C2 domain-containing protein

Overview
NameC2 domain-containing protein
Smed IDSMED30013757
Length (bp)4527
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2 domain-containing protein (SMED30013757) t-SNE clustered cells

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30013757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2 domain-containing protein (SMED30013757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2 domain-containing protein (SMED30013757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:HGNC Symbol;Acc:HGNC:13406])

HSP 1 Score: 130.568 bits (327), Expect = 5.921e-32
Identity = 72/200 (36.00%), Postives = 115/200 (57.50%), Query Frame = 1
Query: 2737 PMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E   + +  G  SA    SSVP         P +   P  + +        D ++  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P     +++ R+T+++  +L+PEW QTV++ +I    L+K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct:   67 PLVLSSVVEKG-SHVHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPG--RGAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 251          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:HGNC Symbol;Acc:HGNC:13406])

HSP 1 Score: 127.872 bits (320), Expect = 1.224e-28
Identity = 74/208 (35.58%), Postives = 117/208 (56.25%), Query Frame = 1
Query: 2737 PMKKSSIIE-SSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E  SH  +  G  SA    SSVP         P +   P  + +        D ++  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +        +++ R+T+++  +L+PEW QTV++ +I    L+K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4637 PLVLSSVVEKGSH--VHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4830          

HSP 2 Score: 99.3673 bits (246), Expect = 6.072e-20
Identity = 47/117 (40.17%), Postives = 76/117 (64.96%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A++   ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4473 LSQHQEQIIQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQT-GKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRL 4588          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:HGNC Symbol;Acc:HGNC:13406])

HSP 1 Score: 127.872 bits (320), Expect = 1.373e-28
Identity = 74/208 (35.58%), Postives = 117/208 (56.25%), Query Frame = 1
Query: 2737 PMKKSSIIE-SSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E  SH  +  G  SA    SSVP         P +   P  + +        D ++  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +        +++ R+T+++  +L+PEW QTV++ +I    L+K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4637 PLVLSSVVEKGSH--VHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4830          

HSP 2 Score: 98.9821 bits (245), Expect = 6.857e-20
Identity = 47/117 (40.17%), Postives = 76/117 (64.96%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A++   ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4473 LSQHQEQIIQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQT-GKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRL 4588          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: PRKCA (protein kinase C alpha [Source:HGNC Symbol;Acc:HGNC:9393])

HSP 1 Score: 87.4261 bits (215), Expect = 9.354e-18
Identity = 46/118 (38.98%), Postives = 73/118 (61.86%), Query Frame = 1
Query: 2983 DQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            D+ L + V  AKN++PMD NGL+DP+VK++L PDP  +S   ++T+ + +TL+P+W ++  F   LK S + R L + +WD+DR   NDFMG     ++    +     WYKL + +E
Sbjct:  170 DEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNES--KQKTKTIRSTLNPQWNESFTFK--LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASG-WYKLLNQEE 282          
BLAST of C2 domain-containing protein vs. Ensembl Human
Match: RIMS1 (regulating synaptic membrane exocytosis 1 [Source:HGNC Symbol;Acc:HGNC:17282])

HSP 1 Score: 89.7373 bits (221), Expect = 4.173e-17
Identity = 50/145 (34.48%), Postives = 88/145 (60.69%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLK--SNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPA 3366
            L G++ + + +D     L ++V +A + LP  ++G   +P+VK+   PD ++ S   R+T+ +   L P+W QT V+ ++ +R  R+R+L+I+VWD  R++   ++F+G+ LI L    +LD +PHWYKL    E  +P L QP+
Sbjct:  742 LPGQLSVKLWYDKVGHQLIVNVLQATD-LPARVDGRPRNPYVKMYFLPDRSDKS--KRRTKTVKKILEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELETA-LLDDEPHWYKLQTHDESSLP-LPQPS 881          

HSP 2 Score: 67.781 bits (164), Expect = 1.992e-10
Identity = 37/112 (33.04%), Postives = 66/112 (58.93%), Query Frame = 1
Query: 2137 KPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDE--IEFLVR--VGPVPK 2460
            +P+K  +    R++L + +      G  +G++++GG++   G LGAFI ++  GS+AD +   ++ GDE++EWNG  L G T EEV +I+     E  +E +V   +G +P+
Sbjct:  588 QPSKEGDRLIGRVILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLAD-VVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPIGDIPR 698          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 84.3445 bits (207), Expect = 5.347e-16
Identity = 42/106 (39.62%), Postives = 64/106 (60.38%), Query Frame = 1
Query: 2146 KNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKS 2463
            +N  +  KR+LL R  K  N+  N +G+R++GG+   +G L A++ Q+   +  ++   QIK GDE++EWNG+ L GKTFEEV  I+     EIE ++R    P S
Sbjct:  871 ENSRYDVKRILLTRSYKHHNIY-NDLGVRVVGGKRQMNGELSAYVSQLH-STANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKSHGEIEMVIRTYKNPSS 974          

HSP 2 Score: 62.003 bits (149), Expect = 4.146e-9
Identity = 38/135 (28.15%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            G IQ+ + +D  +  L   + +A+ +   D +  A +PFVKV L P         R+TR++ ++ +PEW Q + +  +   +L    L+ +V D+ R   +  +G   I LA+K  ++  P WY L    +  IP
Sbjct: 1025 GHIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPG--RKVSHKRRTRFVDSSCAPEWNQVLEY-QVAPHTLNTMFLEFTVCDYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 1155          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 84.3445 bits (207), Expect = 5.347e-16
Identity = 42/106 (39.62%), Postives = 64/106 (60.38%), Query Frame = 1
Query: 2146 KNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKS 2463
            +N  +  KR+LL R  K  N+  N +G+R++GG+   +G L A++ Q+   +  ++   QIK GDE++EWNG+ L GKTFEEV  I+     EIE ++R    P S
Sbjct:  871 ENSRYDVKRILLTRSYKHHNIY-NDLGVRVVGGKRQMNGELSAYVSQLH-STANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKSHGEIEMVIRTYKNPSS 974          

HSP 2 Score: 62.003 bits (149), Expect = 4.146e-9
Identity = 38/135 (28.15%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            G IQ+ + +D  +  L   + +A+ +   D +  A +PFVKV L P         R+TR++ ++ +PEW Q + +  +   +L    L+ +V D+ R   +  +G   I LA+K  ++  P WY L    +  IP
Sbjct: 1025 GHIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPG--RKVSHKRRTRFVDSSCAPEWNQVLEY-QVAPHTLNTMFLEFTVCDYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 1155          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 84.3445 bits (207), Expect = 8.726e-16
Identity = 42/106 (39.62%), Postives = 64/106 (60.38%), Query Frame = 1
Query: 2146 KNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKS 2463
            +N  +  KR+LL R  K  N+  N +G+R++GG+   +G L A++ Q+   +  ++   QIK GDE++EWNG+ L GKTFEEV  I+     EIE ++R    P S
Sbjct: 8562 ENSRYDVKRILLTRSYKHHNIY-NDLGVRVVGGKRQMNGELSAYVSQLH-STANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKSHGEIEMVIRTYKNPSS 8665          

HSP 2 Score: 60.077 bits (144), Expect = 1.654e-8
Identity = 38/135 (28.15%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            G IQ+ + +D  +  L   + +A+ +   D +  A +PFVKV L P         R+TR++ ++ +PEW Q + +  +   +L    L+ +V D+ R   +  +G   I LA+K  ++  P WY L    +  IP
Sbjct: 8716 GHIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPG--RKVSHKRRTRFVDSSCAPEWNQVLEY-QVAPHTLNTMFLEFTVCDYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 8846          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: cla-1 (CLArinet, functional homolog of cytomatrix at the active zone proteins piccolo and fife [Source:RefSeq peptide;Acc:NP_001294143])

HSP 1 Score: 83.5741 bits (205), Expect = 1.073e-15
Identity = 42/106 (39.62%), Postives = 64/106 (60.38%), Query Frame = 1
Query: 2146 KNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKS 2463
            +N  +  KR+LL R  K  N+  N +G+R++GG+   +G L A++ Q+   +  ++   QIK GDE++EWNG+ L GKTFEEV  I+     EIE ++R    P S
Sbjct: 2282 ENSRYDVKRILLTRSYKHHNIY-NDLGVRVVGGKRQMNGELSAYVSQLH-STANNQTLGQIKIGDEVVEWNGILLRGKTFEEVERIVNKSHGEIEMVIRTYKNPSS 2385          

HSP 2 Score: 61.6178 bits (148), Expect = 6.223e-9
Identity = 38/135 (28.15%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            G IQ+ + +D  +  L   + +A+ +   D +  A +PFVKV L P         R+TR++ ++ +PEW Q + +  +   +L    L+ +V D+ R   +  +G   I LA+K  ++  P WY L    +  IP
Sbjct: 2436 GHIQVSLGYDG-NSRLVAKIIRARGLKSRDQSRSAPNPFVKVYLLPG--RKVSHKRRTRFVDSSCAPEWNQVLEY-QVAPHTLNTMFLEFTVCDYQRDVDDLPLGNVQIPLADKSAINTGPRWYPLQGSYDQPIP 2566          
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 83.1889 bits (204), Expect = 1.238e-15
Identity = 40/111 (36.04%), Postives = 67/111 (60.36%), Query Frame = 1
Query: 2944 LGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            LG I L +++   D+ L +H+ +AKN+  MD NG +DP+VK  L P  T+ +    +T  +  TL+PEW + + +  I +    K++L ++V D DR+ S DF+G+  I+L
Sbjct:  675 LGSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGFSDPYVKFHLLPGNTKATKLTSKT--IEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGS-DFLGETRIAL 782          

HSP 2 Score: 62.003 bits (149), Expect = 3.934e-9
Identity = 35/113 (30.97%), Postives = 59/113 (52.21%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANK 3285
            G+I + + ++    SL I++ +   ++ MD  G +DP+ KV L   P        +T     TL+PEW + + F+   K  L K+ L I V+D D  K +D++G  L+S + K
Sbjct:  816 GKINVGLQYNIQQGSLFININRCVELVGMDSTGFSDPYCKVSL--TPITSKAHRAKTSTKKRTLNPEWNEQLQFVVPFK-DLPKKTLQIGVYDHDLGKHDDYIGGILLSTSAK 925          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Fife (gene:FBgn0264606 transcript:FBtr0333630)

HSP 1 Score: 88.9669 bits (219), Expect = 1.482e-17
Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 1
Query: 2167 KRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLV 2439
            +R++L RD  +K  R  G GMR++GG+  +DG L A+I    PG  A++  + +++GD+++EWNG+SL+ ++FEEV SI+    D +E LV
Sbjct:  491 RRIILRRDPTDKAHRTRGFGMRVVGGKTGADGRLFAYIVWTVPGGAAEK--NGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGDVVELLV 579          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Fife (gene:FBgn0264606 transcript:FBtr0333631)

HSP 1 Score: 88.9669 bits (219), Expect = 1.482e-17
Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 1
Query: 2167 KRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLV 2439
            +R++L RD  +K  R  G GMR++GG+  +DG L A+I    PG  A++  + +++GD+++EWNG+SL+ ++FEEV SI+    D +E LV
Sbjct:  491 RRIILRRDPTDKAHRTRGFGMRVVGGKTGADGRLFAYIVWTVPGGAAEK--NGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGDVVELLV 579          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Fife (gene:FBgn0264606 transcript:FBtr0333629)

HSP 1 Score: 87.8113 bits (216), Expect = 5.495e-17
Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 1
Query: 2167 KRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLV 2439
            +R++L RD  +K  R  G GMR++GG+  +DG L A+I    PG  A++  + +++GD+++EWNG+SL+ ++FEEV SI+    D +E LV
Sbjct:  491 RRIILRRDPTDKAHRTRGFGMRVVGGKTGADGRLFAYIVWTVPGGAAEK--NGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGDVVELLV 579          

HSP 2 Score: 54.6842 bits (130), Expect = 7.752e-7
Identity = 48/182 (26.37%), Postives = 76/182 (41.76%), Query Frame = 1
Query: 2869 GPVNTNESEKDEVDNDKS--------------QNQSEKLL-GEIQLIISFDDYDQSLTIHVAKAKNMLPMD----LNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLR 3357
            GPV      + E   DKS              Q   EKL+ G +Q+ + +      L + +    ++ P D       L + + KVR+ P   + S   +QT     T +P W  T+ F ++   +L  R +DI +WD      + F+G+  I L  +  LD +  W +L D K     GLR
Sbjct:  612 GPVGLGLIAEPETTTDKSPASPTRRKLPKTPEQIAREKLVTGRVQIQVWYHAERSELVVSLMAGDDLAPRDEAYGHGNLPEAYAKVRILPKCGDGS--VQQTEVSRPTQNPIWNATLTFGHVKADTLMVRYIDIQLWDLVPHTESIFLGECSIEL-QQAFLDDQAIWCRLEDTK-----GLR 785          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Fife (gene:FBgn0264606 transcript:FBtr0333632)

HSP 1 Score: 87.8113 bits (216), Expect = 5.993e-17
Identity = 38/91 (41.76%), Postives = 62/91 (68.13%), Query Frame = 1
Query: 2167 KRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLV 2439
            +R++L RD  +K  R  G GMR++GG+  +DG L A+I    PG  A++  + +++GD+++EWNG+SL+ ++FEEV SI+    D +E LV
Sbjct:  491 RRIILRRDPTDKAHRTRGFGMRVVGGKTGADGRLFAYIVWTVPGGAAEK--NGLQQGDKILEWNGMSLIDRSFEEVCSIMDRTGDVVELLV 579          

HSP 2 Score: 55.0694 bits (131), Expect = 6.984e-7
Identity = 48/182 (26.37%), Postives = 76/182 (41.76%), Query Frame = 1
Query: 2869 GPVNTNESEKDEVDNDKS--------------QNQSEKLL-GEIQLIISFDDYDQSLTIHVAKAKNMLPMD----LNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLR 3357
            GPV      + E   DKS              Q   EKL+ G +Q+ + +      L + +    ++ P D       L + + KVR+ P   + S   +QT     T +P W  T+ F ++   +L  R +DI +WD      + F+G+  I L  +  LD +  W +L D K     GLR
Sbjct:  612 GPVGLGLIAEPETTTDKSPASPTRRKLPKTPEQIAREKLVTGRVQIQVWYHAERSELVVSLMAGDDLAPRDEAYGHGNLPEAYAKVRILPKCGDGS--VQQTEVSRPTQNPIWNATLTFGHVKADTLMVRYIDIQLWDLVPHTESIFLGECSIEL-QQAFLDDQAIWCRLEDTK-----GLR 785          
BLAST of C2 domain-containing protein vs. Ensembl Fly
Match: Rim (gene:FBgn0053547 transcript:FBtr0336721)

HSP 1 Score: 82.0333 bits (201), Expect = 4.659e-15
Identity = 39/125 (31.20%), Postives = 68/125 (54.40%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKL 3321
            G +QL + +D     L + +  A  +         +P+ KV L PD +  S   R+T+ +  T  P W QT V+  + +  L  R+L++++WD+ R  +NDF+G+ +I LA+  +LD +  WY+L
Sbjct:  840 GRLQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKS--KRRTKTVGTTCEPRWGQTFVYSGLRRCDLNGRLLEVTLWDYVRYGANDFIGEVVIDLAH-HILDDEAEWYQL 961          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: pcloa (piccolo presynaptic cytomatrix protein a [Source:ZFIN;Acc:ZDB-GENE-030131-8115])

HSP 1 Score: 134.42 bits (337), Expect = 7.431e-31
Identity = 76/199 (38.19%), Postives = 115/199 (57.79%), Query Frame = 1
Query: 2755 IIESSHAELDCGSPSASRRISSVPI-----EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +  SS + LD   PSAS   S+VP       P+  +KR SK+               ++ ++ QS  + GEIQL I++D    +L +HV +A+N+ P D NG +DPFVKV L P     ++  R+++++  TL+PEW QTV++ NI    LRK+ L++SVWD+D+  +NDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 3601 VPSSSASALD--KPSASAGSSAVPSPGQPGSPSVSKKRHSKN---------------SEGTKTQSHPVSGEIQLQINYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPG--RGAENKRRSKHVQKTLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKSSANDFLGEVLIDLSNTAQLDNVPRWLPLKEQSE 3780          

HSP 2 Score: 96.2857 bits (238), Expect = 2.806e-19
Identity = 39/101 (38.61%), Postives = 71/101 (70.30%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L+RD K++++ GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWN +SL GKT+EEV+ ++ +   E E  +R+
Sbjct: 3455 HYPFPHARIKLLRDPKDRSVSGNGLGIRVVGGKEVPGSNGDIGAYVAKVLPGGAAEQT-GKIVEGMQVLEWNNISLSGKTYEEVQGLVGHQVGEAELCIRL 3554          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: pcloa (piccolo presynaptic cytomatrix protein a [Source:ZFIN;Acc:ZDB-GENE-030131-8115])

HSP 1 Score: 134.42 bits (337), Expect = 7.625e-31
Identity = 76/199 (38.19%), Postives = 115/199 (57.79%), Query Frame = 1
Query: 2755 IIESSHAELDCGSPSASRRISSVPI-----EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +  SS + LD   PSAS   S+VP       P+  +KR SK+               ++ ++ QS  + GEIQL I++D    +L +HV +A+N+ P D NG +DPFVKV L P     ++  R+++++  TL+PEW QTV++ NI    LRK+ L++SVWD+D+  +NDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 3678 VPSSSASALD--KPSASAGSSAVPSPGQPGSPSVSKKRHSKN---------------SEGTKTQSHPVSGEIQLQINYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPG--RGAENKRRSKHVQKTLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKSSANDFLGEVLIDLSNTAQLDNVPRWLPLKEQSE 3857          

HSP 2 Score: 96.2857 bits (238), Expect = 3.267e-19
Identity = 39/101 (38.61%), Postives = 71/101 (70.30%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L+RD K++++ GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWN +SL GKT+EEV+ ++ +   E E  +R+
Sbjct: 3532 HYPFPHARIKLLRDPKDRSVSGNGLGIRVVGGKEVPGSNGDIGAYVAKVLPGGAAEQT-GKIVEGMQVLEWNNISLSGKTYEEVQGLVGHQVGEAELCIRL 3631          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: pcloa (piccolo presynaptic cytomatrix protein a [Source:ZFIN;Acc:ZDB-GENE-030131-8115])

HSP 1 Score: 131.724 bits (330), Expect = 5.635e-30
Identity = 76/206 (36.89%), Postives = 116/206 (56.31%), Query Frame = 1
Query: 2755 IIESSHAELDCGSPSASRRISSVPI-----EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +  SS + LD   PSAS   S+VP       P+  +KR SK+               ++ ++ QS  + GEIQL I++D    +L +HV +A+N+ P D NG +DPFVKV L P   +        ++  R+++++  TL+PEW QTV++ NI    LRK+ L++SVWD+D+  +NDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 4383 VPSSSASALD--KPSASAGSSAVPSPGQPGSPSVSKKRHSKN---------------SEGTKTQSHPVSGEIQLQINYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAENKRRSKHVQKTLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKSSANDFLGEVLIDLSNTAQLDNVPRWLPLKEQSE 4571          

HSP 2 Score: 96.2857 bits (238), Expect = 3.019e-19
Identity = 39/101 (38.61%), Postives = 71/101 (70.30%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L+RD K++++ GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWN +SL GKT+EEV+ ++ +   E E  +R+
Sbjct: 4237 HYPFPHARIKLLRDPKDRSVSGNGLGIRVVGGKEVPGSNGDIGAYVAKVLPGGAAEQT-GKIVEGMQVLEWNNISLSGKTYEEVQGLVGHQVGEAELCIRL 4336          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: pcloa (piccolo presynaptic cytomatrix protein a [Source:ZFIN;Acc:ZDB-GENE-030131-8115])

HSP 1 Score: 131.339 bits (329), Expect = 6.186e-30
Identity = 76/206 (36.89%), Postives = 116/206 (56.31%), Query Frame = 1
Query: 2755 IIESSHAELDCGSPSASRRISSVPI-----EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +  SS + LD   PSAS   S+VP       P+  +KR SK+               ++ ++ QS  + GEIQL I++D    +L +HV +A+N+ P D NG +DPFVKV L P   +        ++  R+++++  TL+PEW QTV++ NI    LRK+ L++SVWD+D+  +NDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 3559 VPSSSASALD--KPSASAGSSAVPSPGQPGSPSVSKKRHSKN---------------SEGTKTQSHPVSGEIQLQINYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAENKRRSKHVQKTLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKSSANDFLGEVLIDLSNTAQLDNVPRWLPLKEQSE 3747          

HSP 2 Score: 96.2857 bits (238), Expect = 2.944e-19
Identity = 39/101 (38.61%), Postives = 71/101 (70.30%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L+RD K++++ GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWN +SL GKT+EEV+ ++ +   E E  +R+
Sbjct: 3413 HYPFPHARIKLLRDPKDRSVSGNGLGIRVVGGKEVPGSNGDIGAYVAKVLPGGAAEQT-GKIVEGMQVLEWNNISLSGKTYEEVQGLVGHQVGEAELCIRL 3512          
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Match: pcloa (piccolo presynaptic cytomatrix protein a [Source:ZFIN;Acc:ZDB-GENE-030131-8115])

HSP 1 Score: 131.339 bits (329), Expect = 6.260e-30
Identity = 76/206 (36.89%), Postives = 116/206 (56.31%), Query Frame = 1
Query: 2755 IIESSHAELDCGSPSASRRISSVPI-----EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +  SS + LD   PSAS   S+VP       P+  +KR SK+               ++ ++ QS  + GEIQL I++D    +L +HV +A+N+ P D NG +DPFVKV L P   +        ++  R+++++  TL+PEW QTV++ NI    LRK+ L++SVWD+D+  +NDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 4383 VPSSSASALD--KPSASAGSSAVPSPGQPGSPSVSKKRHSKN---------------SEGTKTQSHPVSGEIQLQINYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAENKRRSKHVQKTLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKSSANDFLGEVLIDLSNTAQLDNVPRWLPLKEQSE 4571          

HSP 2 Score: 95.9005 bits (237), Expect = 3.522e-19
Identity = 39/101 (38.61%), Postives = 71/101 (70.30%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L+RD K++++ GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWN +SL GKT+EEV+ ++ +   E E  +R+
Sbjct: 4237 HYPFPHARIKLLRDPKDRSVSGNGLGIRVVGGKEVPGSNGDIGAYVAKVLPGGAAEQT-GKIVEGMQVLEWNNISLSGKTYEEVQGLVGHQVGEAELCIRL 4336          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:NCBI gene;Acc:100494439])

HSP 1 Score: 163.31 bits (412), Expect = 1.775e-39
Identity = 114/398 (28.64%), Postives = 186/398 (46.73%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSD--GHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +Y FP  R+ L RD+K+  + GNG G+R++GG+      G  GA+I +I PG  A+    ++ EG +++EWNG SL GKT+EEV+SI+   S E E  VR+                 D N + N   T +N+ + +T      +++K  +   D     A           Q + +Q+   +              S M+K S I S       G+ SA       P +P           G  + ++        +  ++ S  + GE+Q+   F++    +      A  +        ++  VKV L P     +++ R+T+Y+  +L+PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P WY L +  E
Sbjct: 1997 HYAFPHSRIKLQRDAKDHTVSGNGFGIRVVGGKEIPGNPGGTGAYIAKILPGGDAEHT-GRLTEGMQVLEWNGFSLTGKTYEEVQSIISQSSGEAELCVRL-----------------DFNMLSNC-ETPQNLELHDTGK----ALEKTRSPGVDPKQLAAEL---------QKVSQQQTPSF------------VSSAMEKGSYIHS-------GTTSAGSSAVPSPGQP-----------GSPSVSKKRHSSKSTEAIKSHSHPITGELQV---FNNNHLCILCITCGAFGVF------FSEEKVKVYLLPG--RGTEYKRRTKYVQKSLNPEWNQTVIYKNISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSNASNLDNIPRWYFLKEQSE 2321          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:NCBI gene;Acc:100494439])

HSP 1 Score: 97.0561 bits (240), Expect = 2.650e-19
Identity = 44/101 (43.56%), Postives = 65/101 (64.36%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSD--GHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L RD+K+  + GNG G+R++GG+      G  GA+I +I PG  A+    ++ EG +++EWNG SL GKT+EEV+SI+   S E E  VR+
Sbjct: 2971 HYAFPHSRIKLQRDAKDHTVSGNGFGIRVVGGKEIPGNPGGTGAYIAKILPGGDAEHT-GRLTEGMQVLEWNGFSLTGKTYEEVQSIISQSSGEAELCVRL 3070          

HSP 2 Score: 93.5893 bits (231), Expect = 2.638e-18
Identity = 36/80 (45.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3097 SDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +++ R+T+Y+  +L+PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P WY L +  E
Sbjct: 3202 TEYKRRTKYVQKSLNPEWNQTVIYKNISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSNASNLDNIPRWYFLKEQSE 3281          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:NCBI gene;Acc:100494439])

HSP 1 Score: 96.6709 bits (239), Expect = 3.424e-19
Identity = 44/101 (43.56%), Postives = 65/101 (64.36%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSD--GHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L RD+K+  + GNG G+R++GG+      G  GA+I +I PG  A+    ++ EG +++EWNG SL GKT+EEV+SI+   S E E  VR+
Sbjct: 1997 HYAFPHSRIKLQRDAKDHTVSGNGFGIRVVGGKEIPGNPGGTGAYIAKILPGGDAEHT-GRLTEGMQVLEWNGFSLTGKTYEEVQSIISQSSGEAELCVRL 2096          

HSP 2 Score: 92.8189 bits (229), Expect = 4.546e-18
Identity = 36/80 (45.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3097 SDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +++ R+T+Y+  +L+PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P WY L +  E
Sbjct: 2231 TEYKRRTKYVQKSLNPEWNQTVIYKNISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSNASNLDNIPRWYFLKEQSE 2310          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: PCLO (piccolo presynaptic cytomatrix protein [Source:NCBI gene;Acc:100494439])

HSP 1 Score: 96.2857 bits (238), Expect = 3.732e-19
Identity = 44/101 (43.56%), Postives = 65/101 (64.36%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSD--GHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            +Y FP  R+ L RD+K+  + GNG G+R++GG+      G  GA+I +I PG  A+    ++ EG +++EWNG SL GKT+EEV+SI+   S E E  VR+
Sbjct: 1997 HYAFPHSRIKLQRDAKDHTVSGNGFGIRVVGGKEIPGNPGGTGAYIAKILPGGDAEH-TGRLTEGMQVLEWNGFSLTGKTYEEVQSIISQSSGEAELCVRL 2096          

HSP 2 Score: 92.8189 bits (229), Expect = 4.956e-18
Identity = 36/80 (45.00%), Postives = 56/80 (70.00%), Query Frame = 1
Query: 3097 SDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            +++ R+T+Y+  +L+PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P WY L +  E
Sbjct: 2231 TEYKRRTKYVQKSLNPEWNQTVIYKNISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSNASNLDNIPRWYFLKEQSE 2310          
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Match: RPH3A (rabphilin 3A [Source:NCBI gene;Acc:100487950])

HSP 1 Score: 88.5817 bits (218), Expect = 8.168e-18
Identity = 53/161 (32.92%), Postives = 88/161 (54.66%), Query Frame = 1
Query: 2800 ASRRISSVPI--EPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            A+   SSVP    P+A+Q +   +       E E +  D+D++       LG ++  + +D  + SL   + KAK + PMD NGLADP+VK+ L P  ++ +    +T+ + NT +P W +T+V+  I    L+++ L ISV D D+   N+F+G+   SL
Sbjct:   50 AASYTSSVPTVAAPSARQPQTQDE------EEEEANSYDSDEATT-----LGSLEFSLFYDQENNSLHCGIIKAKGLKPMDSNGLADPYVKLHLLPGASKANKL--RTKTLRNTRNPIWNETLVYHGITDEELQRKTLRISVCDEDKFGHNEFIGETRFSL 197          

HSP 2 Score: 75.485 bits (184), Expect = 1.542e-13
Identity = 45/147 (30.61%), Postives = 78/147 (53.06%), Query Frame = 1
Query: 2905 VDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDI 3345
            + ND+  +  E+  G+I + + ++     L + + +  ++  MD NG +DPFVK+ L PD  + +    +T+    TL+PE+ +   F  I    L K+ LD+SVWD+D  KSND++G   + +  K   +   HWY+    K+  I
Sbjct:  216 IPNDRGGDVEER--GKILVSLMYNTQQGGLIVGIVRCVHLAAMDANGYSDPFVKLWLKPDMGKKA--KNKTQIKKKTLNPEFNEEF-FYEIKHSDLAKKQLDVSVWDYDIGKSNDYIGGCQLGINAKG--ERLKHWYECLKNKDKKI 355          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Pclo (piccolo (presynaptic cytomatrix protein) [Source:MGI Symbol;Acc:MGI:1349390])

HSP 1 Score: 130.183 bits (326), Expect = 1.078e-29
Identity = 75/207 (36.23%), Postives = 113/207 (54.59%), Query Frame = 1
Query: 2737 PMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E   A    G  SA    SSVP         P +   P  + +        D S+  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +         ++ R+T+Y+  +L+PEW QTV++ +I    L K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 1294 PLVMSSVVEKG-AHAHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 1487          

HSP 2 Score: 95.9005 bits (237), Expect = 3.669e-19
Identity = 47/117 (40.17%), Postives = 75/117 (64.10%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A+    ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 1130 LSQHQEQILQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEH-SGKLIEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRL 1245          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Pclo (piccolo (presynaptic cytomatrix protein) [Source:MGI Symbol;Acc:MGI:1349390])

HSP 1 Score: 130.568 bits (327), Expect = 1.250e-29
Identity = 75/207 (36.23%), Postives = 113/207 (54.59%), Query Frame = 1
Query: 2737 PMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E   A    G  SA    SSVP         P +   P  + +        D S+  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +         ++ R+T+Y+  +L+PEW QTV++ +I    L K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4565 PLVMSSVVEKG-AHAHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4758          

HSP 2 Score: 97.4413 bits (241), Expect = 1.559e-19
Identity = 47/117 (40.17%), Postives = 75/117 (64.10%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A+    ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4401 LSQHQEQILQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEH-SGKLIEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRL 4516          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Pclo (piccolo (presynaptic cytomatrix protein) [Source:MGI Symbol;Acc:MGI:1349390])

HSP 1 Score: 130.568 bits (327), Expect = 1.438e-29
Identity = 75/207 (36.23%), Postives = 113/207 (54.59%), Query Frame = 1
Query: 2737 PMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E   A    G  SA    SSVP         P +   P  + +        D S+  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +         ++ R+T+Y+  +L+PEW QTV++ +I    L K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4565 PLVMSSVVEKG-AHAHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4758          

HSP 2 Score: 97.0561 bits (240), Expect = 1.981e-19
Identity = 47/117 (40.17%), Postives = 75/117 (64.10%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A+    ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4401 LSQHQEQILQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEH-SGKLIEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRL 4516          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Prkca (protein kinase C, alpha [Source:MGI Symbol;Acc:MGI:97595])

HSP 1 Score: 87.4261 bits (215), Expect = 8.481e-17
Identity = 46/118 (38.98%), Postives = 73/118 (61.86%), Query Frame = 1
Query: 2983 DQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            D+ L + V  AKN++PMD NGL+DP+VK++L PDP  +S   ++T+ + +TL+P+W ++  F   LK S + R L + +WD+DR   NDFMG     ++    +     WYKL + +E
Sbjct:  170 DEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNES--KQKTKTIRSTLNPQWNESFTFK--LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASG-WYKLLNQEE 282          
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Match: Doc2b (double C2, beta [Source:MGI Symbol;Acc:MGI:1100497])

HSP 1 Score: 85.5001 bits (210), Expect = 9.292e-17
Identity = 42/127 (33.07%), Postives = 74/127 (58.27%), Query Frame = 1
Query: 2896 KDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            +DE D D  ++     LG +   + +D  + +L   ++KAK + PMD NGLADP+VK+ L P  ++ +    +T+ + NTL+P W +T+ +  I    + ++ L ISV D D+ + N+F+G+  + L
Sbjct:  111 EDEPDVDGYESDDCTALGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKL--RTKTLRNTLNPSWNETLTYYGITDEDMVRKTLRISVCDEDKFRHNEFIGETRVPL 235          

HSP 2 Score: 77.0258 bits (188), Expect = 6.143e-14
Identity = 41/134 (30.60%), Postives = 73/134 (54.48%), Query Frame = 1
Query: 2914 DKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWY 3315
            DK++++S +  G I + + +    Q L + + +  ++  MD NG +DP+VK  L PD  + S    +T     TL+PE+ +   +  I    L K+ L+++VWD+D  KSNDF+G  ++ +  K   +   HW+
Sbjct:  257 DKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPDVDKKS--KHKTAVKKKTLNPEFNEEFCY-EIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKG--ERLKHWF 385          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9PU36|PCLO_CHICK (Protein piccolo (Fragment) OS=Gallus gallus OX=9031 GN=PCLO PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.740e-30
Identity = 60/148 (40.54%), Postives = 96/148 (64.86%), Query Frame = 1
Query: 2914 DKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            + +++ S  + GEIQL I++D +  +L IH+ +A+N+ P D NG +DPFVKV L P   +        +++ R+T+Y+  +L+PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4602 EATKSGSHPITGEIQLQINYDKHLGNLIIHILQARNLAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKNISTEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSVSQLDNTPRWYPLKEQSE 4749          

HSP 2 Score: 96.6709 bits (239), Expect = 1.600e-18
Identity = 43/101 (42.57%), Postives = 66/101 (65.35%), Query Frame = 1
Query: 2149 NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
             Y FP  RL L+RD K+  + GNG+G+R++GG+    S G +GA+I ++ PG  A++    I EG +++EWNG+ L GKT+EEV++I+     E E  VR+
Sbjct: 4407 QYIFPHARLKLLRDPKDHTVSGNGLGIRVVGGKEIPGSSGEIGAYIAKVLPGGNAEQTGKLI-EGMQVLEWNGIPLTGKTYEEVQNIIIQQCGEAEICVRL 4506          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JKS6|PCLO_RAT (Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 7.187e-29
Identity = 76/208 (36.54%), Postives = 115/208 (55.29%), Query Frame = 1
Query: 2737 PMKKSSIIE-SSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E  SHA    G  SA    SSVP         P +   P  + +        D  +  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +        +++ R+T+Y+  +L+PEW QTV++ +I    L K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4582 PLVMSSVVEKGSHAH--SGPTSAGS--SSVP--------SPGQPGSPSVSKKKHSSTKPTDGPKAASHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4775          

HSP 2 Score: 92.4337 bits (228), Expect = 3.415e-17
Identity = 47/117 (40.17%), Postives = 72/117 (61.54%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RD K+    GNG+G+RI+GG+      G +GA+I +I PG  A+     + EG +++EWNGV L  KT+EEV+SI+   S E E  VR+
Sbjct: 4419 LSQHQEQILQMNGKTIHYIFPHARVKITRDFKDHTGSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGESAEHT-GPLMEGMQVLEWNGVPLTSKTYEEVQSIINQQSGEAEICVRL 4534          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9QYX7|PCLO_MOUSE (Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4)

HSP 1 Score: 130.568 bits (327), Expect = 1.006e-28
Identity = 75/207 (36.23%), Postives = 113/207 (54.59%), Query Frame = 1
Query: 2737 PMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E   A    G  SA    SSVP         P +   P  + +        D S+  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +         ++ R+T+Y+  +L+PEW QTV++ +I    L K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4565 PLVMSSVVEKG-AHAHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGGSKPTDVSKTASHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASVEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4758          

HSP 2 Score: 97.0561 bits (240), Expect = 1.386e-18
Identity = 47/117 (40.17%), Postives = 75/117 (64.10%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A+    ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4401 LSQHQEQILQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEH-SGKLIEGMQVLEWNGIPLTSKTYEEVQSIINQQSGEAEICVRL 4516          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y6V0|PCLO_HUMAN (Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5)

HSP 1 Score: 127.872 bits (320), Expect = 6.592e-28
Identity = 74/208 (35.58%), Postives = 117/208 (56.25%), Query Frame = 1
Query: 2737 PMKKSSIIE-SSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            P+  SS++E  SH  +  G  SA    SSVP         P +   P  + +        D ++  S  + GEIQL I++D  +  L IH+ +A+N++P D NG +DPFVKV L P   +        +++ R+T+++  +L+PEW QTV++ +I    L+K+ L+++VWD+DR  SNDF+G+ LI L++   LD  P WY L +  E
Sbjct: 4637 PLVLSSVVEKGSH--VHSGPTSAGS--SSVP--------SPGQPGSPSVSKKKHGSSKPTDGTKVVSHPITGEIQLQINYDLGN--LIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTKHVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE 4830          

HSP 2 Score: 98.9821 bits (245), Expect = 3.293e-19
Identity = 47/117 (40.17%), Postives = 76/117 (64.96%), Query Frame = 1
Query: 2110 LNQKKIEIVKPNK---NYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            L+Q + +I++ N    +Y FP  R+ + RDSK+  + GNG+G+RI+GG+      G +GA+I +I PG  A++   ++ EG +++EWNG+ L  KT+EEV+SI+   S E E  VR+
Sbjct: 4473 LSQHQEQIIQMNGKTMHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGGSAEQT-GKLMEGMQVLEWNGIPLTSKTYEEVQSIISQQSGEAEICVRL 4588          
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P70610|DOC2B_RAT (Double C2-like domain-containing protein beta OS=Rattus norvegicus OX=10116 GN=Doc2b PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 1.731e-16
Identity = 42/127 (33.07%), Postives = 74/127 (58.27%), Query Frame = 1
Query: 2896 KDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            +DE D D  ++     LG +   + +D  + +L   ++KAK + PMD NGLADP+VK+ L P  ++ +    +T+ + NTL+P W +T+ +  I    + ++ L ISV D D+ + N+F+G+  + L
Sbjct:  111 EDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTISKAKGLKPMDHNGLADPYVKLHLLPGASKANKL--RTKTLRNTLNPSWNETLTYYGITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPL 235          

HSP 2 Score: 77.411 bits (189), Expect = 3.091e-13
Identity = 41/134 (30.60%), Postives = 72/134 (53.73%), Query Frame = 1
Query: 2914 DKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWY 3315
            DK++++S +  G I + + +    Q L + + +  ++  MD NG +DP+VK  L PD   D     +T     TL+PE+ +   +  I    L K+ L+++VWD+D  KSNDF+G  ++ +  K   +   HW+
Sbjct:  257 DKAEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANGYSDPYVKTYLKPD--VDKKSKHKTAVKKKTLNPEFNEEFCY-EIKHGDLAKKTLEVTVWDYDIGKSNDFIGGVVLGINAKG--ERLKHWF 385          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A4S2LJ54 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006833 PE=4 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 1.162e-91
Identity = 191/437 (43.71%), Postives = 275/437 (62.93%), Query Frame = 1
Query: 2146 KNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV-GPVPKSTDTSKSSSEIPDE---NQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFN-------ESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSS-----------IIESSHAELDCGSPSASRRISS--VPIEPTAKQKRPSKDVGPVNT---NESEKDEVD-----NDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQ 3360
            + Y+FPTKRLLLMRDSK++  R NG+GMRI+GG + SDG LGAF+E+I P    D+L  +I+EGDE++EWN + LV KTFEEV++I+   ++E EFLVR     P++T         P++   N+ K++    + +     A    + M++          PH   +       E   H  T SI    AQ+   + S++T   +  S  +KSS           +     +EL   +   S+R S+    + PT   +   +   P+++    E +K  +      +DK+++  E+  GEI+LI++FDD+DQSLT+HV++A+++ PMDLNGLADPFVKVRLHPDPTED DFNRQT+YM NTL+PEWQQTVVFMN  KR+L++RVL+++VWDFDRLK+NDFMGQALI+L +KQ+LDG+PHWY L  M+ V +P  ++
Sbjct: 2276 RTYDFPTKRLLLMRDSKDRYQRENGIGMRIVGGHIRSDGRLGAFVEEIDPRGPVDQLHGEIREGDEILEWNSIPLVDKTFEEVQAIINQVTEETEFLVRARKDEPQTTTRQPWERSFPEDDARNENKHIMQRVDALCHHHAAQQALMGMQQRPT------CPHMQTHFQALPPSEQCVHSHTASIT---AQQSRGQYSSSTGSESAHSSERKSSGRQPVSITVTEVTSRPESELYKQNSFESQRTSTHERTMSPTVDGRGQEELQSPISSRSPTERKKGRLGSLTNRDDKAEDIPEE-FGEIELILTFDDFDQSLTVHVSRARDLPPMDLNGLADPFVKVRLHPDPTEDPDFNRQTKYMPNTLTPEWQQTVVFMNCFKRTLKRRVLEVTVWDFDRLKTNDFMGQALINLGDKQLLDGRPHWYPLHKMEPVILPSAKK 2702          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A183A9Y7 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS3772 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 1.255e-71
Identity = 153/365 (41.92%), Postives = 220/365 (60.27%), Query Frame = 1
Query: 2215 NGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV---GPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIE-------PTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLA 3279
            NG+GMRI+GG + SDG LGAF+E+I+P   AD+L  +I+EGDE++EWN + LVGKTFEEV+SI+   S+E E LVR    G   + +      S  P +++  +     + +     A    + ++  S      +M     + S S  R   I  Q +       + + + ++     +KSS  ++    L  G P    R S V          P A +   S+D+   + ++S   +  +  + +   +  G  +LI++FDDYDQSLT+HV++A+++  MDLNGLADPFVKVRLHPDPTED DFNRQT+YM NTL+PEWQQTVVFMN  KR+L++RVL+++VWDFDRLK+NDFMGQ LI+L 
Sbjct: 2033 NGIGMRIVGGHIRSDGKLGAFVEEIYPRGPADQLHGEIREGDEILEWNSIPLVGKTFEEVQSIISQVSEETELLVRARHDGSTERESSQPWEISRTPVDSRSSHAPKRVDALCHHHAAQQALIGIQSRSMCP---HMQRHYLSMSPSEIRQSPIGLQSSTRTRSSPTGSDSNSSN---ARKSSTGQA----LWMGGPDPGTRESPVSHTRTHPYSPPHASRASESRDLEDFDVDDSRPFDHQSQSTNSYKRERSGSFKLILTFDDYDQSLTVHVSRARDLPSMDLNGLADPFVKVRLHPDPTEDPDFNRQTKYMPNTLTPEWQQTVVFMNCFKRTLKRRVLEVTVWDFDRLKTNDFMGQTLINLG 2387          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: W6UJX4 (Protein piccolo OS=Echinococcus granulosus OX=6210 GN=EGR_03849 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 2.529e-65
Identity = 101/143 (70.63%), Postives = 122/143 (85.31%), Query Frame = 1
Query: 2944 LGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHR 3372
             GEI+LI++FDDYDQSLT HVA+A+ + PMDLNGLADPFVK+RLHPDPTED D NRQ +Y+ NTL PEWQQTVVFMN LKR+L+KRVL+ +VWDFDRLK NDFMGQA+I L +K+ LDG+PHWYKL  ++++ IPG RQP  R
Sbjct:  200 FGEIELILTFDDYDQSLTAHVARARGLRPMDLNGLADPFVKLRLHPDPTEDVDLNRQIKYIPNTLEPEWQQTVVFMNCLKRTLKKRVLEATVWDFDRLKMNDFMGQAIIHLGSKEALDGQPHWYKLHALQDIVIPGYRQPGTR 342          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A0X3NVX3 (C2 domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR88668 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 5.670e-64
Identity = 99/148 (66.89%), Postives = 127/148 (85.81%), Query Frame = 1
Query: 2929 QSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHR 3372
            +S K  GEI+LI++FDDYDQSLT+HVA+A+ +  MDLNGLADPFVK+RLHPDPTED D NRQ +Y+ NTL PEWQQTVVFMN LKR+L+KRVL++++WDFDRLK NDFMGQA+I L++K +LDG+PHW+KL D++++ +PG RQ   R
Sbjct:  257 ESRKSFGEIELILTFDDYDQSLTVHVARARGLRAMDLNGLADPFVKLRLHPDPTEDMDLNRQVKYIPNTLEPEWQQTVVFMNCLKRTLKKRVLEVTMWDFDRLKMNDFMGQAIIHLSDKDLLDGQPHWFKLHDLRDIVVPGYRQAGTR 404          
BLAST of C2 domain-containing protein vs. TrEMBL
Match: A0A183QF17 (C2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 1.929e-62
Identity = 97/134 (72.39%), Postives = 120/134 (89.55%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            GEI+LI++FDDYDQSLT+HVA+A+N+  MDLNGLADPFVKVRLHPDPTED DFNRQT+YM NTL+PEWQQTVVFMN +KR+L++RVL+++VWDFDRLK+NDFMGQ +I+L +K+ LDGKPHW+ L  +  V IP
Sbjct:  167 GEIELILTFDDYDQSLTVHVARARNLPAMDLNGLADPFVKVRLHPDPTEDPDFNRQTKYMPNTLTPEWQQTVVFMNCIKRTLKRRVLEVTVWDFDRLKTNDFMGQTIINLGDKEYLDGKPHWFSLHGLMPVVIP 300          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 89.3521 bits (220), Expect = 1.511e-17
Identity = 51/132 (38.64%), Postives = 80/132 (60.61%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLA--NKQVLDGKPHWYKLTDMKE 3336
            G IQ  I+ D  + +LT+ + +AKN++PMD NGL+DP+VK++L PDP  +S   ++T+ +   L+P W +T  F   LK + + R L + +WD+D    NDFMG     ++   KQ +DG   W+KL   +E
Sbjct:  158 GRIQ--ITADIKNNALTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSES--KQKTKTIKCCLNPTWNETFTFN--LKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDG---WFKLLSQEE 280          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 88.9669 bits (219), Expect = 1.903e-17
Identity = 51/132 (38.64%), Postives = 80/132 (60.61%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLA--NKQVLDGKPHWYKLTDMKE 3336
            G IQ  I+ D  + +LT+ + +AKN++PMD NGL+DP+VK++L PDP  +S   ++T+ +   L+P W +T  F   LK + + R L + +WD+D    NDFMG     ++   KQ +DG   W+KL   +E
Sbjct:  158 GRIQ--ITADIKNNALTVSIKEAKNLVPMDPNGLSDPYVKLKLIPDPKSES--KQKTKTIKCCLNPTWNETFTFN--LKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDG---WFKLLSQEE 280          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000036659.1 (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:103047660])

HSP 1 Score: 86.6557 bits (213), Expect = 2.222e-17
Identity = 43/136 (31.62%), Postives = 76/136 (55.88%), Query Frame = 1
Query: 2869 GPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            G ++   S    V+ D   +     LG ++  + ++    SL   V KAK + PMD NGLADP+VK+ L P   + +    +T+ + NTL+P W +T+ +  I +  + ++ L +SV D D+L  N+F+G++ ++L
Sbjct:   64 GTLSVMSSMDTSVEIDSCDSDDNTSLGTLEFDVLYESATSSLHCTVLKAKGLKPMDFNGLADPYVKLHLLPGACKANKL--KTKIVKNTLNPVWNETLTYCGITEEDMYRKTLRVSVCDEDKLTHNEFIGESRVAL 197          

HSP 2 Score: 72.0182 bits (175), Expect = 1.324e-12
Identity = 38/108 (35.19%), Postives = 58/108 (53.70%), Query Frame = 1
Query: 2989 SLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHW 3312
             L + V +  ++  MD+NG +DP+VK  L PD  + S    +T  +  TL+PE+ +   F  I    L  + L+++VWD+D  KSNDF+G   +SL      D   HW
Sbjct:  238 GLCVGVRRCAHLAAMDVNGFSDPYVKTYLKPDVKKKS--KHKTAVIKKTLNPEFNEEF-FYEITFNELATKTLEVTVWDYDLGKSNDFIGG--VSLGCHSQGDALQHW 340          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000010716.2 (double C2-like domain-containing protein alpha [Source:NCBI gene;Acc:103047660])

HSP 1 Score: 87.4261 bits (215), Expect = 2.582e-17
Identity = 43/136 (31.62%), Postives = 76/136 (55.88%), Query Frame = 1
Query: 2869 GPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            G ++   S    V+ D   +     LG ++  + ++    SL   V KAK + PMD NGLADP+VK+ L P   + +    +T+ + NTL+P W +T+ +  I +  + ++ L +SV D D+L  N+F+G++ ++L
Sbjct:   86 GTLSVMSSMDTSVEIDSCDSDDNTSLGTLEFDVLYESATSSLHCTVLKAKGLKPMDFNGLADPYVKLHLLPGACKANKL--KTKIVKNTLNPVWNETLTYCGITEEDMYRKTLRVSVCDEDKLTHNEFIGESRVAL 219          

HSP 2 Score: 72.4034 bits (176), Expect = 1.500e-12
Identity = 38/108 (35.19%), Postives = 58/108 (53.70%), Query Frame = 1
Query: 2989 SLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHW 3312
             L + V +  ++  MD+NG +DP+VK  L PD  + S    +T  +  TL+PE+ +   F  I    L  + L+++VWD+D  KSNDF+G   +SL      D   HW
Sbjct:  303 GLCVGVRRCAHLAAMDVNGFSDPYVKTYLKPDVKKKS--KHKTAVIKKTLNPEFNEEF-FYEITFNELATKTLEVTVWDYDLGKSNDFIGG--VSLGCHSQGDALQHW 405          
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Match: rims1a (regulating synaptic membrane exocytosis 1 [Source:NCBI gene;Acc:103030767])

HSP 1 Score: 89.3521 bits (220), Expect = 2.794e-17
Identity = 48/141 (34.04%), Postives = 86/141 (60.99%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLA-DPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLK--SNDFMGQALISLANKQVLDGKPHWYKLT--DMKEVDIP 3348
            L G++ + + +D     L ++V +AK  LP  L+G   +P+VK+   PD ++ S   R+T+ +  +L P+W QT V+ ++ +R  R+ +L+I+VWD  +++   +DF+G+ LI L    +LD KPHWYK+   D+  + +P
Sbjct:  739 LPGQLSVKMWYDKVGHQLIVNVLQAKE-LPPRLDGRPRNPYVKMYFLPDRSDKS--KRRTKTVKKSLEPKWNQTFVYSHVHRRDFREHMLEITVWDQPKIQDEESDFLGEILIELETA-LLDDKPHWYKMQTHDLSSIPLP 875          

HSP 2 Score: 65.855 bits (159), Expect = 4.289e-10
Identity = 34/103 (33.01%), Postives = 62/103 (60.19%), Query Frame = 1
Query: 2137 KPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDE--IEFLV 2439
            +P+K  +    R+ L + +      G  +G++++GG++   G LGAFI ++  GS+AD +   ++ GDE+++WNG SL G T +EV +I+ +   E  +E +V
Sbjct:  578 QPSKEGDHLIGRITLSKRTAMPKEAGALLGLKVVGGKITETGRLGAFITKVKKGSLAD-VVGHLRAGDEVLQWNGKSLPGLTKKEVYNIILDSQMEPQVELVV 679          
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004426.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 7.568e-32
Identity = 64/146 (43.84%), Postives = 90/146 (61.64%), Query Frame = 1
Query: 2932 SEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            S  + GEIQL +SFD +  +L IHV +A+ + P D NG +DPFVKV L P   +        S+  R+T+Y+  TL+PEW QTVV+ NI+   L+++ L+ SVWD+DR  SNDF+G+  I L++   LDG   WY L +  E   P
Sbjct:  156 SHPITGEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPLREQSEGGSP 301          
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004430.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004430.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 9.916e-32
Identity = 64/146 (43.84%), Postives = 90/146 (61.64%), Query Frame = 1
Query: 2932 SEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIP 3348
            S  + GEIQL +SFD +  +L IHV +A+ + P D NG +DPFVKV L P   +        S+  R+T+Y+  TL+PEW QTVV+ NI+   L+++ L+ SVWD+DR  SNDF+G+  I L++   LDG   WY L +  E   P
Sbjct:  153 SHPITGEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPLREQSEGGSP 298          
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004407.1 (pep scaffold:Pmarinus_7.0:GL476335:1234109:1328003:1 gene:ENSPMAG00000004009.1 transcript:ENSPMAT00000004407.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 7.598e-13
Identity = 32/81 (39.51%), Postives = 53/81 (65.43%), Query Frame = 1
Query: 2077 MKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCS--DGHLGAFIEQIFPGSVADR 2313
            M Q  S P + LNQ  + I  P ++Y+FP  R+ L +D+K+ ++ GNG+G+R++GG+     DG +GA+I +I PG  A++
Sbjct: 3721 MPQLISKPILYLNQSILSISDPPQSYDFPHARVPLQQDAKDHSMSGNGLGVRVVGGKEVPGRDGEIGAYISKILPGGAAEQ 3801          
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001439.1 (pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:-1 gene:ENSPMAG00000001272.1 transcript:ENSPMAT00000001439.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.421e-12
Identity = 40/146 (27.40%), Postives = 74/146 (50.68%), Query Frame = 1
Query: 2935 EKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSND--FMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPA 3366
            + + G + + + +D     L +    A ++   D     +P++K+   PD ++ S   R+T  +  +L P+W QT  +  + +R  R+ +L++++WD  R    +  F+G+ LI L    +LD  PHWYKL       +P L QP+
Sbjct:  678 QTMPGRLSIKLWYDKVGFQLVVTTLGATDLPLRDDGQPRNPYIKIYFLPDRSDKS--KRRTTTVGRSLEPQWNQTFAYCPVQRREFREHMLELTLWDQQRSPGEESVFLGEILIELETA-LLDDNPHWYKLQSHDPSSLP-LPQPS 819          

HSP 2 Score: 51.6026 bits (122), Expect = 1.955e-6
Identity = 43/130 (33.08%), Postives = 62/130 (47.69%), Query Frame = 1
Query: 2944 LGEIQLIISFDDYDQSLTIHVAKAKNMLPM-DLNGLADPFVKVRLHPDPTEDSDF--NRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVW-DFDRLKSNDFMGQALISLANKQVLDGKPHWYKL 3321
            +GEIQ  IS  D    L + V +AK +        L  P+VKV L     E+      ++T+    TL P +QQ +VF    ++S   +VL + VW D+ R+    FMG A I L    + +    WYKL
Sbjct: 1463 MGEIQ--ISMVDKKGQLEVEVIRAKGLFAKPSSKTLPAPYVKVYL----LENGAVIAKKKTKIARKTLDPLYQQPLVF----EQSPSGKVLQVIVWGDYGRMDHKSFMGAARIVLEELDLSNMVIGWYKL 1582          
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Match: SYT6 (synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638])

HSP 1 Score: 67.781 bits (164), Expect = 1.484e-12
Identity = 43/155 (27.74%), Postives = 74/155 (47.74%), Query Frame = 1
Query: 2833 PTAKQKRPSK-DVGPVNTNESEKDEVDND--------KSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALI 3270
            P+   +RPS  D+G +     ++  V+ D         + N    L G++   + +D   + L + V +A  +   D +G +DP+VK+ L PD         QT+    TL+P +++T  F  +    L  R L  SV+DFDR   +D +GQ ++
Sbjct:   67 PSPATRRPSPLDIGRIKPELYKQRSVEGDDADGGCGTTAANDGRTLAGKLNFALHYDYEMEQLLVRVCRAAELPAKDFSGTSDPYVKIYLLPDRKR----KYQTKVHRKTLNPVFEETFQFF-VPYAELPARRLHFSVYDFDRFSRHDTIGQVVV 216          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 85.1149 bits (209), Expect = 9.633e-18
Identity = 46/127 (36.22%), Postives = 72/127 (56.69%), Query Frame = 1
Query: 2944 LGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL-ANKQVLDGKPHWYKL 3321
            LG IQL + ++     L + V +   +  MD NG +DP+VK  L PDP + S   R+T     TL+PE+ +  V+ +I    L K+ L+++VWD+D  KSNDF+G  ++++ A    L    HWY +
Sbjct:  154 LGRIQLALKYNTQRGMLFVTVMRCSGLASMDANGYSDPYVKCYLKPDPQKKS--KRRTNIRKKTLNPEFNEEFVY-DIAHHELAKKSLEVTVWDYDVGKSNDFIGGVILNINAEGSAL---KHWYDM 274          

HSP 2 Score: 67.781 bits (164), Expect = 6.255e-12
Identity = 33/111 (29.73%), Postives = 61/111 (54.95%), Query Frame = 1
Query: 2944 LGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISL 3276
            LG ++  + +   D  L + +  AK + PMD  G +DP+VK+ L P  ++ +     T+Y   TL+P + +T+ +  I +  +  + L + V+D D +  NDF+G+  I+L
Sbjct:   19 LGLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGGTSDPYVKLHLLPGASKSNKLRSHTKY--KTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINL 127          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 78.9518 bits (193), Expect = 4.264e-15
Identity = 48/130 (36.92%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            G I L IS++         + +A+N++PMD NGL+DP+VKV+L PDP  D+   ++T+    +LSP + +T  F   ++   + R L I VWD+DR   NDFMG     ++  Q  +G   W+KL   +E
Sbjct:   61 GRIHLKISYE---------LREARNLMPMDPNGLSDPYVKVKLLPDP--DNTSKKKTKIFKESLSPVFNETFEFK--IQNKDKDRRLSIEVWDWDRTTRNDFMGSLSFGVSELQK-NGVEGWFKLLSQEE 176          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO49802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY4])

HSP 1 Score: 71.633 bits (174), Expect = 5.883e-13
Identity = 41/145 (28.28%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 2920 SQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDG-KPHWYKLTDMKEVDIPG 3351
            +Q  S  + G+I++ + ++  +Q L + V +A++++P DLNG +DP+V + L PD  E+    ++TR+   TL+P + +   F  +   +L    L  ++WD D    +DF G+A++ L+     +G    W+ L    +  I G
Sbjct:   22 TQADSGDIKGDIEMSLKYNHREQLLLVKVIRARDLVPRDLNGKSDPYVVLELVPDRLEEG--TKKTRFKQKTLNPVFNEIFQF-KVPHNNLTDTKLCATIWDHDFFGEDDFNGEAVVDLSRVNFNNGTHTDWFMLQLQTDFSITG 163          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 71.2478 bits (173), Expect = 2.797e-12
Identity = 41/129 (31.78%), Postives = 74/129 (57.36%), Query Frame = 1
Query: 2947 GEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMK 3333
            G+I+L I  +    +L + V  AK++   + +   DP+VK+ L PDP++ +    +T+    + +P + +T+V+ N+    L+ R L ++VWD DR+  NDFMG  +I+LA+        +WY L D++
Sbjct: 1185 GQIKLSIRHER--GALRVMVMHAKDLSSRNSSTAGDPYVKLYLLPDPSKTTKL--KTKIAKKSQNPTYNETLVYSNLSAADLKTRHLQVTVWDHDRVGENDFMGGVVINLADMDSSINITNWYPLKDIR 1309          
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Match: EDO29765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2P9])

HSP 1 Score: 65.855 bits (159), Expect = 3.056e-11
Identity = 30/87 (34.48%), Postives = 52/87 (59.77%), Query Frame = 1
Query: 2992 LTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDF 3252
            L +H+ +AKN+   D +G++DPF K+ L PD    +    +T  +  TL+P W   +++  + +  LR+RVL+IS+WD D    ++F
Sbjct:  181 LHVHIMEAKNLPGKDADGMSDPFCKITLLPDKKGKT--RHKTAIIKRTLNPSWDYNLIYEELSQEELRQRVLEISIWDHDIASRDEF 265          

HSP 2 Score: 60.077 bits (144), Expect = 2.572e-9
Identity = 33/116 (28.45%), Postives = 62/116 (53.45%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNG-LADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANK 3285
            + GE+Q+ + +D   + L + V +A+++ P+D     +DP+    L PD    S   R+T  +   L+P+W     + ++    L  R L+++VWD+DR  SNDF+G   + +  +
Sbjct:   19 VTGEVQVGLRYDYKHEKLEVQVHRARDIAPVDTKKKRSDPY----LLPDKGRKS--KRKTPTIRKNLNPQWNFPFTYDDVTLEELMDRSLELTVWDWDRGASNDFLGGVRLGMETR 128          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: PCLO (protein piccolo-like [Source:NCBI gene;Acc:105354233])

HSP 1 Score: 129.028 bits (323), Expect = 3.325e-29
Identity = 58/132 (43.94%), Postives = 86/132 (65.15%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            + GEIQL I++D    +L +HV +A+N+ P + +G +DPFVKV L P     +D  R+T+Y   T++PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 7134 ITGEIQLQINYDRNLGNLIVHVLQARNLAPREHDGYSDPFVKVYLLPG--RGADNKRRTKYAQKTVNPEWNQTVIYKNIHLEQLKKKTLEVTVWDYDRSSSNDFLGEVLIDLSNTAQLDNTPRWLPLKEQSE 7263          

HSP 2 Score: 96.2857 bits (238), Expect = 2.550e-19
Identity = 40/100 (40.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query: 2152 YNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            Y FP  R+ L RD K+ ++ GNG+G+R++GG+      G +GA+I  + PG  A+++  ++ EG +++EWNGV L GKT+EEV+ I+     E E  +R+
Sbjct: 6925 YAFPHTRIKLKRDMKDTSVSGNGLGIRVVGGKQIPGCRGEIGAYIANVIPGGAAEQM-GKVVEGMQVLEWNGVPLTGKTYEEVQCIMGQPCAEAELCLRL 7023          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: pcloa (protein piccolo [Source:NCBI gene;Acc:101155978])

HSP 1 Score: 128.257 bits (321), Expect = 4.837e-29
Identity = 60/138 (43.48%), Postives = 89/138 (64.49%), Query Frame = 1
Query: 2929 QSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVD 3342
            QS  + GEIQL I +D    +L +HV +A+N+ P D NG +DPFVKV L P     ++  R++++   +L+PEW QTV++ NI    LRK+ L++SVWD+D+  SNDF+G+ LI+L++   LD  P W  L +  E D
Sbjct: 3510 QSHPVSGEIQLQIHYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPG--RGAENKRKSKHAGKSLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKGSSNDFLGEVLINLSDTSQLDNIPRWIPLKEQSEGD 3645          

HSP 2 Score: 95.1301 bits (235), Expect = 5.591e-19
Identity = 41/100 (41.00%), Postives = 68/100 (68.00%), Query Frame = 1
Query: 2152 YNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            Y FP  R+ L RD K++ + GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWNGV L GKT+EEV+ ++    +E E  VR+
Sbjct: 3321 YPFPHLRVKLQRDPKDRTVSGNGLGIRVVGGKEVPGSNGEIGAYVAKVLPGGAAEQT-GKILEGMQVLEWNGVFLTGKTYEEVQGLVGQLCNEAEVCVRL 3419          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: PCLO (protein piccolo-like [Source:NCBI gene;Acc:105354233])

HSP 1 Score: 125.561 bits (314), Expect = 3.629e-28
Identity = 58/139 (41.73%), Postives = 87/139 (62.59%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            + GEIQL I++D    +L +HV +A+N+ P + +G +DPFVKV L P   +        +D  R+T+Y   T++PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 7125 ITGEIQLQINYDRNLGNLIVHVLQARNLAPREHDGYSDPFVKVYLLPGRGQVMVVQNASADNKRRTKYAQKTVNPEWNQTVIYKNIHLEQLKKKTLEVTVWDYDRSSSNDFLGEVLIDLSNTAQLDNTPRWLPLKEQSE 7263          

HSP 2 Score: 96.2857 bits (238), Expect = 2.572e-19
Identity = 40/100 (40.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query: 2152 YNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            Y FP  R+ L RD K+ ++ GNG+G+R++GG+      G +GA+I  + PG  A+++  ++ EG +++EWNGV L GKT+EEV+ I+     E E  +R+
Sbjct: 6916 YAFPHTRIKLKRDMKDTSVSGNGLGIRVVGGKQIPGCRGEIGAYIANVIPGGAAEQM-GKVVEGMQVLEWNGVPLTGKTYEEVQCIMGQPCAEAELCLRL 7014          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: PCLO (protein piccolo-like [Source:NCBI gene;Acc:105354233])

HSP 1 Score: 125.561 bits (314), Expect = 3.817e-28
Identity = 58/139 (41.73%), Postives = 87/139 (62.59%), Query Frame = 1
Query: 2941 LLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKE 3336
            + GEIQL I++D    +L +HV +A+N+ P + +G +DPFVKV L P   +        +D  R+T+Y   T++PEW QTV++ NI    L+K+ L+++VWD+DR  SNDF+G+ LI L+N   LD  P W  L +  E
Sbjct: 7134 ITGEIQLQINYDRNLGNLIVHVLQARNLAPREHDGYSDPFVKVYLLPGRGQVMVVQNASADNKRRTKYAQKTVNPEWNQTVIYKNIHLEQLKKKTLEVTVWDYDRSSSNDFLGEVLIDLSNTAQLDNTPRWLPLKEQSE 7272          

HSP 2 Score: 96.2857 bits (238), Expect = 2.572e-19
Identity = 40/100 (40.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query: 2152 YNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            Y FP  R+ L RD K+ ++ GNG+G+R++GG+      G +GA+I  + PG  A+++  ++ EG +++EWNGV L GKT+EEV+ I+     E E  +R+
Sbjct: 6925 YAFPHTRIKLKRDMKDTSVSGNGLGIRVVGGKQIPGCRGEIGAYIANVIPGGAAEQM-GKVVEGMQVLEWNGVPLTGKTYEEVQCIMGQPCAEAELCLRL 7023          
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Match: pcloa (protein piccolo [Source:NCBI gene;Acc:101155978])

HSP 1 Score: 125.176 bits (313), Expect = 4.588e-28
Identity = 60/145 (41.38%), Postives = 90/145 (62.07%), Query Frame = 1
Query: 2929 QSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTE-------DSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVD 3342
            QS  + GEIQL I +D    +L +HV +A+N+ P D NG +DPFVKV L P   +        ++  R++++   +L+PEW QTV++ NI    LRK+ L++SVWD+D+  SNDF+G+ LI+L++   LD  P W  L +  E D
Sbjct: 3510 QSHPVSGEIQLQIHYDKQLGNLIVHVLQARNLAPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAENKRKSKHAGKSLNPEWNQTVIYKNIHLEQLRKKTLEVSVWDYDKGSSNDFLGEVLINLSDTSQLDNIPRWIPLKEQSEGD 3654          

HSP 2 Score: 95.1301 bits (235), Expect = 5.453e-19
Identity = 41/100 (41.00%), Postives = 68/100 (68.00%), Query Frame = 1
Query: 2152 YNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLC--SDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRV 2445
            Y FP  R+ L RD K++ + GNG+G+R++GG+    S+G +GA++ ++ PG  A++   +I EG +++EWNGV L GKT+EEV+ ++    +E E  VR+
Sbjct: 3321 YPFPHLRVKLQRDPKDRTVSGNGLGIRVVGGKEVPGSNGEIGAYVAKVLPGGAAEQT-GKILEGMQVLEWNGVFLTGKTYEEVQGLVGQLCNEAEVCVRL 3419          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 2276.52 bits (5898), Expect = 0.000e+0
Identity = 1323/1350 (98.00%), Postives = 1329/1350 (98.44%), Query Frame = 1
Query:  190 VDVHAAESNDHTRNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQXXXXXXXXXXXXXXXXXENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAXXXXXXXXXXXXXXXXXXXXXXXDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKXXXXXXXXXXXXXXXXXXXXTIRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDYDVVNEYYVNEKCQPRQYADELMNXXXXXXXXXXNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKXXXXXXXXXXXXXXXXXMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRXXXXXXXXXXXXXXXXXXXXXXXRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRXXXXXXXXXXXXXXXXXXXXEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDXXXXXXXXXXHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 4239
            VDVHAAESNDHT NTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTA+TTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYID PATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQ+VEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIK+NQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRV+DISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIK S+ +                F PSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI
Sbjct:   61 VDVHAAESNDHTGNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTAHTTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDAPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQNVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKINQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVIDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKRSKSQ-------------QRKFSPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 1397          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 2275.74 bits (5896), Expect = 0.000e+0
Identity = 1323/1350 (98.00%), Postives = 1329/1350 (98.44%), Query Frame = 1
Query:  190 VDVHAAESNDHTRNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQXXXXXXXXXXXXXXXXXENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAXXXXXXXXXXXXXXXXXXXXXXXDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKXXXXXXXXXXXXXXXXXXXXTIRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDYDVVNEYYVNEKCQPRQYADELMNXXXXXXXXXXNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKXXXXXXXXXXXXXXXXXMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRXXXXXXXXXXXXXXXXXXXXXXXRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRXXXXXXXXXXXXXXXXXXXXEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDXXXXXXXXXXHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 4239
            VDVHAAESNDHT NTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTA+TTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYID PATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQ+VEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIK+NQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRV+DISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIK S+ +                F PSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI
Sbjct: 1104 VDVHAAESNDHTGNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTAHTTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDAPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQNVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKINQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVIDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKRSKSQ-------------QRKFSPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 2440          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 2274.59 bits (5893), Expect = 0.000e+0
Identity = 1323/1350 (98.00%), Postives = 1329/1350 (98.44%), Query Frame = 1
Query:  190 VDVHAAESNDHTRNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQXXXXXXXXXXXXXXXXXENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAXXXXXXXXXXXXXXXXXXXXXXXDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKXXXXXXXXXXXXXXXXXXXXTIRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDYDVVNEYYVNEKCQPRQYADELMNXXXXXXXXXXNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKXXXXXXXXXXXXXXXXXMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRXXXXXXXXXXXXXXXXXXXXXXXRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRXXXXXXXXXXXXXXXXXXXXEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDXXXXXXXXXXHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 4239
            VDVHAAESNDHT NTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTA+TTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYID PATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQ+VEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIK+NQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRV+DISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIK S+ +                F PSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI
Sbjct:  970 VDVHAAESNDHTGNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTAHTTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDAPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQNVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKINQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVIDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKRSKSQ-------------QRKFSPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 2306          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 2262.26 bits (5861), Expect = 0.000e+0
Identity = 1321/1353 (97.63%), Postives = 1328/1353 (98.15%), Query Frame = 1
Query:  190 VDVHAAESNDHTRNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQXXXXXXXXXXXXXXXXXENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAXXXXXXXXXXXXXXXXXXXXXXXDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKXXXXXXXXXXXXXXXXXXXXTIRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDYDVVNEYYVNEKCQPRQYADELMNXXXXXXXXXXNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKXXXXXXXXXXXXXXXXXMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRXXXXXXXXXXXXXXXXXXXXXXXRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKISKT---VENSSPVNKPSNLKPIRNTPRQISPEKINNLTRXXXXXXXXXXXXXXXXXXXXEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDXXXXXXXXXXHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 4239
            VDVHAAESNDHT NTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTA+TTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYID PATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQ+VEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIK+NQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRV+DISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKSSRDEAINMSNISYINNPSSDF                LP  +I  T   ++NSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI
Sbjct:   61 VDVHAAESNDHTGNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTAHTTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDAPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQNVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKINQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVIDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKSSRDEAINMSNISYINNPSSDF----------------LPHCQILITLILIQNSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKDVSGWYKLLKPDI 1397          
BLAST of C2 domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 2243 bits (5811), Expect = 0.000e+0
Identity = 1311/1338 (97.98%), Postives = 1317/1338 (98.43%), Query Frame = 1
Query:  190 VDVHAAESNDHTRNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQXXXXXXXXXXXXXXXXXENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAXXXXXXXXXXXXXXXXXXXXXXXDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKXXXXXXXXXXXXXXXXXXXXTIRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMMDYDVVNEYYVNEKCQPRQYADELMNXXXXXXXXXXNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKXXXXXXXXXXXXXXXXXMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMXXXXXXXXXXXXXPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRXXXXXXXXXXXXXXXXXXXXXXXRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRXXXXXXXXXXXXXXXXXXXXEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDXXXXXXXXXXHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKD 4203
            VDVHAAESNDHT NTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTA+TTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYID PATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQ+VEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIK+NQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRV+DISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIK S+ +                F PSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKD
Sbjct:   61 VDVHAAESNDHTGNTDIKSTDYPDEFTTNTENSLPSKTIIYPVPLTDSQHTVEKIQQNKKYNEEKNCHSSYVRTETITSQCCEQTHYPSSSTLIGKHASTERNPALCNKISDTREAKFPSSISKIVNEQSNKQTAHTTTVSTSTPNKVSSENFTAYTSYSRAAKNSLLNKLCIQLQVPTHIKNRKSLINEEILLVTQIKRQHLKDFVQIQNVELQLNHLRNIEKQQMTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHYRYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYPRELKYNPYYYIDAPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNMTYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEELLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADELMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQQYLQNVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHDQIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSVENEMKQESSLPSIKINQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGNGVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVSLVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKNLSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSIKRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRISSVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLIISFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQTRYMSNTLSPEWQQTVVFMNILKRSLRKRVIDISVWDFDRLKSNDFMGQALISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSKSSKEIKRSKSQ-------------QRKFSPSLPNSNHINPNPSQLPDIKISKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSVTTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLSLRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTKSIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLDDIEFVKKNSKKD 1385          
The following BLAST results are available for this feature:
BLAST of C2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCLO5.921e-3236.00piccolo presynaptic cytomatrix protein [Source:HGN... [more]
PCLO1.224e-2835.58piccolo presynaptic cytomatrix protein [Source:HGN... [more]
PCLO1.373e-2835.58piccolo presynaptic cytomatrix protein [Source:HGN... [more]
PRKCA9.354e-1838.98protein kinase C alpha [Source:HGNC Symbol;Acc:HGN... [more]
RIMS14.173e-1734.48regulating synaptic membrane exocytosis 1 [Source:... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cla-15.347e-1639.62CLArinet, functional homolog of cytomatrix at the ... [more]
cla-15.347e-1639.62CLArinet, functional homolog of cytomatrix at the ... [more]
cla-18.726e-1639.62CLArinet, functional homolog of cytomatrix at the ... [more]
cla-11.073e-1539.62CLArinet, functional homolog of cytomatrix at the ... [more]
rbf-11.238e-1536.04Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fife1.482e-1741.76gene:FBgn0264606 transcript:FBtr0333630[more]
Fife1.482e-1741.76gene:FBgn0264606 transcript:FBtr0333631[more]
Fife5.495e-1741.76gene:FBgn0264606 transcript:FBtr0333629[more]
Fife5.993e-1741.76gene:FBgn0264606 transcript:FBtr0333632[more]
Rim4.659e-1531.20gene:FBgn0053547 transcript:FBtr0336721[more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcloa7.431e-3138.19piccolo presynaptic cytomatrix protein a [Source:Z... [more]
pcloa7.625e-3138.19piccolo presynaptic cytomatrix protein a [Source:Z... [more]
pcloa5.635e-3036.89piccolo presynaptic cytomatrix protein a [Source:Z... [more]
pcloa6.186e-3036.89piccolo presynaptic cytomatrix protein a [Source:Z... [more]
pcloa6.260e-3036.89piccolo presynaptic cytomatrix protein a [Source:Z... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCLO1.775e-3928.64piccolo presynaptic cytomatrix protein [Source:NCB... [more]
PCLO2.650e-1943.56piccolo presynaptic cytomatrix protein [Source:NCB... [more]
PCLO3.424e-1943.56piccolo presynaptic cytomatrix protein [Source:NCB... [more]
PCLO3.732e-1943.56piccolo presynaptic cytomatrix protein [Source:NCB... [more]
RPH3A8.168e-1832.92rabphilin 3A [Source:NCBI gene;Acc:100487950][more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pclo1.078e-2936.23piccolo (presynaptic cytomatrix protein) [Source:M... [more]
Pclo1.250e-2936.23piccolo (presynaptic cytomatrix protein) [Source:M... [more]
Pclo1.438e-2936.23piccolo (presynaptic cytomatrix protein) [Source:M... [more]
Prkca8.481e-1738.98protein kinase C, alpha [Source:MGI Symbol;Acc:MGI... [more]
Doc2b9.292e-1733.07double C2, beta [Source:MGI Symbol;Acc:MGI:1100497... [more]
back to top
BLAST of C2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PU36|PCLO_CHICK2.740e-3040.54Protein piccolo (Fragment) OS=Gallus gallus OX=903... [more]
sp|Q9JKS6|PCLO_RAT7.187e-2936.54Protein piccolo OS=Rattus norvegicus OX=10116 GN=P... [more]
sp|Q9QYX7|PCLO_MOUSE1.006e-2836.23Protein piccolo OS=Mus musculus OX=10090 GN=Pclo P... [more]
sp|Q9Y6V0|PCLO_HUMAN6.592e-2835.58Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE... [more]
sp|P70610|DOC2B_RAT1.731e-1633.07Double C2-like domain-containing protein beta OS=R... [more]
back to top
BLAST of C2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LJ541.162e-9143.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183A9Y71.255e-7141.92Uncharacterized protein OS=Echinostoma caproni OX=... [more]
W6UJX42.529e-6570.63Protein piccolo OS=Echinococcus granulosus OX=6210... [more]
A0A0X3NVX35.670e-6466.89C2 domain-containing protein (Fragment) OS=Schisto... [more]
A0A183QF171.929e-6272.39C2 domain-containing protein OS=Schistosoma rodhai... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcbb1.511e-1738.64protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
prkcbb1.903e-1738.64protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000036659.12.222e-1731.62double C2-like domain-containing protein alpha [So... [more]
ENSAMXT00000010716.22.582e-1731.62double C2-like domain-containing protein alpha [So... [more]
rims1a2.794e-1734.04regulating synaptic membrane exocytosis 1 [Source:... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004426.17.568e-3243.84pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
ENSPMAT00000004430.19.916e-3243.84pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
ENSPMAT00000004407.17.598e-1339.51pep scaffold:Pmarinus_7.0:GL476335:1234109:1328003... [more]
ENSPMAT00000001439.11.421e-1227.40pep scaffold:Pmarinus_7.0:GL476337:947677:1015027:... [more]
SYT61.484e-1227.74synaptotagmin 6 [Source:HGNC Symbol;Acc:HGNC:18638... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO419339.633e-1836.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449254.264e-1536.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498025.883e-1328.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459772.797e-1231.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297653.056e-1134.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of C2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCLO3.325e-2943.94protein piccolo-like [Source:NCBI gene;Acc:1053542... [more]
pcloa4.837e-2943.48protein piccolo [Source:NCBI gene;Acc:101155978][more]
PCLO3.629e-2841.73protein piccolo-like [Source:NCBI gene;Acc:1053542... [more]
PCLO3.817e-2841.73protein piccolo-like [Source:NCBI gene;Acc:1053542... [more]
pcloa4.588e-2841.38protein piccolo [Source:NCBI gene;Acc:101155978][more]
back to top
BLAST of C2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050479.10.000e+098.00SMESG000050479.1[more]
SMESG000050479.10.000e+098.00SMESG000050479.1[more]
SMESG000050479.10.000e+098.00SMESG000050479.1[more]
SMESG000050479.10.000e+097.63SMESG000050479.1[more]
SMESG000050479.10.000e+097.98SMESG000050479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013757 ID=SMED30013757|Name=C2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4527bp
ACAAGCCGAACGAGCTCAAAAAGGAATATCTCATTGAAAATGTCTCATAC
ACATTGTGTTTTGGAATGCAAAATGTGGACTCTGGATGCAATCACCAAAA
CAGGCTTCGTTATGTCTAAGAATAATAAATAACAATATGTCTGAAGAGTT
TATTAATAAAAGAGCCTCAGCCTATCTAGGCAACAGTCTGTGGATGTTCA
CGCAGCAGAATCAAACGACCATACAAGGAATACGGACATAAAATCTACAG
ACTACCCAGATGAATTCACAACCAACACAGAAAACTCTCTCCCTAGCAAA
ACAATTATATATCCAGTGCCTTTGACTGATTCTCAGCACACAGTTGAAAA
AATCCAACAAAACAAGAAATACAATGAGGAGAAAAATTGCCATTCATCAT
ATGTGCGCACTGAAACAATAACATCCCAATGTTGTGAGCAGACGCACTAT
CCTTCATCCTCGACTCTCATTGGTAAGCATGCATCTACTGAAAGAAACCC
AGCTCTCTGCAATAAAATCTCTGATACCAGAGAAGCAAAATTTCCCAGTT
CTATATCAAAAATAGTAAATGAACAATCCAACAAACAAACAGCTAATACA
ACAACTGTTTCAACATCAACACCAAATAAAGTCTCGTCAGAAAATTTCAC
TGCCTACACTAGCTACAGTCGCGCTGCAAAAAACTCTCTTCTTAATAAAC
TATGTATACAATTGCAGGTTCCAACTCACATTAAAAATAGAAAATCACTC
ATCAATGAAGAAATTCTCCTCGTAACTCAAATTAAAAGACAACATTTGAA
AGACTTTGTTCAGATTCAAAATGTGGAATTACAGCTGAATCATTTACGTA
ATATCGAAAAACAGCAAATGACAGAAATCCAAGACAAAATGGCAGAAATA
CAGAACGCAAAATCCGGTTTGTCTTATCCTCGTTTGTCGAAATCTCGCTA
CATTCCAAATTACGTTTCTAATACGGATAGTAATTATTATTATTACGCTC
CGCAACGAAATCACTATCGCTACCCATATCCTCAATACTATTACCAGAAT
CCGTATCCGTATCGGCAAGATCAAATTTACAAATGCGATCCGAATTACGA
TGATCAGAGATCAACTTATTCCATTCACTCCTCTCCACAATGCCTTAGTT
ATGGGGGTTCCTATCCTCGAGAACTAAAATATAATCCTTATTACTACATT
GATCCTCCGGCAACAACCTCAAGAAACTTTTCCCGATCTACCGATCAAAT
AGCGATGCACAATATCCCAAATTATCCCATGGAAATGTCTCACTCCGATC
AAGGTCTATTTAATATGACATACAATTACCCATATAAAATGAACGACCGC
TTTGCCTTTAACATTGATATAGAATTGATGCAAAAAGAACAACGAGTTCT
TGAATTGGAAAGAGAAATTGAGTTGAGGAAACGACAAATTGAAGAAACAA
TAAGATATCAGGAGGAATTGTTACAATTAGCCGAACTAAATAACGTCAAC
GTAAATGAATATAAAAACAATTACGTACAAAATAACAACCAGCCAATGAT
GGATTACGATGTTGTCAATGAATATTACGTCAACGAGAAATGTCAACCAA
GGCAATATGCGGATGAACTAATGAATCCTTATTATCCATACGACGATTTG
CCACCAAATCACCAACAGTTCGCCAGTTATTACGATAATCTTTATCAACA
GAATGAACCCAGGGATAGTATTTGTTACGCGGAGCCAGTATTCCATCAGG
ATCCGTATTATTCACAGCAGTATCTCCAAAGTGTAGAGGGGTCGAATATT
TACGGAAAACATCAGGAGACCAGCACCGGAAATACTTTCGACCAACAACA
GCCAAGATACTCATCTAAGTCGTATGCAACCGAAAAAAGACCGCTGGGTA
ACCCATCAGCTCATGACCAAATTGATTACATCATGCAAACGGATAAAGAT
AATGATAAATCTCATAATATTTCTAACCACAACAACAACCACAGCAGCAA
TAATAATAATATGCGACCATTGTCTGGTGAATATGAAAATGTGGCACCTT
TAGATTCTGACAGTGTTGAAAATGAAATGAAACAGGAATCTTCTCTGCCA
TCAATTAAGCTTAATCAAAAAAAAATAGAAATTGTGAAACCAAATAAGAA
TTACAATTTTCCAACCAAACGACTTTTATTGATGAGAGACTCGAAAGAGA
AAAATCTGAGAGGAAACGGAGTGGGGATGAGAATAATTGGTGGCCAATTA
TGTTCAGACGGACATTTGGGGGCATTCATTGAACAGATATTTCCAGGAAG
TGTCGCCGACCGACTTCAAGATCAAATAAAAGAGGGAGATGAACTTATTG
AATGGAATGGTGTATCTTTAGTTGGTAAAACCTTTGAAGAAGTAAGGTCA
ATTTTGAAAAATGATTCTGATGAAATTGAGTTTTTAGTGAGGGTAGGCCC
AGTGCCAAAATCAACCGATACATCGAAAAGTAGCTCAGAAATCCCAGATG
AAAATCAAGTGAAAAACCTATCATCAACTTTTGAAAACATGAATGTAAAG
GAAACTGCCAACCCAACCCAATTGTCAATGAAAAAGGACAGTGCATACAA
AACCGACGAAAACATGCCTCATGCGTCCTTTAATGAATCGTCGTCTCACA
GAAGGACTCAGTCAATAAAACGACAACGCGCTCAAGAATACGAAATGAAA
ACATCGACGACGACGACTCAAAATACTCAAAAGTCTCCTATGAAAAAATC
TTCAATTATTGAATCGTCTCACGCTGAATTAGATTGCGGTTCGCCGTCAG
CTTCAAGGCGTATATCGTCAGTTCCTATAGAGCCAACTGCCAAACAGAAA
CGGCCATCAAAAGATGTTGGCCCTGTCAACACAAATGAATCTGAAAAAGA
CGAAGTTGATAACGATAAATCGCAAAATCAGTCAGAAAAATTACTGGGAG
AAATTCAATTAATAATAAGTTTCGATGATTATGACCAGAGTTTGACAATT
CATGTTGCAAAAGCAAAAAATATGTTGCCCATGGATTTGAATGGCTTAGC
CGATCCTTTTGTCAAAGTACGATTGCATCCAGACCCCACCGAAGATTCGG
ACTTTAATCGGCAGACGAGATACATGTCAAATACACTTTCACCCGAATGG
CAGCAAACCGTCGTTTTCATGAATATATTAAAACGGTCTTTAAGGAAACG
GGTACTTGATATATCAGTCTGGGATTTTGACCGTCTAAAATCAAACGATT
TCATGGGGCAAGCATTAATTAGTTTAGCAAACAAACAAGTACTTGATGGG
AAACCTCACTGGTATAAGCTGACTGATATGAAGGAAGTAGACATTCCAGG
ATTACGTCAACCAGCTCATAGAAAAGTTGAGAGTAAGACAAGTGGAAAGA
GTAAAACGAGCAGTAAATCATCAAAAGAAATAAAAAGTTCCAGAGATGAA
GCCATCAACATGTCAAATATTTCCTATATTAATAATCCTAGCTCAGATTT
TCCTCCCTCATTGCCAAATTCTAATCACATTAATCCTAATCCAAGTCAAC
TTCCAGATATAAAAATTAGCAAGACAGTAGAGAACTCAAGTCCCGTTAAC
AAACCAAGCAATTTAAAACCAATCAGAAACACTCCTCGTCAGATATCCCC
AGAGAAAATTAACAATTTGACCAGGACCGATACTGCTGATAGTAAATCGA
GTAATTCATCTTCAGTGACAACCGACTTCCTTAGTGAAGAGCAGCGTGAA
ATAGTCAGAAAATGGCTTGGTCCAGGTCAATTGCTGATGCTAAGTTATAC
TCAGAGAGTTGATAAAGTTGGTAATTTACCAGATGACAGTTTGGTCGTTG
CCGAATTATATCTTTCACTGAGAAAAATCGCAGATGAAGATATTTTGATT
GTTACTGCCAGTTCTTTGAAAAATCTTAAATCAAAGAACATAACTGAAGT
CTATATTAAACTCTATCTCATGTACAGTGAACAACAGTTGTCGAGAGTAA
TGAAAAGAAAAACCAAATCAATTGTTCTCAGTGATGAAAACAATTTTAAT
GAATCATTCAATTTCCACACTCAACTGGAAGGTATGTTGTTGCAAGTGTC
TTTATGGTCGTGTGGCAAAGGTCTGAATGTTCACAAAATGCTTGGTGAAG
CTGTTATTCATTTAGATGACATTGAATTTGTAAAAAAGAACTCAAAGAAA
GATGTAAGTGGTTGGTATAAGCTACTGAAACCAGATATTTAGTAGTATAA
TCTGTGATTGGGAATTGCGATATTCATTGTTATTTGTCTTTCTCTTCAAA
AAACATCTTTCTAGAGTTTTTTCTCACTTGTTAAACTTACTATGATGTAT
ATATCGATTGGATTCAACGGCTGGTACCTTTTTATACATAGCTTCATTGA
TATTTACAATGTATAGATTTTATTATGTTGAGTTTGTGTCTATTCTTCAA
TTATATTTGATAATTTTTTATTTTTATTTCAATGAAATTGTCATTTGGAA
ACGGGTAGAAATGAATGAAATCTAATA
back to top

protein sequence of SMED30013757-orf-1

>SMED30013757-orf-1 ID=SMED30013757-orf-1|Name=SMED30013757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1125bp
MTEIQDKMAEIQNAKSGLSYPRLSKSRYIPNYVSNTDSNYYYYAPQRNHY
RYPYPQYYYQNPYPYRQDQIYKCDPNYDDQRSTYSIHSSPQCLSYGGSYP
RELKYNPYYYIDPPATTSRNFSRSTDQIAMHNIPNYPMEMSHSDQGLFNM
TYNYPYKMNDRFAFNIDIELMQKEQRVLELEREIELRKRQIEETIRYQEE
LLQLAELNNVNVNEYKNNYVQNNNQPMMDYDVVNEYYVNEKCQPRQYADE
LMNPYYPYDDLPPNHQQFASYYDNLYQQNEPRDSICYAEPVFHQDPYYSQ
QYLQSVEGSNIYGKHQETSTGNTFDQQQPRYSSKSYATEKRPLGNPSAHD
QIDYIMQTDKDNDKSHNISNHNNNHSSNNNNMRPLSGEYENVAPLDSDSV
ENEMKQESSLPSIKLNQKKIEIVKPNKNYNFPTKRLLLMRDSKEKNLRGN
GVGMRIIGGQLCSDGHLGAFIEQIFPGSVADRLQDQIKEGDELIEWNGVS
LVGKTFEEVRSILKNDSDEIEFLVRVGPVPKSTDTSKSSSEIPDENQVKN
LSSTFENMNVKETANPTQLSMKKDSAYKTDENMPHASFNESSSHRRTQSI
KRQRAQEYEMKTSTTTTQNTQKSPMKKSSIIESSHAELDCGSPSASRRIS
SVPIEPTAKQKRPSKDVGPVNTNESEKDEVDNDKSQNQSEKLLGEIQLII
SFDDYDQSLTIHVAKAKNMLPMDLNGLADPFVKVRLHPDPTEDSDFNRQT
RYMSNTLSPEWQQTVVFMNILKRSLRKRVLDISVWDFDRLKSNDFMGQAL
ISLANKQVLDGKPHWYKLTDMKEVDIPGLRQPAHRKVESKTSGKSKTSSK
SSKEIKSSRDEAINMSNISYINNPSSDFPPSLPNSNHINPNPSQLPDIKI
SKTVENSSPVNKPSNLKPIRNTPRQISPEKINNLTRTDTADSKSSNSSSV
TTDFLSEEQREIVRKWLGPGQLLMLSYTQRVDKVGNLPDDSLVVAELYLS
LRKIADEDILIVTASSLKNLKSKNITEVYIKLYLMYSEQQLSRVMKRKTK
SIVLSDENNFNESFNFHTQLEGMLLQVSLWSCGKGLNVHKMLGEAVIHLD
DIEFVKKNSKKDVSGWYKLLKPDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0098793presynapse
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0031340positive regulation of vesicle fusion
GO:0032024positive regulation of insulin secretion
GO:0045956positive regulation of calcium ion-dependent exocytosis
GO:0048791calcium ion-regulated exocytosis of neurotransmitter
GO:0006886intracellular protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR001478PDZ