JmjC domain-containing protein

Overview
NameJmjC domain-containing protein
Smed IDSMED30013770
Length (bp)1499
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of JmjC domain-containing protein (SMED30013770) t-SNE clustered cells

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30013770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of JmjC domain-containing protein (SMED30013770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for JmjC domain-containing protein (SMED30013770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30013770SMESG000028946.1 dd_Smed_v4_14490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013770SMESG000028946.1 dd_Smed_v4_14490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
eyeSMED30013770SMESG000028946.1 Contig55456newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30013770SMESG000028946.1 Contig55456uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013770SMESG000028946.1 Contig55456newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013770SMESG000028946.1 Contig55456uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013770SMESG000028946.1 Contig11448newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013770SMESG000028946.1 Contig11448uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30013770SMESG000028946.1 OX_Smed_1.0.16641ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 52.373 bits (124), Expect = 1.324e-6
Identity = 54/225 (24.00%), Postives = 98/225 (43.56%), Query Frame = 1
Query:  355 FFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKL---QDI-YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            F  ++++   P+I+KG  D   P    W+ E ++++ G     + V  R+     + T +T+  F+  Y +   +D+ Y+A       IPE L  +I+ P + + G  E   +    W    GT S LH            GRK   L   +   +    + H       S++D E  ++ +  + A  P++   +  G+ +FIP  Y H VR+    LS+++ F
Sbjct:  195 FREQFLVPGRPVILKGVAD-HWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLL--HNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRAL--DLSFSVSF 413          
BLAST of JmjC domain-containing protein vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 52.373 bits (124), Expect = 1.395e-6
Identity = 54/225 (24.00%), Postives = 98/225 (43.56%), Query Frame = 1
Query:  355 FFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKL---QDI-YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            F  ++++   P+I+KG  D   P    W+ E ++++ G     + V  R+     + T +T+  F+  Y +   +D+ Y+A       IPE L  +I+ P + + G  E   +    W    GT S LH            GRK   L   +   +    + H       S++D E  ++ +  + A  P++   +  G+ +FIP  Y H VR+    LS+++ F
Sbjct:  233 FREQFLVPGRPVILKGVAD-HWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLL--HNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRAL--DLSFSVSF 451          
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Match: Kdm8 (lysine (K)-specific demethylase 8 [Source:MGI Symbol;Acc:MGI:1924285])

HSP 1 Score: 51.9878 bits (123), Expect = 9.881e-7
Identity = 54/229 (23.58%), Postives = 99/229 (43.23%), Query Frame = 1
Query:  346 PKDFFTK-YVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDI----YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            P  +F + +++   P+I++G  D   P    W+ + ++++ G     + V  R+     + T +T++ F+  + L +     Y+A       IPE L  +I+ P +   G  E   +    W    GT S LH            GRK   L   +  ++    E H       S++D E  ++ +  +    P++   +  GD +FIP+ Y H VRS    LS+++ F
Sbjct:  189 PLQYFKQHFLVPGRPVILEGVAD-HWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPE-LKRDISIPDYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHIL--HNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSL--DLSFSVSF 411          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q497B8|KDM8_RAT (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Rattus norvegicus OX=10116 GN=Kdm8 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 5.648e-6
Identity = 57/237 (24.05%), Postives = 100/237 (42.19%), Query Frame = 1
Query:  322 EMTKSVIQPKDFFTK-YVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDI----YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            E+ +    P   F K +++   P+I++G  D   P    W+ + ++++ G     + V  R+     + T +T+  F+  Y L +     Y+A       IPE L  +I+ P +   G  E   +    W    GT S LH            GRK   L   +  ++    E H       S++D E  ++ +  +    P++   +  GD +FIP+ Y H VRS    LS+++ F
Sbjct:  181 EVPRLRCPPLQHFKKHFLVPGRPVILEGVAD-HWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTLMTVNEFIHKYILSEAKDVGYLAQHQLFDQIPE-LKQDISIPDYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHIL--HNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSL--DLSFSVSF 411          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N371|KDM8_HUMAN (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 6.357e-6
Identity = 54/225 (24.00%), Postives = 98/225 (43.56%), Query Frame = 1
Query:  355 FFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKL---QDI-YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            F  ++++   P+I+KG  D   P    W+ E ++++ G     + V  R+     + T +T+  F+  Y +   +D+ Y+A       IPE L  +I+ P + + G  E   +    W    GT S LH            GRK   L   +   +    + H       S++D E  ++ +  + A  P++   +  G+ +FIP  Y H VR+    LS+++ F
Sbjct:  195 FREQFLVPGRPVILKGVAD-HWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPE-LKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLL--HNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRAL--DLSFSVSF 413          
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CXT6|KDM8_MOUSE (Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.912e-6
Identity = 54/229 (23.58%), Postives = 99/229 (43.23%), Query Frame = 1
Query:  346 PKDFFTK-YVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDI----YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF 996
            P  +F + +++   P+I++G  D   P    W+ + ++++ G     + V  R+     + T +T++ F+  + L +     Y+A       IPE L  +I+ P +   G  E   +    W    GT S LH            GRK   L   +  ++    E H       S++D E  ++ +  +    P++   +  GD +FIP+ Y H VRS    LS+++ F
Sbjct:  189 PLQYFKQHFLVPGRPVILEGVAD-HWPCMKKWSLQYIQEIAGCRTVPVEVGSRYTDEDWSQTLMTVDEFIQKFILSEAKDVGYLAQHQLFDQIPE-LKRDISIPDYCCLGNGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHIL--HNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSL--DLSFSVSF 411          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A5H2VAN0 (Jumonji C domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 GN=DjHRJDa PE=2 SV=1)

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 341/408 (83.58%), Postives = 376/408 (92.16%), Query Frame = 1
Query:  169 IEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDN-LSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHDEL 1389
            IEEGDKT+LYFVKDDGMN KFPPK++RS++DQIP+GHLR LG+QR AEGPV+  K+ +QP++FFTKYVLKN PL+++ AID KQPIRV WNDERLKK+HGKSK+WVIKRHEKSSK PTK+TLERFL+FYKLQDIY+ASTIPEE +SEI YPKFM CGPI NSLVEAELWMAYGGTGSLLHYHGDHQ+HCMADGRKDFIL+ENKHKKSFKMVEKHPFTGEGYSELDTEM+NMF+EKQI+ IPWIYATI AGDC+FIP+GYIHQVRSYGRSLSY IQFAS HNK+ TKCDN SE D D+ L  HDFIYTERDGIEQLKNTKLTDEDLRNIL+KLIRTA+ILP+ERFQYFYN AIGKV QKMPSAQVVFNNID K DGF+TLEQI  LPGNQLNKISKILNSIHK+RHDEL
Sbjct:    1 IEEGDKTDLYFVKDDGMNAKFPPKITRSIHDQIPVGHLRSLGFQRIAEGPVDTMKTFLQPENFFTKYVLKNNPLVVRNAIDEKQPIRVTWNDERLKKIHGKSKVWVIKRHEKSSKAPTKVTLERFLEFYKLQDIYLASTIPEEFMSEITYPKFMKCGPIVNSLVEAELWMAYGGTGSLLHYHGDHQIHCMADGRKDFILMENKHKKSFKMVEKHPFTGEGYSELDTEMVNMFQEKQISGIPWIYATILAGDCLFIPAGYIHQVRSYGRSLSYTIQFASTHNKATTKCDNLSENDNDDTLMNHDFIYTERDGIEQLKNTKLTDEDLRNILIKLIRTATILPFERFQYFYNIAIGKVKQKMPSAQVVFNNIDLKRDGFITLEQIQKLPGNQLNKISKILNSIHKSRHDEL 408          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A267DWQ0 (JmjC domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007632g1 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.745e-115
Identity = 180/418 (43.06%), Postives = 255/418 (61.00%), Query Frame = 1
Query:  145 VLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKV--NQKMPSAQVVFNN-IDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHDEL 1389
            VL         G+K  L F KD  M+T FPP + +  + ++P GHLR LGYQRHA+GPV++   +  P +F+ +YVL+  PL+++ AID   P+   W DE LK+  G+ K+ V  + E        +TLERFLD YK QD+Y+AS IP E+ +    P    CGP+   + EAE+WM+ GGTGSLLHYH +HQ+HCMADGRKDFILIE+K+K + K VE+ P +G G S +D +M+NMF+   +   PW Y T+  GDC+FIP+G++HQVRSYGRSLSY   F  + +K++  C   S K    L Q D ++T +DG  QLKN KL  + LR++L+  +     L +  FQ  Y  A+ K   + +   A+  F   +  +    +T + ++ LP   L+K++  LNSIHKT  DEL
Sbjct:   32 VLLLLVAEFSNGEKHPL-FEKDHAMDTVFPPVIWK--HPELPAGHLRSLGYQRHADGPVKVASRLPSPVEFYAEYVLRLKPLVLRDAIDKSSPMMDRWTDEYLKRHFGQHKVTVTHKKEIIKGQVEVMTLERFLDRYKFQDLYMASLIPAEMEAGFTVPHVAQCGPVSRHITEAEMWMSSGGTGSLLHYHSEHQLHCMADGRKDFILIEHKYKDNLKCVEQPPGSGNGASTIDVDMVNMFDSPDVEKTPWRYTTLLPGDCLFIPAGHLHQVRSYGRSLSYTFLFRPVEDKNLGDCRALS-KAVRGLDQFDLVWTIKDGYSQLKNEKLDADSLRSVLLSWVGKDGGLTFPVFQRNYEKAVAKAAGDSRSIGAKRAFQQLLQSEKKQVLTKDALMKLPAKTLDKLALFLNSIHKTVRDEL 445          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A1I8FX82 (JmjC domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.360e-101
Identity = 167/405 (41.23%), Postives = 245/405 (60.49%), Query Frame = 1
Query:  178 GDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKV--NQKMPSAQVVFNN-IDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHD 1383
            G+K  L F KD  M+T FPP + +  + ++P GHLR LGYQRHA+GPV++   +  P +F+ +YVL+  PL+++ AID   P+   W DE LK+  G+ K+ V  + E              +   +++D+Y+AS IP E+ +    P    CGP+   + EAE+WM+ GGTGSLLHYH +HQ+HCMADGRKDFILIE+K+K + K VE+ P +G G S +D +M+NMF+   +   PW Y T+  GDC+FIP+G++HQVRSYGRSLSY   F  + +K++  C   S K    L Q D ++T +DG  QLKN KL  + LR++L+  +     L +  FQ  Y  A+ K   + +   A+  F   +  +    +T + ++ LP   L+K++  LNSIHKT HD
Sbjct:   92 GEKHPL-FEKDHAMDTVFPPVIWK--HPELPAGHLRSLGYQRHADGPVKVASRLPSPVEFYAEYVLRLKPLVLRDAIDKSSPMMDRWTDEYLKRHFGQHKVTVTHKKE--------------IIKGQVEDLYMASLIPAEMEAGFTVPHVAQCGPVSRHITEAEMWMSSGGTGSLLHYHSEHQLHCMADGRKDFILIEHKYKDNLKCVEQPPGSGNGASTIDVDMVNMFDSPDVEKTPWRYTTLLPGDCLFIPAGHLHQVRSYGRSLSYTFLFRPVEDKNLGDCRALS-KAVRGLDQFDLVWTIKDGYSQLKNEKLDADSLRSVLLSWVGKDGGLTFPVFQRNYEKAVAKAAGDSRSIGAKRAFQQLLQSEKKQVLTKDALMKLPAKTLDKLALFLNSIHKTIHD 478          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: A0A1S3H325 (uncharacterized protein LOC106151697 OS=Lingula unguis OX=7574 GN=LOC106151697 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 1.094e-88
Identity = 150/391 (38.36%), Postives = 239/391 (61.13%), Query Frame = 1
Query:  199 FVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWN----DERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILN 1359
            F+KD GMN  FPP + R     IP GHLR LG+QR  +G VE  + ++ P++F+  +V +  P++ + AI    P    W     D+ L   +G   + V  + E   K P K+ L +FL  Y  ++ Y+++T P++++ E+  PK + CG     L E+ELWM+ GGT S+LHYH DH +HC+  GRKDFILI  +HK++F+MVE    +G GYS++D +M+N+F+  +I  +PW Y+T++ GDCI++P+G++HQVRSYGRS+SY I +A +   S + C+   ++D   LS+  F +    G +QL N +L  E LR+ L+ L+R  S L YER+  FY   + +++   P A  VF  ++     ++T +++L +  ++L K++ ILN
Sbjct:   27 FIKDQGMNVVFPPLVKRHG-SGIPEGHLRPLGHQRSPDGQVEQ-EMMLTPQEFYDMHVHRGEPVVFRKAI-MDIPALTKWGQDDEDKYLNDKYGDLDVLVTVKKEVFKKGPKKMKLSQFLSDYMYENWYLSTTAPQQMMQELVLPKCLQCGTFRKYLQESELWMSSGGTTSMLHYHADHNLHCVVTGRKDFILIHPEHKETFEMVEHPAHSGHGYSKIDMDMVNVFKHPEITQVPWTYSTLKPGDCIYVPAGHLHQVRSYGRSISYTILWAPVPQFSASDCEGKPDRDIP-LSEVTFTWAYFAGDKQLSNARLNSESLRHHLLALLRMDSALSYERWAAFYEEVMAQMDD-FPDADEVFQILNSSDKSYLTRKELLEMEKSKLQKVANILN 412          
BLAST of JmjC domain-containing protein vs. TrEMBL
Match: C3YD71 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_121824 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.619e-86
Identity = 145/422 (34.36%), Postives = 240/422 (56.87%), Query Frame = 1
Query:  145 VLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWN-DERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKT------RHDEL 1389
             +F++ +++   D   ++F KD   + +FPP + RS    +P GHLR LGYQ+  E  V+  + ++ P++F+ ++V   +PL+ + A+  K P    W  D+ +++ +G   + + K+ E     P ++ L+ FLD Y+ +D Y+ S +P+ +  E+  P+ + CG  +  ++E+ LW++ GGT S+LHY  DH +HC+  GRKDFI+I  K+     + EK  F+G GYS ++ +MIN+F    IA IPW++AT+  GDCIFIPSGY  QVRSYGRS++  I ++ L     + C +     Y  LSQ + ++T + G + L       E  R  L+ L++    L  E F+YFY   +G      P A+ +F  +D K  GFV++E+I ++  + L  +++ L+S H         HDEL
Sbjct:    8 AIFFAVLSLSASD---IHFPKDMRTDVQFPPIVKRS-DSGLPDGHLRPLGYQKKPEARVKEYQELLAPREFWEQHVQHRVPLVYRQAV-VKAPAFTKWQTDDYIREKYGDLDVLIEKKVESRDAQPQQMPLKEFLDSYEYEDWYVVSLLPDPMREEMMVPRSLLCGTFQQHILESNLWISAGGTSSVLHYDADHNLHCLLSGRKDFIMIHPKYADQLDLEEKRKFSGSGYSTMNMDMINIFTNPHIAKIPWMWATLRPGDCIFIPSGYFQQVRSYGRSMAGTIMWSPLPEFDDSDCASTDIDQYTPLSQVNMMWTYKKGDKVLAMRHTDPEVFRAGLLTLLKDRDRLRPEHFEYFYEDLMGD-KADAPRAREIFGLLDQKKKGFVSMEEIKDMDVSVLKNVARHLDSPHGPVKDHDHSHDEL 423          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO30444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0R7])

HSP 1 Score: 215.312 bits (547), Expect = 1.931e-65
Identity = 123/359 (34.26%), Postives = 195/359 (54.32%), Query Frame = 1
Query:  274 GHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWV-IKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQF-ASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASI--LPYERFQYFYNTAI-----GKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLP 1323
            GHLR  GYQ+   GPV     V++P++F+ K+V +N+PL+ +  +  + P    W DE LK+ +G   + +  KR  ++     ++ L  F+D Y+  D+Y+ + +P+ +L+E+  P  + CG     L E  LW+  GGT S++HY  DH +HCM  GRKDFI+I  K K+  K+  K P  G G+S ++ + IN+     I+ + W YATI  GDCIF+PSGYIHQVRSYGRS+S  + F AS+ N        N   +Y  LS+    +T + G + +       E+ R+ +++ +    +  L  + FQ F +         +   K    ++    +D +  GFVT+E I N+P
Sbjct:    1 GHLRPFGYQKPPNGPVIEYDYVLRPQEFWEKHVHENLPLVFRHGV-AESPAIANWKDEYLKEKYGDLDVLIEGKRENRTHGKTQRMLLGDFIDRYRKDDLYVVTVMPDPMLAEVQVPPAIMCGTFAKFLHETNLWIGSGGTRSVIHYDADHNIHCMMAGRKDFIMIHQKFKQQLKL-GKFPQFGSGFSMVNPDEINLDLYPNISDVEWTYATINDGDCIFLPSGYIHQVRSYGRSISATMLFTASVDNTFEADGCENETFEYKPLSEMRVHWTYKKGDKVVPMGYQNVENFRHNIIRQMGEVGVTQLTADLFQRFIDETFELEEDDERKLKRDPVKLFAKYLDKEKKGFVTVEDIKNVP 357          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO37253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD8])

HSP 1 Score: 161.77 bits (408), Expect = 7.385e-45
Identity = 108/363 (29.75%), Postives = 180/363 (49.59%), Query Frame = 1
Query:  268 PIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIK-RHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEG-YSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYG-RSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDL-RNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKI 1344
            P GHL+ LG  R AEG V+       P +FF  YV+   PL+ KGA     P   +W DE L    G  ++ V + + E  S       L+ F++ YK +DIY+  ++ + +  +      + CG   N L +A +W + GGT S+LHY     ++C+  G K+F++I+ K+     M   H    +G +S +D E ++M +   +  +PW+ A++E GDC++IP  ++HQV+S+G R+L+ NI +A     + T CD +  KD D +    F     + + Q    K   + L + I +K +R  +    E +    +T I   N         F  +D   DG VT E++++L    L ++
Sbjct:   23 PPGHLQPLGSHRPAEGEVDAVSKPPSPHEFFNNYVIPGKPLLFKGAAKA-LPAYKLWTDEYLSSKFGDLRMEVEEGKKENRSWGTFNFKLKEFINKYKKEDIYMVESLQKPMREDYMLLHSLACGGFTNVLQDAVMWFSSGGTKSVLHYDSLENINCLFSGNKNFVMIDKKY-----MNMTHIDRKDGSFSNVDVERVDMQKYPGLGKVPWMNASMEEGDCMYIPWRWVHQVQSFGPRNLAVNIWWARFTQFNQTDCDTSIYKDKDLVPLSAFELKPNEVVRQEFLEKTGRKPLTKEIWLKALREQA---EEVYATLADTEILLQN---------FAEVDADKDGLVTPEEMMSLHSRDLERL 367          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO37504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFI3])

HSP 1 Score: 155.992 bits (393), Expect = 8.460e-42
Identity = 105/375 (28.00%), Postives = 193/375 (51.47%), Query Frame = 1
Query:  274 GHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPT------KITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYG-RSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYT-ERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPS-----AQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILN 1359
            GH   LG  R ++G VE+ +S+  PK+F+  Y     P++++GA     P   +W D  L + +G  ++ +  R EK  K P       + T+  FL+ Y  +D Y+ S +P+ L  E+     + CG     ++EA LW++ GGT S+LH   D+ ++C+ +G KD+ILI   ++K+  + +     G G++ LD + +N+ +  +   + W YA + AGDC+++P  Y HQVRSYG ++++ ++ F+ L   + T C+ +++ +Y  LS  + ++T    G + + N  L   +L++  ++ I+      +     F +     V +  PS     A  + + +DP   G+   + I  L    L  I+ IL+
Sbjct:   27 GHGLELGKHRDSDGHVEVLQSLPSPKEFWDNYASIRKPVVLRGA-GKNFPAFDLWTDPYLVENYGDLEVKLEARKEKE-KVPVGEKGLGRDTIRSFLESYAKKDTYMVSQLPDPLAREVRVLPCLMCGTFSERILEANLWLSSGGTKSMLHKDADNAINCLLNGTKDWILIHPDNEKNIPVAKGDKGYG-GFATLDVDKVNLIKYPKFKEVHWQYANLTAGDCLYLPYSYWHQVRSYGAKNMAVSVLFSRLTQFNETGCE-SAKLEYTPLSDVNMVWTYPGHGPQTMGN--LDPFELKDNYLQEIKHIENQQFTVDYLFESLTQEGVYENHPSIRRDMASKILSIMDPGSKGYAGEDDIEALTVESLKAIADILD 395          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO34398 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF6])

HSP 1 Score: 134.035 bits (336), Expect = 1.955e-35
Identity = 83/302 (27.48%), Postives = 155/302 (51.32%), Query Frame = 1
Query:  262 QIPIGHLRCLGYQRH-AEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPT------KITLERFLDFYKLQDI--YIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDL 1140
            ++P+GHL+ LG  R  +   ++  +    P+DF+ K+V  +  L+++GA    +     W DE LK+ +G  ++ +  + EKS + P+      + T+  F+D         YI S +P  +  + A    + CG  ++ LVE +LW++ GGT S++H    + ++C+ +G K + +IE K++       + P    G+S+++ + +++ +  ++A +PW   TI AGDC+F+P  Y HQV S G +   N   A L ++            +D++   DF    R    +LK T L++ D+
Sbjct:   22 EVPVGHLKPLGSHRPPSTDLIDEIEGFPSPQDFWEKWVKPSRALVLRGAAKHSEAF-TKWTDEYLKENYGDLEVRLEGKKEKSGRIPSGAMGVGRDTIGNFVDNAHKPGAKSYIVSDMPSPMYKDFAVIPPLTCGTFKDYLVEVDLWLSGGGTASIMHKDAFNAINCLMNGTKVWKMIEYKYEDKIYKAWEPPEMIGGFSKINVQNVDLLKYPKVAEVPWSLVTINAGDCLFLPKSYYHQVTSSGDT---NAAVALLFSR------------FDHMDNLDFSDCNR----ELKPTPLSEMDI 303          
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Match: EDO30343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T124])

HSP 1 Score: 130.183 bits (326), Expect = 1.014e-34
Identity = 68/227 (29.96%), Postives = 118/227 (51.98%), Query Frame = 1
Query:  268 PIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWV-IKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEG-YSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSG 942
            P+GH+  LG  +  EG VE    +  P +F+  YVL + P+I +GA  + +    +W D  L+K +G   + V   + E  +++   + LE FLD Y   + Y+  T+PE +  E + P+ + CG   ++L ++ LW + GGT S LH      ++C+  G K +  ++  H +   M  K     EG Y   + + ++M++   +  IPW  A + AGDC+++P G
Sbjct:   25 PLGHMMPLGSHQPKEGDVESRDDMPSPSEFYHNYVLASKPVIFRGAAKSSKGFN-LWTDAYLRKKYGHEIVRVDYGKKENRARSADDMPLEEFLDIYNSSERYLVDTLPERMWEEFSLPECLLCGGFSHALQDSVLWFSSGGTKSHLHNDKVENINCLFSGEKVWFFVDQIHSQDINMDHK-----EGDYCSANVDKVDMYQYPFLQHIPWWQAHMRAGDCMYVPYG 245          
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Match: kdm8 (lysine demethylase 8 [Source:NCBI gene;Acc:101171915])

HSP 1 Score: 53.1434 bits (126), Expect = 3.398e-7
Identity = 56/234 (23.93%), Postives = 92/234 (39.32%), Query Frame = 1
Query:  349 KDFFTKYVLKNIPLIIKGAIDTKQPIRV-IWNDERLKKMHG--KSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDI---------YIAS-----TIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFA 999
            + F T Y+L   P+I++G ID    +    W+ E L+ + G     + V  R+   + + T +T+  F+D Y L +I         Y+A       IPE L  +I  P +   G  +   +    W    GT S LH            G K   L   +        +          E++     +F E   +  P++   +E GD +FIP  + H VRS   S S +  ++
Sbjct:  179 ESFSTNYLLPLKPVILEGIIDHWPALNNHPWSIEYLRSVAGFRTVPVEVGSRYTDENWSQTLLTVNEFIDRYILNEISQDGGKSRGYLAQHQLFDQIPE-LKEDIRIPDYCCLGEGDEDDITINAWFGPAGTVSPLHQDPQQNFLAQVVGSKYIRLFSPEDTDKLYPHQSQLLHNTSQVEVENPNAELFPE--FSKAPYLECVLEPGDVLFIPVKHWHYVRSLQVSFSVSFWWS 409          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000028946.1 (SMESG000028946.1)

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 427/429 (99.53%), Postives = 429/429 (100.00%), Query Frame = 1
Query:  103 MIFLTCIRHLITLNVLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHDEL 1389
            MIFLTCIRHLITLNVLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAG+CIFIP+GYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHDEL
Sbjct:    1 MIFLTCIRHLITLNVLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRSMYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEMINMFEEKQIASIPWIYATIEAGECIFIPAGYIHQVRSYGRSLSYNIQFASLHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTLEQILNLPGNQLNKISKILNSIHKTRHDEL 429          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 124.405 bits (311), Expect = 3.943e-31
Identity = 85/307 (27.69%), Postives = 157/307 (51.14%), Query Frame = 1
Query:  313 GP---VEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDE-----RLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEG-YSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNI------QFASLHNKS--ITKCDN--NSEKDYDN---LSQHDFIYTERDGIEQLKNTKLTDEDLRNILVKLIR 1167
            GP   ++ T   + P  FF  +V KN PL++K A     P    W+DE      L K +  +     K+ E  +    ++  + F+  Y   DIY+ + +P  L  +I +P  + C   + ++ +  +W + G T S++H      ++C+  G K F+L++ +     K  +K P   EG YS++D + ++  + K++ ++ +I A +EAGDC++IP  +IHQVRS+ R+++ NI       F  + NK+  + KC+   + +K + N   L  +  IY   DGIE L  ++L ++ + +  V ++ 
Sbjct:   32 GPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAA-KNFPAMEKWDDEYFLNLNLSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPE-----KHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEML--SELQNKSVSSAFVTILE 330          
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 125.176 bits (313), Expect = 4.018e-31
Identity = 83/288 (28.82%), Postives = 147/288 (51.04%), Query Frame = 1
Query:  313 GP---VEMTKSVIQPKDFFTKYVLKNIPLIIKGAIDTKQPIRVIWNDE-----RLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDFYKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSLLHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEG-YSELDTEMINMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNI------QFASLHNKS--ITKCDN--NSEKDYDN---LSQHDFIYTERDGIEQL 1110
            GP   ++ T   + P  FF  +V KN PL++K A     P    W+DE      L K +  +     K+ E  +    ++  + F+  Y   DIY+ + +P  L  +I +P  + C   + ++ +  +W + G T S++H      ++C+  G K F+L++ +     K  +K P   EG YS++D + ++  + K++ ++ +I A +EAGDC++IP  +IHQVRS+ R+++ NI       F  + NK+  + KC+   + +K + N   L  +  IY   DGIE L
Sbjct:   32 GPSVSIDFTNGFVDPITFFESFVQKNKPLLMKQAA-KNFPAMEKWDDEYFLNLNLSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSYNDSDIYMVNNLPNFLNEDIHFPWPLQCDLFDENIFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPE-----KHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINIWFRVPEMFFEISNKTELLEKCNKYPDDKKTFSNTNYLGLNTGIYNRNDGIEML 313          
The following BLAST results are available for this feature:
BLAST of JmjC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
KDM81.324e-624.00lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
KDM81.395e-624.00lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Kdm89.881e-723.58lysine (K)-specific demethylase 8 [Source:MGI Symb... [more]
back to top
BLAST of JmjC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q497B8|KDM8_RAT5.648e-624.05Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
sp|Q8N371|KDM8_HUMAN6.357e-624.00Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
sp|Q9CXT6|KDM8_MOUSE6.912e-623.58Bifunctional peptidase and arginyl-hydroxylase JMJ... [more]
back to top
BLAST of JmjC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5H2VAN00.000e+083.58Jumonji C domain-containing protein (Fragment) OS=... [more]
A0A267DWQ01.745e-11543.06JmjC domain-containing protein OS=Macrostomum lign... [more]
A0A1I8FX821.360e-10141.23JmjC domain-containing protein OS=Macrostomum lign... [more]
A0A1S3H3251.094e-8838.36uncharacterized protein LOC106151697 OS=Lingula un... [more]
C3YD716.619e-8634.36Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO304441.931e-6534.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372537.385e-4529.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375048.460e-4228.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343981.955e-3527.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303431.014e-3429.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of JmjC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
kdm83.398e-723.93lysine demethylase 8 [Source:NCBI gene;Acc:1011719... [more]
back to top
BLAST of JmjC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000028946.10.000e+099.53SMESG000028946.1[more]
SMESG000008562.13.943e-3127.69SMESG000008562.1[more]
SMESG000008562.14.018e-3128.82SMESG000008562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013770 ID=SMED30013770|Name=JmjC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1499bp
GTTGTACACTCTGACAGCTTATTCAAACAATGTGTTACCAAATAATCTTA
ATTACCACGTGTCTGTAGAAATTTAAAAAATTCTTCGTCAATTTAAAACA
AAATGATTTTTCTAACTTGCATTCGTCATCTTATAACTTTGAATGTTTTG
TTTTATTCAACAATTGCAATTGAAGAAGGAGATAAAACTGAATTGTATTT
TGTGAAAGATGATGGTATGAATACAAAGTTCCCACCGAAACTCTCTAGAT
CAATGTATGATCAAATTCCAATTGGTCATCTTAGATGCCTAGGTTACCAA
CGACATGCAGAAGGACCAGTTGAAATGACAAAATCAGTTATTCAACCTAA
AGATTTTTTCACTAAATATGTTTTGAAAAACATTCCTTTAATAATAAAAG
GTGCCATTGATACAAAACAGCCAATTAGGGTTATTTGGAATGATGAAAGA
TTAAAAAAGATGCACGGAAAATCAAAGATTTGGGTTATTAAGAGACATGA
AAAATCCAGTAAAACACCGACAAAAATAACATTAGAAAGATTTCTTGATT
TTTATAAATTGCAAGACATTTATATTGCTTCAACAATTCCAGAAGAACTT
TTATCAGAAATTGCATATCCGAAATTTATGAACTGTGGTCCTATTGAAAA
CAGTCTTGTTGAAGCTGAATTGTGGATGGCATATGGAGGAACCGGTTCGT
TGCTTCATTATCATGGAGATCACCAAGTTCATTGTATGGCTGATGGAAGA
AAAGATTTTATTTTAATTGAAAATAAACATAAAAAATCATTTAAAATGGT
TGAAAAACATCCATTTACGGGGGAGGGTTATTCTGAATTGGACACAGAAA
TGATAAATATGTTTGAAGAAAAACAAATCGCTAGCATTCCTTGGATATAT
GCAACGATTGAAGCTGGGGACTGTATTTTTATTCCTTCAGGTTATATTCA
CCAAGTTAGGTCATATGGACGTAGTTTATCATATAATATTCAATTTGCTT
CACTACATAACAAAAGTATCACAAAATGTGATAATAATTCCGAAAAAGAT
TATGATAATTTATCCCAACATGATTTTATTTATACCGAAAGAGACGGAAT
TGAGCAGTTGAAAAATACTAAATTGACCGACGAGGACTTGAGAAACATAC
TTGTCAAATTAATTAGAACAGCTTCAATTCTTCCATATGAAAGATTCCAG
TATTTCTATAATACTGCTATTGGAAAAGTCAATCAAAAAATGCCTTCAGC
ACAAGTGGTTTTCAATAACATTGATCCGAAAGGCGATGGTTTCGTGACAT
TGGAACAAATTCTAAATTTGCCGGGAAACCAACTAAATAAAATATCAAAG
ATCCTGAACAGCATCCACAAAACCCGACATGATGAGCTATAAAAATATCT
CTAAATTTTATTTAAATATTCACATTACAATTTTAAAATTGTAAATTCTT
TTGAAATTTTAACTATTTGTTTTATTAGCTAATAAAAATTATCAGTCTC
back to top

protein sequence of SMED30013770-orf-1

>SMED30013770-orf-1 ID=SMED30013770-orf-1|Name=SMED30013770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=430bp
MIFLTCIRHLITLNVLFYSTIAIEEGDKTELYFVKDDGMNTKFPPKLSRS
MYDQIPIGHLRCLGYQRHAEGPVEMTKSVIQPKDFFTKYVLKNIPLIIKG
AIDTKQPIRVIWNDERLKKMHGKSKIWVIKRHEKSSKTPTKITLERFLDF
YKLQDIYIASTIPEELLSEIAYPKFMNCGPIENSLVEAELWMAYGGTGSL
LHYHGDHQVHCMADGRKDFILIENKHKKSFKMVEKHPFTGEGYSELDTEM
INMFEEKQIASIPWIYATIEAGDCIFIPSGYIHQVRSYGRSLSYNIQFAS
LHNKSITKCDNNSEKDYDNLSQHDFIYTERDGIEQLKNTKLTDEDLRNIL
VKLIRTASILPYERFQYFYNTAIGKVNQKMPSAQVVFNNIDPKGDGFVTL
EQILNLPGNQLNKISKILNSIHKTRHDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000036eye
PLANA:0000418head
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR041667Cupin_8
IPR003347JmjC_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003347JmjC domainSMARTSM00558cupin_9coord: 168..311
e-value: 0.0023
score: 7.3
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 151..315
score: 16.412
IPR041667Cupin-like domain 8PFAMPF13621Cupin_8coord: 82..298
e-value: 3.1E-19
score: 69.7
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 74..298
e-value: 1.1E-32
score: 115.5
NoneNo IPR availablePANTHERPTHR12461HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR-RELATEDcoord: 24..424
NoneNo IPR availablePANTHERPTHR12461:SF53coord: 24..424
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.688
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 80..345