFGTRVRGKRTCDKIKAGLTMCQKERQIAIGWTGVAAPGSFVPKCKSSGDYDTVQCHGSTGFCWCVDDDGNEIP 110          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40365 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B6])

HSP 1 Score: 53.1434 bits (126), Expect = 1.054e-8
Identity = 45/129 (34.88%), Postives = 62/129 (48.06%), Query Frame = 2
Query:  284 CSTICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCK--YGKCHCAGRDGEQL------TKPIAARYSTNCKCARDKDDYRRLGILG----KIFV--CNSDGSYAPVQC--LGSMCFCVDSDGKQLPE 622
            C T   R LA   R    T  F PRC   G + AIQC+   GKC C   +G +L      +KP+    +   +C R++   R LG  G      FV  C +DG Y  VQC  +   C+CVD +G ++P+
Sbjct:   82 CHTDRMRALAWTGRLIINT--FVPRCLPDGSFEAIQCQPATGKCWCVDVNGNELVGTRTDSKPVCTSRAGLSECQRERQ--RVLGWSGVAVDGTFVPECTADGGYERVQCHEVTGFCWCVDGNGNEIPK 206          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C3])

HSP 1 Score: 51.2174 bits (121), Expect = 3.295e-8
Identity = 38/108 (35.19%), Postives = 54/108 (50.00%), Query Frame = 2
Query:  347 FFPRCDTHGYYNAIQC--KYGKCHCAGRDGEQL-------TKPIAAR-YSTNCKCARDKDDYRRLGILG----KIFV--CNSDGSYAPVQC--LGSMCFCVDSDGKQL 616
            + PRCD  G Y  +QC    G C C  +DG ++        +P+  + Y+T C    +++ YR LG  G     ++V  C  DGSY  VQC  L   C+CVD  G +L
Sbjct:   74 YVPRCDASGGYEPVQCLSTTGHCWCVDKDGIEIRGTRRRGVRPVCKQGYNTPC----ERERYRALGWTGLRVTGLWVPDCRPDGSYESVQCHALSGYCWCVDRSGHEL 177          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO38469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV6])

HSP 1 Score: 50.0618 bits (118), Expect = 1.091e-7
Identity = 39/122 (31.97%), Postives = 53/122 (43.44%), Query Frame = 2
Query:  290 TICKRDL--AIAKRDCGGTGCFFPRCDTHGYYNAIQC--KYGKCHCAGRDGEQLTKPIAARYSTNC------KCARDKDDYRRLGILGKIF-VCNSDGSYAPVQCLGS--MCFCVDSDGKQL 616
            T+C+  L  A+        G F P C + G +  +QC    G C CA  D  Q       R   +C      KC R   D      +G+    C  DG+Y  +QC GS   C+CVD+DG +L
Sbjct:   55 TVCQSQLEAALGPDGIASPGRFVPLCTSEGKFADVQCHGSTGYCWCAHPDNGQEVTGTRQRGQPDCSDVALSKCQRHYRDNLIYPPIGRFLPTCKPDGNYEKMQCHGSTGFCWCVDADGAEL 176          
BLAST of Thyroglobulin vs. Ensembl Nematostella
Match: EDO40371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C2])

HSP 1 Score: 48.9062 bits (115), Expect = 2.144e-7
Identity = 38/123 (30.89%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  290 TICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCK--YGKCHCAGRDGEQLTKPIAARYSTNCKCAR----DKDDYRRLGILGKIFV------CNSDGSYAPVQCLGS--MCFCVDSDGKQL 616
            T C+  +  A +       F PRC   G Y  +QC+   G+C C    G +L    +    T  K        +D  + L   G++ V      C SDGSY P+QC  S   C+CVD  G +L
Sbjct:   59 TPCRAQVEQALKTPASLDRFVPRCTLDGAYEDVQCQESTGECWCVDAQGSELDGTRSTELVTCHKHMSPSVCQQDRMQALAWSGRLVVGAFIPRCRSDGSYDPIQCHESPGQCWCVDVHGNEL 181          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000017076.1 (SMESG000017076.1)

HSP 1 Score: 307.76 bits (787), Expect = 5.813e-108
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 2
Query:  179 MNPISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKCP 667
            MNPISICAVLLWAGIAFGCEESSECKSSEVCWSDECSTICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKCP
Sbjct:    1 MNPISICAVLLWAGIAFGCEESSECKSSEVCWSDECSTICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKCP 163          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000017073.1 (SMESG000017073.1)

HSP 1 Score: 238.81 bits (608), Expect = 1.085e-80
Identity = 130/162 (80.25%), Postives = 139/162 (85.80%), Query Frame = 2
Query:  179 MNPISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGGTGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            MNPISICAVLLWAGIAFGCEESSECKSSEVCWS +CSTICKRD+ IAKR C   GC  P+CDTHGYYN  Q KYG C+CAGRDGE+LTK +    + NCKCARDKDDYRRLGI+GK FVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAV IT  + LKC
Sbjct:    1 MNPISICAVLLWAGIAFGCEESSECKSSEVCWSGDCSTICKRDIVIAKRKCSFMGCVTPQCDTHGYYNVTQYKYGTCYCAGRDGEKLTKILDDCRNANCKCARDKDDYRRLGIVGKTFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVYITNQHELKC 162          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000017143.1 (SMESG000017143.1)

HSP 1 Score: 106.301 bits (264), Expect = 9.988e-29
Identity = 63/163 (38.65%), Postives = 87/163 (53.37%), Query Frame = 2
Query:  179 MNPISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGG-TGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            MN I IC  L     + GCE+S  CK    C    C+T C  +    K  C G   C  P CD+ G Y  IQC+   C C   DG++LT+      S++CKCA +K  +  L ILG  F C  +G Y P+QC+ S CFCVD +G+++ +  +V I+  +LL C
Sbjct:    1 MNAIIICVCLFLVQASLGCEDSVNCKYPRFCKGGRCTTTCLENKRKEKLRCRGRVDCDIPNCDSDGLYKPIQCQSDMCACYSSDGKRLTESFMPEESSDCKCAMNKFYFETLQILGLPFKCQKNGDYEPIQCVDSECFCVDENGRRVEKIESVEISHKDLLHC 163          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000017141.1 (SMESG000017141.1)

HSP 1 Score: 104.76 bits (260), Expect = 3.767e-28
Identity = 63/163 (38.65%), Postives = 89/163 (54.60%), Query Frame = 2
Query:  179 MNPISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGG-TGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            MN I IC  L     + GCE+S +CK    C    C+T C  +    K  CG   GC  P CD+ G Y +IQC    C C   DG++LT+P     S++CKCA +K  + +L +LG  F C  +G Y P+QC+ S CFCVD +G ++    ++ I+  +LL C
Sbjct:    1 MNAIIICVCLFLVQASLGCEDSIDCKYPRFCQGGRCTTTCLENKRKEKLRCGKRVGCPIPGCDSDGLYKSIQCPIHMCACYSGDGKRLTEPFIRGKSSDCKCAMNKFLFDKLQLLGLPFKCQKNGDYEPIQCVDSECFCVDENGLRVENMESIGISHKDLLHC 163          
BLAST of Thyroglobulin vs. Planmine SMEST
Match: SMESG000017140.1 (SMESG000017140.1)

HSP 1 Score: 104.76 bits (260), Expect = 4.061e-28
Identity = 61/163 (37.42%), Postives = 87/163 (53.37%), Query Frame = 2
Query:  179 MNPISICAVLLWAGIAFGXXXXXXXXXXXVCWSDECSTICKRDLAIAKRDCGG-TGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCKCARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPPAVPITKDNLLKC 664
            MN I IC  L     + GCE+S +C+    C    C+T C  +   AK  CG    C  P CD  G Y+ +QC Y  C C+ RDG+QLTKP     S+NC+CA  K ++         + C  +G++ P+QC G  CFCVD +G+ + +  +VP+   + LKC
Sbjct:    1 MNAIIICIFLFLVQASLGCEDSIDCRYPMFCQGGRCTTRCFEEAKRAKAQCGKRVECPIPDCDAFGNYSPVQCLYHMCFCSSRDGKQLTKPFIPHDSSNCRCAVIKYEFAHNNNPEVKYACQENGNFKPLQCEGGNCFCVDLNGRVIKDKKSVPVLDKDTLKC 163          
The following BLAST results are available for this feature:
BLAST of Thyroglobulin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TG2.078e-1033.33thyroglobulin [Source:HGNC Symbol;Acc:HGNC:11764][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tg2.376e-831.00thyroglobulin [Source:ZFIN;Acc:ZDB-GENE-030519-1][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
amd18.175e-1029.29adenosylmethionine decarboxylase 1 [Source:Xenbase... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tg4.554e-932.32thyroglobulin [Source:MGI Symbol;Acc:MGI:98733][more]
back to top
BLAST of Thyroglobulin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1RRV3|THYG_PIG2.787e-1033.04Thyroglobulin OS=Sus scrofa OX=9823 GN=TG PE=1 SV=... [more]
sp|P01266|THYG_HUMAN9.980e-1033.33Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 S... [more]
sp|P01267|THYG_BOVIN1.957e-930.43Thyroglobulin OS=Bos taurus OX=9913 GN=TG PE=1 SV=... [more]
sp|P06882|THYG_RAT7.374e-932.32Thyroglobulin OS=Rattus norvegicus OX=10116 GN=Tg ... [more]
sp|O08710|THYG_MOUSE3.185e-832.32Thyroglobulin OS=Mus musculus OX=10090 GN=Tg PE=1 ... [more]
back to top
BLAST of Thyroglobulin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J5E73.864e-2040.18equistatin-like OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A210PY594.795e-1935.00Thyroglobulin OS=Mizuhopecten yessoensis OX=6573 G... [more]
A0A1S3IF366.793e-1940.74uncharacterized protein LOC106163748 OS=Lingula un... [more]
A0A194AKI33.013e-1838.32Uncharacterized protein OS=Pinctada fucata OX=5042... [more]
V4AXA07.802e-1839.64Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tg2.968e-929.47thyroglobulin [Source:NCBI gene;Acc:103037495][more]
back to top
BLAST of Thyroglobulin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403731.868e-929.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403651.054e-834.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403723.295e-835.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384691.091e-731.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403712.144e-730.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thyroglobulin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thyroglobulin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017076.15.813e-108100.00SMESG000017076.1[more]
SMESG000017073.11.085e-8080.25SMESG000017073.1[more]
SMESG000017143.19.988e-2938.65SMESG000017143.1[more]
SMESG000017141.13.767e-2838.65SMESG000017141.1[more]
SMESG000017140.14.061e-2837.42SMESG000017140.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013776 ID=SMED30013776|Name=Thyroglobulin|organism=Schmidtea mediterranea sexual|type=transcript|length=676bp
TTTGAATTTATATTTTATAATGAAAATCTTTAATCATTTTTTCATAAACA
AAATGATTTTTAAATCTCAAAATTATAGTTTCCGTATGAGAATAAAGGGT
TGTTAGAATATTCGTATTTCAAATGCTAGATTCTGTATATTTGATTACAT
CTCTTCAAGATCTGATCAGAATTGAAATATGAATCCAATATCAATTTGTG
CCGTGCTGCTTTGGGCAGGGATTGCATTCGGATGCGAAGAATCATCAGAG
TGTAAATCGTCAGAGGTTTGCTGGTCCGATGAATGTTCCACCATTTGTAA
GCGAGATCTCGCAATAGCAAAACGCGATTGTGGTGGTACTGGATGCTTCT
TCCCTCGGTGCGATACCCACGGGTATTACAACGCAATTCAATGCAAGTAC
GGAAAATGTCACTGTGCAGGAAGAGATGGAGAGCAACTTACAAAACCAAT
CGCTGCCAGATATAGCACAAATTGCAAATGTGCAAGGGACAAGGATGACT
ATAGGCGACTTGGTATTCTTGGAAAGATATTCGTTTGTAACAGCGATGGA
AGCTATGCACCAGTTCAATGCTTGGGATCAATGTGCTTTTGTGTTGATTC
GGACGGAAAGCAACTTCCTGAACCACCTGCAGTCCCCATAACAAAGGATA
ATCTGCTGAAATGTCCTTAAATAATA
back to top

protein sequence of SMED30013776-orf-1

>SMED30013776-orf-1 ID=SMED30013776-orf-1|Name=SMED30013776-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MNPISICAVLLWAGIAFGCEESSECKSSEVCWSDECSTICKRDLAIAKRD
CGGTGCFFPRCDTHGYYNAIQCKYGKCHCAGRDGEQLTKPIAARYSTNCK
CARDKDDYRRLGILGKIFVCNSDGSYAPVQCLGSMCFCVDSDGKQLPEPP
AVPITKDNLLKCP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0006590thyroid hormone generation
GO:0015705iodide transport
GO:0030878thyroid gland development
GO:0031641regulation of myelination
GO:0042403thyroid hormone metabolic process
GO:0042446hormone biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0042802identical protein binding
GO:0005179hormone activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036857Thyroglobulin_1_sf
IPR000716Thyroglobulin_1
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000716Thyroglobulin type-1SMARTSM00211TY_2coord: 117..162
e-value: 0.019
score: 19.8
coord: 58..103
e-value: 0.13
score: 12.6
IPR000716Thyroglobulin type-1PFAMPF00086Thyroglobulin_1coord: 120..150
e-value: 5.9E-9
score: 35.5
coord: 54..94
e-value: 5.2E-6
score: 26.0
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 37..99
score: 7.922
IPR000716Thyroglobulin type-1PROSITEPS51162THYROGLOBULIN_1_2coord: 100..162
score: 7.151
IPR036857Thyroglobulin type-1 superfamilyGENE3DG3DSA:4.10.800.10coord: 37..99
e-value: 2.8E-5
score: 25.3
coord: 100..153
e-value: 1.8E-9
score: 38.8
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 28..102
IPR036857Thyroglobulin type-1 superfamilySUPERFAMILYSSF57610Thyroglobulin type-1 domaincoord: 120..155
NoneNo IPR availablePANTHERPTHR12352SECRETED MODULAR CALCIUM-BINDING PROTEINcoord: 120..162
NoneNo IPR availablePANTHERPTHR12352:SF28FI05255Pcoord: 120..162
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.784