SMED30013751

Overview
NameSMED30013751
Smed IDSMED30013751
Length (bp)511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013751 (SMED30013751) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013751 (SMED30013751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013751 (SMED30013751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013751 (SMED30013751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013751 dd_Smed_v4_3938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013751 dd_Smed_v4_3938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30013751 dd_Smed_v4_3938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30013751 dd_Smed_v4_3938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013751 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001416:48870..49419 -2476
Homology
BLAST of SMED30013751 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 60.077 bits (144), Expect = 4.716e-12
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD   ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPSMK-ERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 60.077 bits (144), Expect = 4.716e-12
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD   ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPSMK-ERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 60.4622 bits (145), Expect = 1.038e-11
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:   47 MAAPSMK-ERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 106          
BLAST of SMED30013751 vs. Ensembl Human
Match: COA6 (cytochrome c oxidase assembly factor 6 [Source:HGNC Symbol;Acc:HGNC:18025])

HSP 1 Score: 60.8474 bits (146), Expect = 1.413e-11
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD   ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:   77 MAAPSMK-ERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 136          
BLAST of SMED30013751 vs. Ensembl Celegans
Match: coa-6 (Cytochrome Oxidase Assembly subunits [Source:UniProtKB/TrEMBL;Acc:A5JYU1])

HSP 1 Score: 46.2098 bits (108), Expect = 3.779e-7
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = -1
Query:  257 PLNKLERKTCWFYRDRFWNCLDS--------KEDESNCKNERKQFEESCPQRWVLHFDEKRRF 421
            P  K ER+ C+  RD++  C+D         KE  ++C++ERK F+ +CP  WV HF  K +F
Sbjct:    6 PSLKSERRKCYEARDQYAACIDKFLSQGKSEKEATNSCRSERKNFDGNCPTSWVNHFIRKDQF 68          
BLAST of SMED30013751 vs. Ensembl Celegans
Match: coa-6 (Cytochrome Oxidase Assembly subunits [Source:UniProtKB/TrEMBL;Acc:A5JYU1])

HSP 1 Score: 46.2098 bits (108), Expect = 3.779e-7
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = -1
Query:  257 PLNKLERKTCWFYRDRFWNCLDS--------KEDESNCKNERKQFEESCPQRWVLHFDEKRRF 421
            P  K ER+ C+  RD++  C+D         KE  ++C++ERK F+ +CP  WV HF  K +F
Sbjct:    6 PSLKSERRKCYEARDQYAACIDKFLSQGKSEKEATNSCRSERKNFDGNCPTSWVNHFIRKDQF 68          
BLAST of SMED30013751 vs. Ensembl Celegans
Match: coa-6 (Cytochrome Oxidase Assembly subunits [Source:UniProtKB/TrEMBL;Acc:A5JYU1])

HSP 1 Score: 46.2098 bits (108), Expect = 3.779e-7
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = -1
Query:  257 PLNKLERKTCWFYRDRFWNCLDS--------KEDESNCKNERKQFEESCPQRWVLHFDEKRRF 421
            P  K ER+ C+  RD++  C+D         KE  ++C++ERK F+ +CP  WV HF  K +F
Sbjct:    6 PSLKSERRKCYEARDQYAACIDKFLSQGKSEKEATNSCRSERKNFDGNCPTSWVNHFIRKDQF 68          
BLAST of SMED30013751 vs. Ensembl Celegans
Match: coa-6 (Cytochrome Oxidase Assembly subunits [Source:UniProtKB/TrEMBL;Acc:A5JYU1])

HSP 1 Score: 46.2098 bits (108), Expect = 3.779e-7
Identity = 24/63 (38.10%), Postives = 36/63 (57.14%), Query Frame = -1
Query:  257 PLNKLERKTCWFYRDRFWNCLDS--------KEDESNCKNERKQFEESCPQRWVLHFDEKRRF 421
            P  K ER+ C+  RD++  C+D         KE  ++C++ERK F+ +CP  WV HF  K +F
Sbjct:    6 PSLKSERRKCYEARDQYAACIDKFLSQGKSEKEATNSCRSERKNFDGNCPTSWVNHFIRKDQF 68          
BLAST of SMED30013751 vs. Ensembl Fly
Match: CG42376 (gene:FBgn0259722 transcript:FBtr0299977)

HSP 1 Score: 53.5286 bits (127), Expect = 1.054e-9
Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = -1
Query:  251 NKLERKTCWFYRDRFWNCLD----------SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 415
            +K ERK CW  RD +W CL+           ++  + C++ RK FE+SCP +WV HFD KR + Q
Sbjct:    5 DKAERKKCWNNRDEYWKCLEEHAPKHSSTSGEKVPTPCQSLRKSFEQSCPGQWVKHFDRKRTYDQ 69          
BLAST of SMED30013751 vs. Ensembl Fly
Match: CG42376 (gene:FBgn0259722 transcript:FBtr0299978)

HSP 1 Score: 53.5286 bits (127), Expect = 1.054e-9
Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = -1
Query:  251 NKLERKTCWFYRDRFWNCLD----------SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 415
            +K ERK CW  RD +W CL+           ++  + C++ RK FE+SCP +WV HFD KR + Q
Sbjct:    5 DKAERKKCWNNRDEYWKCLEEHAPKHSSTSGEKVPTPCQSLRKSFEQSCPGQWVKHFDRKRTYDQ 69          
BLAST of SMED30013751 vs. Ensembl Zebrafish
Match: coa6 (cytochrome c oxidase assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-070705-152])

HSP 1 Score: 52.373 bits (124), Expect = 2.178e-9
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSKED-ESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P N  +RK CW  RD  W CLD  +D  S C+  +++FE +CP +WV +F ++R F++
Sbjct:    1 MSAP-NASQRKACWDARDELWKCLDVNKDLTSACEKHQREFEANCPAQWVKYFSKRRDFLK 60          
BLAST of SMED30013751 vs. Ensembl Zebrafish
Match: coa6 (cytochrome c oxidase assembly factor 6 [Source:ZFIN;Acc:ZDB-GENE-070705-152])

HSP 1 Score: 52.373 bits (124), Expect = 2.178e-9
Identity = 25/61 (40.98%), Postives = 38/61 (62.30%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSKED-ESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P N  +RK CW  RD  W CLD  +D  S C+  +++FE +CP +WV +F ++R F++
Sbjct:    1 MSAP-NASQRKACWDARDELWKCLDVNKDLTSACEKHQREFEANCPAQWVKYFSKRRDFLK 60          
BLAST of SMED30013751 vs. Ensembl Xenopus
Match: ptgir (prostaglandin I2 receptor [Source:Xenbase;Acc:XB-GENE-982059])

HSP 1 Score: 59.3066 bits (142), Expect = 9.414e-12
Identity = 27/61 (44.26%), Postives = 42/61 (68.85%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD+  ED S C+N R+ F+ +CPQ+W+ +FD++R +++
Sbjct:    1 MAAPTAK-ERQACWDARDEYWQCLDANNEDASKCQNLRQSFKNNCPQQWMKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. Ensembl Xenopus
Match: ptgir (prostaglandin I2 receptor [Source:Xenbase;Acc:XB-GENE-982059])

HSP 1 Score: 58.151 bits (139), Expect = 4.368e-11
Identity = 27/61 (44.26%), Postives = 42/61 (68.85%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD+  ED S C+N R+ F+ +CPQ+W+ +FD++R +++
Sbjct:   28 MAAPTAK-ERQACWDARDEYWQCLDANNEDASKCQNLRQSFKNNCPQQWMKYFDKRRDYLK 87          
BLAST of SMED30013751 vs. Ensembl Mouse
Match: Coa6 (cytochrome c oxidase assembly factor 6 [Source:MGI Symbol;Acc:MGI:1915142])

HSP 1 Score: 58.5362 bits (140), Expect = 1.343e-11
Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED + C+  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPSMK-ERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. Ensembl Mouse
Match: Coa6 (cytochrome c oxidase assembly factor 6 [Source:MGI Symbol;Acc:MGI:1915142])

HSP 1 Score: 58.5362 bits (140), Expect = 1.343e-11
Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED + C+  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPSMK-ERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. UniProt/SwissProt
Match: sp|Q2M2S5|COA6_BOVIN (Cytochrome c oxidase assembly factor 6 homolog OS=Bos taurus OX=9913 GN=COA6 PE=3 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 8.515e-12
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPTMK-ERQACWGARDEYWKCLDENTEDASKCKKLRSSFESSCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. UniProt/SwissProt
Match: sp|Q5JTJ3|COA6_HUMAN (Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.987e-11
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:   47 MAAPSMK-ERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 106          
BLAST of SMED30013751 vs. UniProt/SwissProt
Match: sp|Q8BGD8|COA6_MOUSE (Cytochrome c oxidase assembly factor 6 homolog OS=Mus musculus OX=10090 GN=Coa6 PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 9.395e-11
Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P  K ER+ CW  RD +W CLD + ED + C+  R  FE SCPQ+W+ +FD++R +++
Sbjct:    1 MAAPSMK-ERQACWGARDLYWRCLDDNAEDAARCQKLRSSFEASCPQQWIKYFDKRRDYLK 60          
BLAST of SMED30013751 vs. UniProt/SwissProt
Match: sp|Q3E846|COA6_YEAST (Cytochrome c oxidase assembly factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COA6 PE=1 SV=1)

HSP 1 Score: 46.9802 bits (110), Expect = 3.502e-6
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = -1
Query:  263 PLNKLERKTCWFYRDRFWNCLD------------SKEDESNCKNERKQFEESCPQRWVLHFDEKR 421
            P  + +RK CW  RD F+ CLD            SK  +S+CK E ++FEE+C   W+ +F EKR
Sbjct:   16 PNTRSQRKLCWESRDAFFQCLDKADILDAMDPKNSKSIKSHCKVENEKFEENCAHSWIKYFKEKR 80          
BLAST of SMED30013751 vs. TrEMBL
Match: A0A383ZF81 (cytochrome c oxidase assembly factor 6 homolog isoform X1 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=LOC103001175 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.297e-10
Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = -1
Query:  251 LLNNYFMPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 448
            +LN   M  P  K ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:    2 VLNPLGMAAPSMK-ERQACWGARDEYWKCLDENTEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 67          
BLAST of SMED30013751 vs. TrEMBL
Match: A0A2Y9DEM5 (cytochrome c oxidase assembly factor 6 homolog isoform X1 OS=Trichechus manatus latirostris OX=127582 GN=LOC101348249 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.998e-10
Identity = 31/72 (43.06%), Postives = 45/72 (62.50%), Query Frame = -1
Query:  251 NHLLNNYFMPKPL---NKLERKTCWFYRDRFWNCLDSK-EDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 454
            N LL N  +P  +   +  ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:   23 NVLLANSLIPLGMAAPSMKERQACWEARDEYWKCLDERNEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 94          
BLAST of SMED30013751 vs. TrEMBL
Match: A0A293LTL9 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.408e-10
Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = -1
Query:  251 NKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 415
            NK +R+ CW  RDR+W CLD + +D S C + RKQ+E  CP +WV HFD KR ++Q
Sbjct:    5 NKAQRQQCWDSRDRYWECLDRNADDASKCVDVRKQYEGLCPSQWVKHFDRKREYLQ 60          
BLAST of SMED30013751 vs. TrEMBL
Match: A0A3Q7NTG3 (cytochrome c oxidase assembly factor 6 homolog isoform X1 OS=Callorhinus ursinus OX=34884 GN=LOC112807936 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 6.517e-10
Identity = 32/74 (43.24%), Postives = 44/74 (59.46%), Query Frame = -1
Query:  251 L*FCINHLLNNYFMPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 469
            L F     L+   M  P  K ER+ CW  RD +W CLD + ED S CK  R  FE SCPQ+W+ +FD++R +++
Sbjct:   12 LAFLCTPGLSPLGMAAPSMK-ERQACWGARDEYWKCLDENTEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLK 84          
BLAST of SMED30013751 vs. TrEMBL
Match: H0ZIW2 (Cytochrome c oxidase assembly factor 6 OS=Taeniopygia guttata OX=59729 GN=COA6 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 7.662e-10
Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = -1
Query:  251 ERKTCWFYRDRFWNCLDS-KEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 406
            ERK CW  RD FW CLDS  +D + C+  R+ FE  CPQ+WV HFD++R F++
Sbjct:   11 ERKACWGARDEFWQCLDSHGDDAAKCEKLRRAFESRCPQQWVKHFDKRRDFLK 63          
BLAST of SMED30013751 vs. Ensembl Cavefish
Match: coa6 (cytochrome c oxidase assembly factor 6 homolog [Source:NCBI gene;Acc:103022513])

HSP 1 Score: 50.8322 bits (120), Expect = 7.305e-9
Identity = 24/61 (39.34%), Postives = 39/61 (63.93%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLD-SKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P N  ER+ CW  RD FW CLD +++D + C+  +  FE  CP +WV +F+++R +++
Sbjct:    1 MSAP-NSQERRACWGARDEFWKCLDHNRDDVAACEKYKTDFEMLCPAQWVKYFNKRRDYLK 60          
BLAST of SMED30013751 vs. Ensembl Yeast
Match: COA6 (Protein involved in cytochrome c oxidase (Complex IV) assembly; involved in delivery of copper to Complex IV; also required for efficient formation of respiratory supercomplexes comprised of Complexes III and IV; localizes to the mitochondrial intermembrane space; ortholog implicated in cardiac defects in zebrafish and human; transcription is induced in response to the DNA-damaging agent MMS; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004857])

HSP 1 Score: 46.9802 bits (110), Expect = 5.044e-8
Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = -1
Query:  263 PLNKLERKTCWFYRDRFWNCLD------------SKEDESNCKNERKQFEESCPQRWVLHFDEKR 421
            P  + +RK CW  RD F+ CLD            SK  +S+CK E ++FEE+C   W+ +F EKR
Sbjct:   16 PNTRSQRKLCWESRDAFFQCLDKADILDAMDPKNSKSIKSHCKVENEKFEENCAHSWIKYFKEKR 80          
BLAST of SMED30013751 vs. Ensembl Nematostella
Match: EDO28917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T547])

HSP 1 Score: 44.2838 bits (103), Expect = 8.261e-7
Identity = 22/59 (37.29%), Postives = 33/59 (55.93%), Query Frame = -1
Query:  257 MPKPLNKLERKTCWFYRDRFWNCLDSKEDESN-CKNERKQFEESCPQRWVLHFDEKRRF 430
            MP P  + ER+ C   RD ++ C+D    ES  CK  +  +++SCP  WV +F  KR +
Sbjct:    1 MPAPTTE-ERRKCHQTRDAYFKCVDENGSESALCKEAKALYDKSCPASWVKYFARKRAY 58          
BLAST of SMED30013751 vs. Ensembl Nematostella
Match: EDO40270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7P0])

HSP 1 Score: 45.0542 bits (105), Expect = 3.368e-6
Identity = 22/59 (37.29%), Postives = 33/59 (55.93%), Query Frame = -1
Query:  257 MPKPLNKLERKTCWFYRDRFWNCLDSKEDESN-CKNERKQFEESCPQRWVLHFDEKRRF 430
            MP P  + ER+ C   RD ++ C+D    ES  CK  +  +++SCP  WV +F  KR +
Sbjct:  140 MPAPTTE-ERRKCHQTRDAYFKCVDENGSESALCKEAKALYDKSCPASWVKYFARKRAY 197          
BLAST of SMED30013751 vs. Ensembl Medaka
Match: coa6 (cytochrome c oxidase assembly factor 6 homolog [Source:NCBI gene;Acc:101169596])

HSP 1 Score: 50.447 bits (119), Expect = 9.759e-9
Identity = 23/61 (37.70%), Postives = 36/61 (59.02%), Query Frame = -1
Query:  251 MPKPLNKLERKTCWFYRDRFWNCLDSKEDES-NCKNERKQFEESCPQRWVLHFDEKRRFIQ 430
            M  P N  ER+ CW  RD  W CLD   D +  C+ ++  F++ CP +WV +F ++R F++
Sbjct:    1 MTAP-NSAERRVCWDARDLLWKCLDDNHDSAEACQKQQSHFQDKCPAQWVRYFSKRRDFLK 60          
BLAST of SMED30013751 vs. Planmine SMEST
Match: SMESG000019957.1 (SMESG000019957.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.961e-39
Identity = 62/62 (100.00%), Postives = 62/62 (100.00%), Query Frame = -1
Query:  245 MPKPLNKLERKTCWFYRDRFWNCLDSKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQDQ 430
            MPKPLNKLERKTCWFYRDRFWNCLDSKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQDQ
Sbjct:    1 MPKPLNKLERKTCWFYRDRFWNCLDSKEDESNCKNERKQFEESCPQRWVLHFDEKRRFIQDQ 62          
BLAST of SMED30013751 vs. Planmine SMEST
Match: SMESG000019958.1 (SMESG000019958.1)

HSP 1 Score: 63.5438 bits (153), Expect = 6.795e-14
Identity = 33/59 (55.93%), Postives = 39/59 (66.10%), Query Frame = -1
Query:  257 MPKPLNKLERKTCWFYRDRFWNCLDSKEDES-NCKNERKQFEESCPQRWVLHFDEKRRF 430
            M  P  K ERK CW  RD FW+CLD+  +ES  C NERK +E+ C  +WVLHFD KR F
Sbjct:    1 MGDPPTKEERKKCWESRDEFWHCLDNNNEESEKCLNERKLYEKYCSHQWVLHFDRKRAF 59          
The following BLAST results are available for this feature:
BLAST of SMED30013751 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
COA64.716e-1247.54cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA64.716e-1247.54cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA61.038e-1147.54cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
COA61.413e-1147.54cytochrome c oxidase assembly factor 6 [Source:HGN... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
coa-63.779e-738.10Cytochrome Oxidase Assembly subunits [Source:UniP... [more]
coa-63.779e-738.10Cytochrome Oxidase Assembly subunits [Source:UniP... [more]
coa-63.779e-738.10Cytochrome Oxidase Assembly subunits [Source:UniP... [more]
coa-63.779e-738.10Cytochrome Oxidase Assembly subunits [Source:UniP... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG423761.054e-941.54gene:FBgn0259722 transcript:FBtr0299977[more]
CG423761.054e-941.54gene:FBgn0259722 transcript:FBtr0299978[more]
back to top
BLAST of SMED30013751 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
coa62.178e-940.98cytochrome c oxidase assembly factor 6 [Source:ZFI... [more]
coa62.178e-940.98cytochrome c oxidase assembly factor 6 [Source:ZFI... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptgir9.414e-1244.26prostaglandin I2 receptor [Source:Xenbase;Acc:XB-G... [more]
ptgir4.368e-1144.26prostaglandin I2 receptor [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Coa61.343e-1144.26cytochrome c oxidase assembly factor 6 [Source:MGI... [more]
Coa61.343e-1144.26cytochrome c oxidase assembly factor 6 [Source:MGI... [more]
back to top
BLAST of SMED30013751 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q2M2S5|COA6_BOVIN8.515e-1247.54Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
sp|Q5JTJ3|COA6_HUMAN4.987e-1147.54Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
sp|Q8BGD8|COA6_MOUSE9.395e-1144.26Cytochrome c oxidase assembly factor 6 homolog OS=... [more]
sp|Q3E846|COA6_YEAST3.502e-640.00Cytochrome c oxidase assembly factor 6 OS=Saccharo... [more]
back to top
BLAST of SMED30013751 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A383ZF811.297e-1046.27cytochrome c oxidase assembly factor 6 homolog iso... [more]
A0A2Y9DEM51.998e-1043.06cytochrome c oxidase assembly factor 6 homolog iso... [more]
A0A293LTL95.408e-1051.79Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A3Q7NTG36.517e-1043.24cytochrome c oxidase assembly factor 6 homolog iso... [more]
H0ZIW27.662e-1052.83Cytochrome c oxidase assembly factor 6 OS=Taeniopy... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coa67.305e-939.34cytochrome c oxidase assembly factor 6 homolog [So... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013751 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COA65.044e-840.00Protein involved in cytochrome c oxidase (Complex ... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO289178.261e-737.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402703.368e-637.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013751 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
coa69.759e-937.70cytochrome c oxidase assembly factor 6 homolog [So... [more]
back to top
BLAST of SMED30013751 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019957.11.961e-39100.00SMESG000019957.1[more]
SMESG000019958.16.795e-1455.93SMESG000019958.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013751 ID=SMED30013751|Name=SMED30013751|organism=Schmidtea mediterranea sexual|type=transcript|length=511bp
TCATCAACATGTACACATGTATTTGCTCTACTCAAAACGTTCAAAGGATT
AAATTGAACTTCAATTATATAATCACATTCATACGTTAAACATAAAAAAC
ATTATAATTTATTGAGAATAAACTACAAAATTGTAATTTAAAAGAACTCT
AAATTTCATTTAATATATTAAAAAACTAAAATAAATAGGCGATGCAATTA
AGCTTTAAATGATAACGATTTTTTTAGATTTCTTTTATCTTAATTTGATC
TTGAATGAAGCGACGTTTCTCATCAAAATGTAAAACCCATCTTTGTGGAC
AACTTTCTTCAAATTGCTTTCGTTCATTTTTACAGTTAGACTCATCTTCT
TTTGAGTCAAGACAATTCCAAAATCTATCACGATAAAACCAGCAGGTTTT
CCTTTCTAATTTATTTAATGGTTTTGGCATGAAATAGTTATTTAATAAGT
GATTGATACAAAATTATAATGTATTGTATCAAATATCTTTGAATTGTTTG
AAAAACTCCAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR042289COA6
IPR036549Cyt_c_oxidase_su6B_sf
IPR003213Cyt_c_oxidase_su6B
Vocabulary: biological process
TermDefinition
GO:0008535respiratory chain complex IV assembly
Vocabulary: molecular function
TermDefinition
GO:0004129cytochrome-c oxidase activity
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003213Cytochrome c oxidase, subunit VIbPFAMPF02297COX6Bcoord: 6..58
e-value: 8.4E-14
score: 51.6
IPR042289Cytochrome c oxidase assembly factor 6 homologPANTHERPTHR46690FAMILY NOT NAMEDcoord: 1..65
NoneNo IPR availablePROSITEPS51808CHCHcoord: 10..52
score: 12.657
IPR036549Cytochrome c oxidase, subunit VIb superfamilySUPERFAMILYSSF47694Cytochrome c oxidase subunit hcoord: 6..57