Matrin-type domain-containing protein

Overview
NameMatrin-type domain-containing protein
Smed IDSMED30013766
Length (bp)1758
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Matrin-type domain-containing protein (SMED30013766) t-SNE clustered cells

Violin plots show distribution of expression levels for Matrin-type domain-containing protein (SMED30013766) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Matrin-type domain-containing protein (SMED30013766) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Matrin-type domain-containing protein (SMED30013766) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013766

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30013766SMESG000072403.1 SmedASXL_013942SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013766SMESG000072403.1 dd_Smed_v4_1859_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013766SMESG000072403.1 Contig54885newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013766SMESG000072403.1 Contig54885uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30013766SMESG000072403.1 OX_Smed_1.0.19239ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30013766SMESG000072874.1 SMESG000077611.1 SMESG000073729.1 Contig5399GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013766SMESG000072403.1 Contig5399GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Match: ZMAT4 (zinc finger matrin-type 4 [Source:HGNC Symbol;Acc:HGNC:25844])

HSP 1 Score: 60.8474 bits (146), Expect = 2.473e-10
Identity = 47/173 (27.17%), Postives = 66/173 (38.15%), Query Frame = 1
Query:  307 CLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDL----EFCRLCETPFSSKVAALQHYSGKKHKKNAENW-SSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            C  CSA L + S  ++HY S KH +K+ L ++ H                            G  P K  +            +EN    D+    + C LC   F+S V A  HY GK H K  +       P+K    + + RC +C+V   S  Q   H  G KHQ  +K
Sbjct:   16 CKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPR-------------------------DGGCPAKRLR------------SENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLK 151          
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Match: ZNF346 (zinc finger protein 346 [Source:HGNC Symbol;Acc:HGNC:16403])

HSP 1 Score: 62.7734 bits (151), Expect = 5.506e-10
Identity = 57/249 (22.89%), Postives = 96/249 (38.55%), Query Frame = 1
Query:  151 APPEDLSDEEIFDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIE----LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAP-------------------TKSSKIPFRELVKKFE-INENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFN--------PIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            A P    + + F  S  ++P   ++E  S       +    +++I+    L    +C  C A+L + S  L+HY S KH NK+      HG   L   K E +++++    S   +     P                   T +  +  ++   K E +++N   +D + FC LC   F+  V A QHY GKKH+K                  +          C  C ++  S  Q + H +G KH+
Sbjct:   51 AQPVGREEAQFFPHSRTVIPILVLSETYS-------LCHPVEHMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETL---KGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 289          
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Match: ZNF346 (zinc finger protein 346 [Source:HGNC Symbol;Acc:HGNC:16403])

HSP 1 Score: 62.003 bits (149), Expect = 8.064e-10
Identity = 49/199 (24.62%), Postives = 77/199 (38.69%), Query Frame = 1
Query:  289 LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAP-------------------TKSSKIPFRELVKKFE-INENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFN--------PIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            L    +C  C A+L + S  L+HY S KH NK+      HG   L   K E +++++    S   +     P                   T +  +  ++   K E +++N   +D + FC LC   F+  V A QHY GKKH+K                  +          C  C ++  S  Q + H +G KH+
Sbjct:   69 LFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETL---KGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 264          
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Match: ZMAT4 (zinc finger matrin-type 4 [Source:HGNC Symbol;Acc:HGNC:25844])

HSP 1 Score: 55.4546 bits (132), Expect = 6.242e-8
Identity = 50/180 (27.78%), Postives = 70/180 (38.89%), Query Frame = 1
Query:  301 KKCLECSAILTTISSALSHYNSTKHQNKIALKF---LPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            K C  C+   T+   A SHY    H  ++ L      P  T   PLS  +             P    TAP  +S    R+  +              +C LC   F++ + A QHY GKKHKKNA   +    +   +D       + + RC +C+V   S  Q   H  G KHQ  +K
Sbjct:   75 KCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLK-------------PPRMDTAPVVASPYQRRDSDR--------------YCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLK 227          
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Match: ZNF346 (zinc finger protein 346 [Source:HGNC Symbol;Acc:HGNC:16403])

HSP 1 Score: 53.5286 bits (127), Expect = 4.306e-7
Identity = 61/278 (21.94%), Postives = 107/278 (38.49%), Query Frame = 1
Query:  289 LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTK---------------------DDLRCDVCNVIGESAAQMETHFAGKKH-----QMKMKAYLERVNAGAIAPPMSSRGF-CD-----FNNVEREEANPVDPTRFIQENILPKNLSGSFLN-PYEPEPQQFEDNYIDE 1023
            L    +C  C A+L + S  L+HY S KH NK+      HG   L   K E +++++                KSS+   +                 + C +C   FSS V A  HY GK H KN +       ++ +  +                      D  C +C+         + H+ GKKH     ++K+ A   R+   A+    + +G+ C       N++E+ +A+    + F  +N  PK ++ S    P + +P Q +   +++
Sbjct:   69 LFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETL---KGETKKLDSD--------------QKSSRSKDKN----------------QCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALSKRLTNPFLVASTLALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAH---VSGFKHKNQSPKTVASSLGQIPMQRQPIQKDSTTLED 310          
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 65.855 bits (159), Expect = 2.223e-12
Identity = 51/167 (30.54%), Postives = 70/167 (41.92%), Query Frame = 1
Query:  307 CLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMK 804
            C  CSA L + S  ++HY S KH NK+ L ++ H     P+                     G  P K  K+   +  ++ ++++N      + C LC   F+S V A  HY GK H K  +      P I     K    CDVC+V   S AQ   H  G KHQ K
Sbjct:   16 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLH-----PVD--------------------GGCPAK--KLRTDDGSEEGDVDKN------KCCTLCNMSFTSAVVAQSHYQGKIHAKRLKLLLGEQPAITAKGLKRCYTCDVCSVTLNSVAQYHAHLQGSKHQNK 149          
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 65.855 bits (159), Expect = 2.223e-12
Identity = 51/167 (30.54%), Postives = 70/167 (41.92%), Query Frame = 1
Query:  307 CLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMK 804
            C  CSA L + S  ++HY S KH NK+ L ++ H     P+                     G  P K  K+   +  ++ ++++N      + C LC   F+S V A  HY GK H K  +      P I     K    CDVC+V   S AQ   H  G KHQ K
Sbjct:   16 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLH-----PVD--------------------GGCPAK--KLRTDDGSEEGDVDKN------KCCTLCNMSFTSAVVAQSHYQGKIHAKRLKLLLGEQPAITAKGLKRCYTCDVCSVTLNSVAQYHAHLQGSKHQNK 149          
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 66.2402 bits (160), Expect = 5.567e-12
Identity = 61/199 (30.65%), Postives = 83/199 (41.71%), Query Frame = 1
Query:  307 CLECSAILTTISSALSHYNSTKHQNKIALKFLPH----GTYNLPLSKEEIREIETGVNKS---------------GEPNAPGTAPTKSSKIPFRELVKKFEINE-------NVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMK 804
            C  CSA L + S  ++HY S KH NK+ L ++ H    G     L  ++  E E  V+K+                + +  G    K  K+   E   K   +E         H+    +C+LC   F++   A QHY GKKHKKNA        + K +D       K    CDVC+V   S AQ   H  G KHQ K
Sbjct:   16 CKVCSAQLISESQRVAHYESRKHANKVRLYYMLHPVDGGCPAKKLRTDDGSE-EGDVDKNKCCTLCNMSFTSAVVAQSHYQGKIHAKRLKLLLGEHPVKTASSEVSPVSSARQHRDSDRYCQLCNAWFNNPGMAQQHYDGKKHKKNAARADLLEQLGKTLDMGEMKGLKRCYTCDVCSVTLNSVAQYHAHLQGSKHQNK 213          
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:560756])

HSP 1 Score: 66.6254 bits (161), Expect = 1.428e-11
Identity = 60/228 (26.32%), Postives = 89/228 (39.04%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRE-LVKKFEINENVHKLDLE----------------------------------FCRLCETPFSSKVAALQHYSGKKHKKNAEN---WSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPP 852
            +L    +C  CSA+L + S  L+HY S KH +K+      HG+   P++K   R   +G ++S               + F   +V +      VH  +L                                   FC +C+  F++ + A QHYSGKKHKK+        +F P   P  T     C VCN+   S  Q + H +G KH+   K    +    A APP
Sbjct:   58 DLFSDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMSIHGS-EEPIAK---RFKPSGDDQSNVDEKDKYKACSVCNMTFSSPVVAQSHYQGKVHSKNLRMQSIGSQTPALPQPKAQAKKDDGMQGPAEQDPNRFCSICQASFNNPLMAQQHYSGKKHKKHMNKQKLMETFGPSTAPASTVKGYPCTVCNIELNSVEQYQAHISGSKHKNHAKP---KKGPNAFAPP 278          
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:560756])

HSP 1 Score: 66.6254 bits (161), Expect = 1.535e-11
Identity = 60/228 (26.32%), Postives = 89/228 (39.04%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRE-LVKKFEINENVHKLDLE----------------------------------FCRLCETPFSSKVAALQHYSGKKHKKNAEN---WSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPP 852
            +L    +C  CSA+L + S  L+HY S KH +K+      HG+   P++K   R   +G ++S               + F   +V +      VH  +L                                   FC +C+  F++ + A QHYSGKKHKK+        +F P   P  T     C VCN+   S  Q + H +G KH+   K    +    A APP
Sbjct:   50 DLFSDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMSIHGS-EEPIAK---RFKPSGDDQSNVDEKDKYKACSVCNMTFSSPVVAQSHYQGKVHSKNLRMQSIGSQTPALPQPKAQAKKDDGMQGPAEQDPNRFCSICQASFNNPLMAQQHYSGKKHKKHMNKQKLMETFGPSTAPASTVKGYPCTVCNIELNSVEQYQAHISGSKHKNHAKP---KKGPNAFAPP 270          
BLAST of Matrin-type domain-containing protein vs. Ensembl Xenopus
Match: zmat1 (lysine-rich coiled-coil 1 [Source:NCBI gene;Acc:733809])

HSP 1 Score: 51.6026 bits (122), Expect = 2.698e-6
Identity = 27/80 (33.75%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  583 EFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKD----DLR--CDVCNVIGESAAQMETHFAGKKHQMK 804
            ++C+LC   F+  + A QHYSGKKH +N         ++     D    D R  C +CN+   S    ++H  G KHQ+K
Sbjct:  223 KYCKLCCASFNKALVAQQHYSGKKHARNQARKKMMEEMEGTGVADSEVSDGRYVCPICNITLTSIEMYQSHMQGNKHQIK 302          

HSP 2 Score: 50.447 bits (119), Expect = 7.615e-6
Identity = 37/126 (29.37%), Postives = 48/126 (38.10%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKK 663
            EL     C  C+A+L   S  +SHY   KH  K+ L FL +    + L  +    +E  V+                           E+ +  HK    FC LC   FSS V A  HY GK H K
Sbjct:   56 ELFTDTFCKVCNAVLQFESHRISHYEGKKHAQKVRLYFLKNELEEMALKTQRTDRVEFHVDG--------------------------EVAQGKHK----FCGLCNMVFSSPVVAQTHYVGKVHAK 151          
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Match: Zfp346 (zinc finger protein 346 [Source:MGI Symbol;Acc:MGI:1349417])

HSP 1 Score: 59.3066 bits (142), Expect = 3.680e-9
Identity = 55/239 (23.01%), Postives = 98/239 (41.00%), Query Frame = 1
Query:  184 FDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIE----LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKS---------------------GEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKN-------AENWSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            FD+      ++ ++    AGR ++      +++I+    L    +C  C A+L + S  L+HY S KH NK+      HG   +   K +++ +++    S                      + +  G    KS K+  ++  K   + +N   LD + FC LC + F+    A QHY GK+H+K        A      +P +  +       C  C ++  S  Q + H +G KH+
Sbjct:   36 FDRERARRLWEAVSGAQPAGREEV------EHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETI---KGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLK-QQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 264          
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Match: Zmat4 (zinc finger, matrin type 4 [Source:MGI Symbol;Acc:MGI:2443497])

HSP 1 Score: 53.9138 bits (128), Expect = 4.457e-8
Identity = 51/183 (27.87%), Postives = 70/183 (38.25%), Query Frame = 1
Query:  301 KKCLECSAILTTISSALSHYNSTKHQNKIALKFL---PHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDL----------RCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            K C  C+   T+   A SHY    H  ++ L      P  T   PLS  +   ++T             AP  +S    R+                 +C LC   F++ + A QHY GKKHKKNA   +    ++ + T  DL          RC  C+V   S  Q   H  G KHQ  +K
Sbjct:    6 KCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDT-------------APVVASPYQRRD--------------SDRYCGLCAAWFNNPLMAQQHYEGKKHKKNA---ARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNLK 158          
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Match: Zmat4 (zinc finger, matrin type 4 [Source:MGI Symbol;Acc:MGI:2443497])

HSP 1 Score: 54.299 bits (129), Expect = 1.007e-7
Identity = 51/183 (27.87%), Postives = 71/183 (38.80%), Query Frame = 1
Query:  301 KKCLECSAILTTISSALSHYNSTKHQNKIALKFL---PHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDL----------RCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            K C  C+   T+   A SHY    H  ++ L      P  T   PLS  +   ++T             AP  +S    R+  +              +C LC   F++ + A QHY GKKHKKNA   +    ++ + T  DL          RC  C+V   S  Q   H  G KHQ  +K
Sbjct:   75 KCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDT-------------APVVASPYQRRDSDR--------------YCGLCAAWFNNPLMAQQHYEGKKHKKNA---ARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNLK 227          
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Match: Zmat4 (zinc finger, matrin type 4 [Source:MGI Symbol;Acc:MGI:2443497])

HSP 1 Score: 53.5286 bits (127), Expect = 1.393e-7
Identity = 51/181 (28.18%), Postives = 70/181 (38.67%), Query Frame = 1
Query:  301 KKCLECSAILTTISSALSHYNSTKHQNKIALKFL---PHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDL----------RCDVCNVIGESAAQMETHFAGKKHQMK 804
            K C  C+   T+   A SHY    H  ++ L      P  T   PLS  +   ++T             AP  +S    R+  +              +C LC   F++ + A QHY GKKHKKNA   +    ++ + T  DL          RC  C+V   S  Q   H  G KHQ K
Sbjct:   75 KCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPLSSLKAPRVDT-------------APVVASPYQRRDSDR--------------YCGLCAAWFNNPLMAQQHYEGKKHKKNA---ARVALLEQLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTK 225          
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Match: Zfp346 (zinc finger protein 346 [Source:MGI Symbol;Acc:MGI:1349417])

HSP 1 Score: 53.5286 bits (127), Expect = 2.913e-7
Identity = 56/254 (22.05%), Postives = 98/254 (38.58%), Query Frame = 1
Query:  184 FDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIE----LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKS---------------------------GEPNAP----------GTAPTKSSKIPFRELVKKFEINENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKNAENW---SSFNPIKPIDTKD----DLRCDVCNVIGESAAQMETHFAGKKHQ 798
            FD+      ++ ++    AGR ++      +++I+    L    +C  C A+L + S  L+HY S KH NK+      HG   +   K +++ +++    S                           G+ +A           G A +K    PF  +     + +N   LD + FC LC + F+    A QHY GK+H+K        + +  +      D       C  C ++  S  Q + H +G KH+
Sbjct:   36 FDRERARRLWEAVSGAQPAGREEV------EHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETI---KGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALSKHLTNPFL-VASTLALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 279          
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A2RV29|ZN346_DANRE (Zinc finger protein 346 OS=Danio rerio OX=7955 GN=znf346 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.159e-10
Identity = 60/228 (26.32%), Postives = 89/228 (39.04%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRE-LVKKFEINENVHKLDLE----------------------------------FCRLCETPFSSKVAALQHYSGKKHKKNAEN---WSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPP 852
            +L    +C  CSA+L + S  L+HY S KH +K+      HG+   P++K   R   +G ++S               + F   +V +      VH  +L                                   FC +C+  F++ + A QHYSGKKHKK+        +F P   P  T     C VCN+   S  Q + H +G KH+   K    +    A APP
Sbjct:   50 DLFSDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMSIHGS-EEPIAK---RFKPSGDDQSNVDEKDKYKACSVCNMTFSSPVVAQSHYQGKVHSKNLRMQSIGSQTPALPQPEAQAKKDDGMQGPAEQDPNRFCSICQASFNNPLMAQQHYSGKKHKKHMNKQKLMETFGPSTAPASTVKGYPCTVCNIELNSVEQYQAHISGSKHKNHAKP---KKGPNAFAPP 270          
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8AVN9|ZN346_XENLA (Zinc finger protein 346 OS=Xenopus laevis OX=8355 GN=znf346 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 5.442e-10
Identity = 74/287 (25.78%), Postives = 121/287 (42.16%), Query Frame = 1
Query:  265 DAPDNLI----ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKF-LPHGTYNLPLSKEEI--REIETGVNKS---------------GEPNAPGTAPTKSSKIPFRELVKKFEINE------------NVHKLD----LEFCRLCETPFSSKVAALQHYSGKKHKKNAE--------NWSSFNPIK-PI------------DTKDDLRCDVCNVIGESAAQMETHFAGKKHQ---MKMKAYLERVNAGAIAPPM-----SSRGF-CD-----FNNVEREEAN 906
            DA ++LI     +    +C  CSA+L + S  L+HY S KH NK+     +  G  ++P  K +    EI  G ++S                E +  G    K+ ++  +  VK+  +N+            + +K+D     +FC+LC + F++ + A QHY+GKKHKK             S   P + PI                   CD CN++  S  Q + H +G KH+   M M    E  +   +AP       + +GF CD      N++E+ +A+
Sbjct:   18 DAVNSLIRENSHIFSDTQCKVCSAVLISESQKLAHYQSRKHANKVRRYMAINQGEDSVPAKKFKAAPAEISDGEDRSKCCPVCNMTFSSPVVAESHYIGKTHIKNLRLREQGGVKEGMVNQAKKTRTPTVATKSDNKMDHSDRAKFCKLCHSTFNNPLMAEQHYAGKKHKKQETKTQIMTIYTSSGQTPAQAPIPLNLNSPMPGSGSAGKGFSCDKCNIVLNSIEQYQAHVSGAKHKNQLMSMTPLSEEGHQAVVAPSAIASGSAGKGFSCDTCNIVLNSIEQYQAH 304          
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UL40|ZN346_HUMAN (Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 3.873e-9
Identity = 49/199 (24.62%), Postives = 77/199 (38.69%), Query Frame = 1
Query:  289 LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAP-------------------TKSSKIPFRELVKKFE-INENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFN--------PIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            L    +C  C A+L + S  L+HY S KH NK+      HG   L   K E +++++    S   +     P                   T +  +  ++   K E +++N   +D + FC LC   F+  V A QHY GKKH+K                  +          C  C ++  S  Q + H +G KH+
Sbjct:   69 LFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETL---KGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 264          
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R0B7|ZN346_MOUSE (Zinc finger protein 346 OS=Mus musculus OX=10090 GN=Znf346 PE=1 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 2.574e-8
Identity = 55/239 (23.01%), Postives = 98/239 (41.00%), Query Frame = 1
Query:  184 FDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIE----LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKS---------------------GEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKN-------AENWSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            FD+      ++ ++    AGR ++      +++I+    L    +C  C A+L + S  L+HY S KH NK+      HG   +   K +++ +++    S                      + +  G    KS K+  ++  K   + +N   LD + FC LC + F+    A QHY GK+H+K        A      +P +  +       C  C ++  S  Q + H +G KH+
Sbjct:   36 FDRERARRLWEAVSGAQPAGREEV------EHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETI---KGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLK-QQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHK 264          
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H898|ZMAT4_HUMAN (Zinc finger matrin-type protein 4 OS=Homo sapiens OX=9606 GN=ZMAT4 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.998e-7
Identity = 50/180 (27.78%), Postives = 70/180 (38.89%), Query Frame = 1
Query:  301 KKCLECSAILTTISSALSHYNSTKHQNKIALKF---LPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            K C  C+   T+   A SHY    H  ++ L      P  T   PLS  +             P    TAP  +S    R+  +              +C LC   F++ + A QHY GKKHKKNA   +    +   +D       + + RC +C+V   S  Q   H  G KHQ  +K
Sbjct:   75 KCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKTPLKTTATPLSPLK-------------PPRMDTAPVVASPYQRRDSDR--------------YCGLCAAWFNNPLMAQQHYDGKKHKKNAARVALLEQLGTTLDMGELRGLRRNYRCTICSVSLNSIEQYHAHLKGSKHQTNLK 227          
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Match: A0A267FUQ4 (Matrin-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023679g1 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.631e-15
Identity = 53/183 (28.96%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  265 DAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKA 813
            DAP N  +L+  + C  C A + +I +A  HYN   HQ ++    LP G Y             +GV  +G    P                   E+ E    LD ++C+LC+  F++ V   QHYSG+KH+ NA++ +     +  +TK   RCDVC +   +   ++ H  G KH+  ++A
Sbjct:  304 DAPHNFKQLVENQWCSLCLAGVNSIVTAEVHYNGKTHQRQLRENGLPAGEY------------YSGVLNTGNSQTP-------------------ELPEG---LDTQYCKLCDVTFTNTVQMFQHYSGRKHRSNAQDRTLVEKKQSAETK-IFRCDVCGIFTNTQDSLDCHLGGMKHKAMLEA 451          
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Match: A0A267FET4 (Matrin-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018604g2 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.997e-15
Identity = 53/183 (28.96%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  265 DAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKA 813
            DAP N  +L+  + C  C A + +I +A  HYN   HQ ++    LP G Y             +GV  +G    P                   E+ E    LD ++C+LC+  F++ V   QHYSG+KH+ NA++ +     +  +TK   RCDVC +   +   ++ H  G KH+  ++A
Sbjct:  286 DAPHNFKQLVENQWCSLCLAGVNSIVTAEVHYNGKTHQRQLRENGLPAGEY------------YSGVLNTGNSQTP-------------------ELPEG---LDTQYCKLCDVTFTNTVQMFQHYSGRKHRSNAQDRTLVEKKQSAETK-IFRCDVCGIFTNTQDSLDCHLGGMKHKAMLEA 433          
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Match: A0A267E3E8 (Matrin-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013165g1 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.488e-15
Identity = 53/183 (28.96%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  265 DAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKA 813
            DAP N  +L+  + C  C A + +I +A  HYN   HQ ++    LP G Y             +GV  +G    P                   E+ E    LD ++C+LC+  F++ V   QHYSG+KH+ NA++ +     +  +TK   RCDVC +   +   ++ H  G KH+  ++A
Sbjct:  302 DAPHNFKQLVENQWCSLCLAGVNSIVTAEVHYNGKTHQKQLRENGLPAGEY------------YSGVLNTGNSQTP-------------------ELPEG---LDTQYCKLCDVTFTNTVQMFQHYSGRKHRSNAQDRTLVEKKQSAETK-IFRCDVCGIFTNTQDSLDCHLGGMKHKAMLEA 449          
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Match: A0A2K5QGQ7 (Zinc finger protein 346 OS=Cebus capucinus imitator OX=1737458 GN=ZNF346 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.305e-9
Identity = 51/199 (25.63%), Postives = 79/199 (39.70%), Query Frame = 1
Query:  289 LIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAP-------------------TKSSKIPFRELVKKFE-INENVHKLDLE-FCRLCETPFSSKVAALQHYSGKKHKKNAEN--------WSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            L    +C  C A+L + S  L+HY S KH NK+      HG   L   K E +++++    S   +     P                   T +  +  ++   K E +++N   +D + FC LC   F+  V A QHY GKKH+K            W +   +          C  C ++  S  Q + H +G KHQ
Sbjct:   69 LFTNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETL---KGETKKLDSDQKSSRSKDKNQCCPICNMTFFSPVVAQSHYLGKTHAKNLKLKQQYTKMEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGWMADPAVTDFPAGKGYPCKTCKIVLNSIKQYQAHISGFKHQ 264          
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Match: A0A226PMQ8 (Uncharacterized protein OS=Colinus virginianus OX=9014 GN=H355_006081 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 9.780e-9
Identity = 48/168 (28.57%), Postives = 73/168 (43.45%), Query Frame = 1
Query:  304 KCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKM 807
            +C  CSA+L + S  L+HY S KH NK+      HG   L   K    +++  V     P   G A       P  ++ +  +   N    + + C +C   FSS   A  HY GK H KN +  S       ++      C+ CN++  S  Q + H +G KH+ +M
Sbjct:   37 QCKVCSALLISESQRLAHYQSKKHANKVRRYLSIHGEEELAPGKR--MKLDAKVRGGPVPWESGEA--AGCVAPLCDICESKQEGTNGEDRN-KCCPICNMTFSSPAVATSHYLGKTHAKNVKQQSP-----KVEAGKGYPCNTCNIVLNSIEQYQAHISGFKHKNQM 194          
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:103029588])

HSP 1 Score: 62.7734 bits (151), Expect = 2.164e-10
Identity = 56/210 (26.67%), Postives = 87/210 (41.43%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPH------GTYNLPLSKEEIREIETG--------VNKS------GEPNAPGTAPTKSSKIPFRELVKKFEI----NENVHKLDLE-----------FCRLCETPFSSKVAALQHYSGKKHKKNAEN---WSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            +L    +C  CSA+L + S  L+HY S KH +K+      H           PLS E   ++  G         N +       E +  G    K+ K+  + L  +  +       V+K D++           FC +C+  F++ + A QHY GKKHKK+        ++ P   P  T     C VCN+   S  Q + H +G KH+
Sbjct:   29 DLFTDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMTIHKDEEPIAKRFKPLSDEATTDVNQGDKYKACTVCNMTFSSAVVAESHYQGKVHAKNLKL--KNLGPQTPVFVQPKAKVNKGDVQTAGGPGQDPNRFCSICQASFNNPLMAQQHYEGKKHKKHLTKQKLMETYGPSTAPASTLKGYPCTVCNIELNSVEQYQAHISGSKHK 236          
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:103029588])

HSP 1 Score: 62.3882 bits (150), Expect = 2.492e-10
Identity = 56/210 (26.67%), Postives = 87/210 (41.43%), Query Frame = 1
Query:  286 ELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPH------GTYNLPLSKEEIREIETG--------VNKS------GEPNAPGTAPTKSSKIPFRELVKKFEI----NENVHKLDLE-----------FCRLCETPFSSKVAALQHYSGKKHKKNAEN---WSSFNP-IKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQ 798
            +L    +C  CSA+L + S  L+HY S KH +K+      H           PLS E   ++  G         N +       E +  G    K+ K+  + L  +  +       V+K D++           FC +C+  F++ + A QHY GKKHKK+        ++ P   P  T     C VCN+   S  Q + H +G KH+
Sbjct:   29 DLFTDSQCKVCSAVLISESQKLAHYQSKKHASKVRRYMTIHKDEEPIAKRFKPLSDEATTDVNQGDKYKACTVCNMTFSSAVVAESHYQGKVHAKNLKL--KNLGPQTPVFVQPKAKVNKGDVQTAGGPGQDPNRFCSICQASFNNPLMAQQHYEGKKHKKHLTKQKLMETYGPSTAPASTLKGYPCTVCNIELNSVEQYQAHISGSKHK 236          
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 58.9214 bits (141), Expect = 2.381e-9
Identity = 34/86 (39.53%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  583 EFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYL 819
             +C+LC   F++   A QHY GKKHKKNA        + K +D       K    CDVC+V   S AQ   H  G KHQ  +K  L
Sbjct:  145 RYCQLCNAWFNNPGMARQHYDGKKHKKNAARADLLEQLGKTLDMGEMKGLKRSYTCDVCSVTLNSVAQYHAHLQGSKHQNNLKNQL 230          
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 58.9214 bits (141), Expect = 2.801e-9
Identity = 34/86 (39.53%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  583 EFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYL 819
             +C+LC   F++   A QHY GKKHKKNA        + K +D       K    CDVC+V   S AQ   H  G KHQ  +K  L
Sbjct:  170 RYCQLCNAWFNNPGMARQHYDGKKHKKNAARADLLEQLGKTLDMGEMKGLKRSYTCDVCSVTLNSVAQYHAHLQGSKHQNNLKNQL 255          
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 57.7658 bits (138), Expect = 4.603e-9
Identity = 33/81 (40.74%), Postives = 40/81 (49.38%), Query Frame = 1
Query:  583 EFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPI-KPIDT------KDDLRCDVCNVIGESAAQMETHFAGKKHQMK 804
             +C+LC   F++   A QHY GKKHKKNA        + K +D       K    CDVC+V   S AQ   H  G KHQ K
Sbjct:  140 RYCQLCNAWFNNPGMARQHYDGKKHKKNAARADLLEQLGKTLDMGEMKGLKRSYTCDVCSVTLNSVAQYHAHLQGSKHQNK 220          
BLAST of Matrin-type domain-containing protein vs. Ensembl Sea Lamprey
Match: zmat4a (zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-GENE-081104-333])

HSP 1 Score: 61.2326 bits (147), Expect = 6.751e-11
Identity = 59/214 (27.57%), Postives = 82/214 (38.32%), Query Frame = 1
Query:  307 CLECSAILTTISSALSHYNSTKHQNKIALKF---------LPHGTYNLPLSKEEIREIE-----------------TGVNKSGEPNAP------GTAPTKSSKIPFRELVKKFEINENVHKLDL------EFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSF--------NPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            C  CSA L + S  L+HY S KH NK+ +           LP      P   E+  ++E                    +  G+ +A       GT    ++  P  +     E    V+   L      + CRLC   F++   A QHY GKKH+KNA    +         NP  P   K    CD+CNV   S  Q + H  G KHQ  ++
Sbjct:   17 CKVCSAKLISESQRLAHYQSRKHANKVRMHSMLNPEDGGSLPKMVRTEPGGTEDSTDVERMKACTLCSMVFNSAVVAQAHYQGKTHAKKLKLMLGTEDATATVSPASKRASPVEDAALVNASPLAGSDPQKLCRLCNAFFNNPGMAAQHYEGKKHRKNAARAQTLGEPASGVTNPT-PAPAKTTYVCDLCNVNLNSMDQYQNHLKGNKHQNNLR 229          

HSP 2 Score: 51.2174 bits (121), Expect = 1.553e-7
Identity = 31/111 (27.93%), Postives = 45/111 (40.54%), Query Frame = 1
Query:  586 FCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNP-----------IKPIDTKDDL------RCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPPMSSRG 867
            FC++C     S+   L HY  +KH       S  NP            +P  T+D         C +C+++  SA   + H+ GK H  K+K  L   +A A   P S R 
Sbjct:   16 FCKVCSAKLISESQRLAHYQSRKHANKVRMHSMLNPEDGGSLPKMVRTEPGGTEDSTDVERMKACTLCSMVFNSAVVAQAHYQGKTHAKKLKLMLGTEDATATVSPASKRA 126          
BLAST of Matrin-type domain-containing protein vs. Ensembl Medaka
Match: zgc:171482 (zinc finger matrin-type protein 4 [Source:NCBI gene;Acc:101159377])

HSP 1 Score: 60.4622 bits (145), Expect = 5.911e-10
Identity = 52/192 (27.08%), Postives = 71/192 (36.98%), Query Frame = 1
Query:  262 PDAPDNLIELIYRKKCLE-CSAILTTISSALSHYNSTKHQNKIALKFLP---HGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAEN-------WSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMK 804
            PD PD     + R KC   C+   T+   A SHY    H  ++ L         TY  P S   +   +T             A T  S    RE  K              +C LC   F++ + A QHY GKKH++NA           S +  +    +    C +C+V+  S  Q   H  G KHQ K
Sbjct:   63 PDNPDCAETEVDRNKCCTLCNMFFTSAIVAQSHYQGKTHAKRVRLVLGEPPNLTTYKWPFSNLHLISTDT-------------AYTVGSGNGGREAGK--------------YCCLCGAWFNNPLMAQQHYEGKKHRRNAARARLLEQLAGSLDATESTGLRSSYSCSICSVVLNSIEQYHAHLQGSKHQNK 227          
BLAST of Matrin-type domain-containing protein vs. Ensembl Medaka
Match: znf346 (zinc finger protein 346 [Source:NCBI gene;Acc:101166820])

HSP 1 Score: 58.9214 bits (141), Expect = 6.931e-9
Identity = 51/212 (24.06%), Postives = 87/212 (41.04%), Query Frame = 1
Query:  193 SNKILPYKKINENTSAGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKN------AENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMK 810
            +NK+  Y  +         + +  ++ ++  +L   K C  C+ I T+ + A SHY    H  ++ ++           + EE +E   GV          T  TK    P R                  FC +C+  F++ + A QHY G+KHKK        E +   +   P  T    +C +CN+   S +Q ++H +G KH+ +MK
Sbjct:   58 ANKVRQYTSLQNEKELLHKKQKTSESDESNGDLDRTKACQLCNTIFTSKAVAESHYQGKFHAKRLKMEMTDVQPAGRASTAEEPKEKPGGV--------IATVKTKDDN-PER------------------FCSICDASFNNPLMAEQHYVGRKHKKRMTRVKLMETYGFSSAQAP--TLLSFKCVLCNIEVNSISQYQSHLSGAKHRNQMK 240          
BLAST of Matrin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000072403.1 (SMESG000072403.1)

HSP 1 Score: 981.474 bits (2536), Expect = 0.000e+0
Identity = 473/473 (100.00%), Postives = 473/473 (100.00%), Query Frame = 1
Query:   76 MPTETVDSESILEVNYEIDPSLNIAAPPEDLSDEEIFDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPPMSSRGFCDFNNVEREEANPVDPTRFIQENILPKNLSGSFLNPYEPEPQQFEDNYIDESNYGMKRNMNSGFDEFGMRAGGPVAIGYEHEYGMSMSGNVGFDSEFGMRRPGPMGLDNEFGMSRSNKAGFDNDYMDDIKPPISSLNFRINVQPDIKRNVSNMPDDSNPYIAPPWSSSIGRSQMSAPYAPNIPNRYGPQFATQTFGPTKFKYSRKSQI 1494
            MPTETVDSESILEVNYEIDPSLNIAAPPEDLSDEEIFDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPPMSSRGFCDFNNVEREEANPVDPTRFIQENILPKNLSGSFLNPYEPEPQQFEDNYIDESNYGMKRNMNSGFDEFGMRAGGPVAIGYEHEYGMSMSGNVGFDSEFGMRRPGPMGLDNEFGMSRSNKAGFDNDYMDDIKPPISSLNFRINVQPDIKRNVSNMPDDSNPYIAPPWSSSIGRSQMSAPYAPNIPNRYGPQFATQTFGPTKFKYSRKSQI
Sbjct:    1 MPTETVDSESILEVNYEIDPSLNIAAPPEDLSDEEIFDKSNKILPYKKINENTSAGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAPPMSSRGFCDFNNVEREEANPVDPTRFIQENILPKNLSGSFLNPYEPEPQQFEDNYIDESNYGMKRNMNSGFDEFGMRAGGPVAIGYEHEYGMSMSGNVGFDSEFGMRRPGPMGLDNEFGMSRSNKAGFDNDYMDDIKPPISSLNFRINVQPDIKRNVSNMPDDSNPYIAPPWSSSIGRSQMSAPYAPNIPNRYGPQFATQTFGPTKFKYSRKSQI 473          
BLAST of Matrin-type domain-containing protein vs. Planmine SMEST
Match: SMESG000003775.1 (SMESG000003775.1)

HSP 1 Score: 125.176 bits (313), Expect = 1.329e-31
Identity = 72/217 (33.18%), Postives = 112/217 (51.61%), Query Frame = 1
Query:  238 AGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKHQNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIPFRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAENWSSFN-PIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLERVNAGAIAP-PMSSRGFCDFN 882
            A  LQ   PD P NL++L+    C  C+  + ++ SA++HYNS  HQ+ +      +G + LPL+  EI ++E+GV    E +         SK    E+    ++ E+V K+++E+C +C  PF+S + AL+HY GKKHK+    ++    P  P    +D RC VC++   S   M  H  GK HQ K+   +E  N   I P  +   G  D+N
Sbjct:   21 AATLQQIRPDVPKNLVDLLNNYNCKLCNTFIPSLKSAITHYNSDSHQSTLRSANFEYGLFELPLTPSEILDLESGVLICAEGSNTVQLVDPISKAKKEEI----KLPESVDKINIEYCSICNVPFNSSIMALKHYGGKKHKQRF--FAKLTAPSDPRSITEDYRCSVCSLSTSSEENMRLHLEGKPHQKKLAKNIEENNMRTIPPETICKWGVMDYN 231          
The following BLAST results are available for this feature:
BLAST of Matrin-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMAT42.473e-1027.17zinc finger matrin-type 4 [Source:HGNC Symbol;Acc:... [more]
ZNF3465.506e-1022.89zinc finger protein 346 [Source:HGNC Symbol;Acc:HG... [more]
ZNF3468.064e-1024.62zinc finger protein 346 [Source:HGNC Symbol;Acc:HG... [more]
ZMAT46.242e-827.78zinc finger matrin-type 4 [Source:HGNC Symbol;Acc:... [more]
ZNF3464.306e-721.94zinc finger protein 346 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmat4a2.223e-1230.54zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
zmat4a2.223e-1230.54zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
zmat4a5.567e-1230.65zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
znf3461.428e-1126.32zinc finger protein 346 [Source:NCBI gene;Acc:5607... [more]
znf3461.535e-1126.32zinc finger protein 346 [Source:NCBI gene;Acc:5607... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zmat12.698e-633.75lysine-rich coiled-coil 1 [Source:NCBI gene;Acc:73... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp3463.680e-923.01zinc finger protein 346 [Source:MGI Symbol;Acc:MGI... [more]
Zmat44.457e-827.87zinc finger, matrin type 4 [Source:MGI Symbol;Acc:... [more]
Zmat41.007e-727.87zinc finger, matrin type 4 [Source:MGI Symbol;Acc:... [more]
Zmat41.393e-728.18zinc finger, matrin type 4 [Source:MGI Symbol;Acc:... [more]
Zfp3462.913e-722.05zinc finger protein 346 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2RV29|ZN346_DANRE1.159e-1026.32Zinc finger protein 346 OS=Danio rerio OX=7955 GN=... [more]
sp|Q8AVN9|ZN346_XENLA5.442e-1025.78Zinc finger protein 346 OS=Xenopus laevis OX=8355 ... [more]
sp|Q9UL40|ZN346_HUMAN3.873e-924.62Zinc finger protein 346 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9R0B7|ZN346_MOUSE2.574e-823.01Zinc finger protein 346 OS=Mus musculus OX=10090 G... [more]
sp|Q9H898|ZMAT4_HUMAN2.998e-727.78Zinc finger matrin-type protein 4 OS=Homo sapiens ... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FUQ44.631e-1528.96Matrin-type domain-containing protein (Fragment) O... [more]
A0A267FET44.997e-1528.96Matrin-type domain-containing protein (Fragment) O... [more]
A0A267E3E85.488e-1528.96Matrin-type domain-containing protein (Fragment) O... [more]
A0A2K5QGQ78.305e-925.63Zinc finger protein 346 OS=Cebus capucinus imitato... [more]
A0A226PMQ89.780e-928.57Uncharacterized protein OS=Colinus virginianus OX=... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf3462.164e-1026.67zinc finger protein 346 [Source:NCBI gene;Acc:1030... [more]
znf3462.492e-1026.67zinc finger protein 346 [Source:NCBI gene;Acc:1030... [more]
zmat4a2.381e-939.53zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
zmat4a2.801e-939.53zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
zmat4a4.603e-940.74zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zmat4a6.751e-1127.57zinc finger, matrin-type 4a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Matrin-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zgc:1714825.911e-1027.08zinc finger matrin-type protein 4 [Source:NCBI gen... [more]
znf3466.931e-924.06zinc finger protein 346 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Matrin-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072403.10.000e+0100.00SMESG000072403.1[more]
SMESG000003775.11.329e-3133.18SMESG000003775.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013766 ID=SMED30013766|Name=Matrin-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1758bp
GTTTAAATTTAATAATACAGTTAAATAATTTGAAGTAAATATAAATAATT
AAAATTCATCTTGAAATTTTAATAAATGCCTACTGAAACAGTTGATTCGG
AATCTATTCTTGAAGTTAATTATGAAATCGATCCTAGCCTTAATATAGCA
GCTCCACCTGAAGACCTTTCTGATGAAGAAATATTCGATAAATCCAATAA
AATATTACCATATAAGAAAATTAATGAAAACACTTCTGCGGGAAGATTAC
AAATGCGAGTACCGGATGCACCTGATAATTTAATTGAATTGATTTATAGG
AAAAAGTGTTTAGAATGTAGCGCCATTCTAACCACTATTTCAAGTGCATT
AAGTCACTATAACAGTACTAAACATCAAAATAAAATAGCATTAAAATTTT
TACCCCACGGTACTTATAATTTACCTCTTTCCAAAGAAGAAATTCGTGAG
ATTGAAACCGGTGTTAATAAGTCTGGTGAACCAAATGCACCCGGAACAGC
ACCTACAAAATCTTCAAAAATACCCTTTCGAGAACTCGTTAAGAAATTTG
AAATAAATGAAAACGTTCACAAATTGGATTTGGAATTTTGTCGTTTATGC
GAAACTCCATTTTCATCTAAAGTCGCTGCTCTGCAGCATTATTCCGGTAA
AAAACACAAAAAAAATGCAGAAAATTGGTCATCATTCAATCCTATAAAAC
CCATTGACACGAAAGATGATTTACGGTGTGATGTTTGCAATGTAATAGGG
GAATCTGCTGCGCAAATGGAGACGCATTTTGCTGGCAAAAAGCACCAGAT
GAAAATGAAAGCATATCTCGAACGAGTAAATGCTGGTGCTATTGCACCCC
CGATGTCGAGTAGAGGGTTCTGTGATTTCAATAATGTCGAGAGAGAAGAA
GCAAACCCCGTGGATCCTACAAGATTTATCCAGGAAAATATTTTACCGAA
AAATCTAAGTGGTTCATTTTTAAATCCATATGAACCGGAACCTCAACAAT
TCGAAGACAACTATATAGATGAGAGTAATTATGGAATGAAAAGGAACATG
AACTCTGGCTTCGACGAATTTGGAATGAGAGCAGGAGGACCTGTCGCTAT
TGGATATGAACATGAGTATGGAATGAGCATGTCTGGTAATGTTGGTTTCG
ATAGTGAATTTGGAATGAGAAGACCCGGTCCTATGGGATTGGATAATGAA
TTCGGTATGTCAAGGTCCAATAAGGCCGGGTTTGACAACGACTATATGGA
TGATATCAAACCTCCGATTTCATCATTGAATTTTAGGATTAACGTACAGC
CCGATATCAAAAGAAACGTTAGTAACATGCCTGATGATTCCAATCCATAC
ATTGCCCCTCCATGGAGCAGTTCCATTGGTCGGTCACAAATGAGTGCTCC
CTATGCTCCTAATATTCCAAATCGGTACGGTCCCCAGTTTGCAACACAAA
CTTTTGGACCAACTAAATTCAAGTATAGTAGGAAATCACAAATATAATTT
TCTGTTAAATACTGTTAAATAATTAACTGTTATTGTATTGTGTGTTAGTA
ATATATTGCTAATGCTTTAAATTTTGTCTTCAGTTACATTTCTATTTCAT
TGTTACTGTATGTGCTCATATTATATATATATACTAAGGTGCTTTTAATG
GGGTTACATAGAGCTGTCTCCAACACTTGTGTATTGTCATTATCTATACG
TATTCAATTTGTGTATGTTTGTTGGTAAATCAATAAATTTTGTAATTATT
ATGAACCA
back to top

protein sequence of SMED30013766-orf-1

>SMED30013766-orf-1 ID=SMED30013766-orf-1|Name=SMED30013766-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MPTETVDSESILEVNYEIDPSLNIAAPPEDLSDEEIFDKSNKILPYKKIN
ENTSAGRLQMRVPDAPDNLIELIYRKKCLECSAILTTISSALSHYNSTKH
QNKIALKFLPHGTYNLPLSKEEIREIETGVNKSGEPNAPGTAPTKSSKIP
FRELVKKFEINENVHKLDLEFCRLCETPFSSKVAALQHYSGKKHKKNAEN
WSSFNPIKPIDTKDDLRCDVCNVIGESAAQMETHFAGKKHQMKMKAYLER
VNAGAIAPPMSSRGFCDFNNVEREEANPVDPTRFIQENILPKNLSGSFLN
PYEPEPQQFEDNYIDESNYGMKRNMNSGFDEFGMRAGGPVAIGYEHEYGM
SMSGNVGFDSEFGMRRPGPMGLDNEFGMSRSNKAGFDNDYMDDIKPPISS
LNFRINVQPDIKRNVSNMPDDSNPYIAPPWSSSIGRSQMSAPYAPNIPNR
YGPQFATQTFGPTKFKYSRKSQI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR003604Matrin/U1-like-C_Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003604Matrin/U1-C-like, C2H2-type zinc fingerSMARTSM00451ZnF_U1_5coord: 73..107
e-value: 0.082
score: 20.9
coord: 167..201
e-value: 5.4E-4
score: 29.3
coord: 213..247
e-value: 0.023
score: 23.8
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 76..100
e-value: 70.0
score: 5.8
coord: 170..194
e-value: 27.0
score: 9.4
coord: 216..240
e-value: 7.0
score: 14.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 60..107
e-value: 7.3E-7
score: 30.7
coord: 210..251
e-value: 1.0E-8
score: 36.6
NoneNo IPR availablePFAMPF12874zf-metcoord: 217..240
e-value: 1.5E-5
score: 25.2
coord: 171..194
e-value: 6.4E-6
score: 26.4
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 154..200
e-value: 8.8E-11
score: 43.3
NoneNo IPR availablePANTHERPTHR46144FAMILY NOT NAMEDcoord: 163..245
coord: 51..200
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 214..247
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 161..202