Fork-head domain-containing protein

Overview
NameFork-head domain-containing protein
Smed IDSMED30013740
Length (bp)639
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fork-head domain-containing protein (SMED30013740) t-SNE clustered cells

Violin plots show distribution of expression levels for Fork-head domain-containing protein (SMED30013740) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fork-head domain-containing protein (SMED30013740) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fork-head domain-containing protein (SMED30013740) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013740

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
body wall muscle cellSMED30013740h1SMcG0000287 BK013021smed_ncbi_20240424PMID:33536473
Pascual-Carreras et al., 2021
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013740h1SMcG0000287 dd_Smed_v4_17749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30013740h1SMcG0000287 dd_Smed_v4_17749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30013740h1SMcG0000287 dd_Smed_v4_17749_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30013740h1SMcG0000287 dd_Smed_v4_17749_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXD4 (forkhead box D4 [Source:HGNC Symbol;Acc:HGNC:3805])

HSP 1 Score: 165.236 bits (417), Expect = 2.016e-48
Identity = 73/99 (73.74%), Postives = 84/99 (84.85%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            +KPP SYIALITM+IL S  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKGNYW+LDPA+  MF+NGSFLRRR R++
Sbjct:  103 AKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQ 201          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXD1 (forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802])

HSP 1 Score: 156.762 bits (395), Expect = 5.383e-45
Identity = 78/111 (70.27%), Postives = 89/111 (80.18%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEE 428
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGSFLRRR R+K    +  N +  E
Sbjct:  125 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAE 235          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXD2 (forkhead box D2 [Source:HGNC Symbol;Acc:HGNC:3803])

HSP 1 Score: 156.377 bits (394), Expect = 1.133e-44
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  127 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 215          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXD4L1 (forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGNC:18521])

HSP 1 Score: 152.91 bits (385), Expect = 5.325e-44
Identity = 67/90 (74.44%), Postives = 76/90 (84.44%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            +KPPYSYIALITM+IL S  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKG YW+LDPA+  MF+NGS
Sbjct:  106 AKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGS 195          
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Match: FOXD4L3 (forkhead box D4 like 3 [Source:HGNC Symbol;Acc:HGNC:18523])

HSP 1 Score: 152.525 bits (384), Expect = 9.266e-44
Identity = 67/90 (74.44%), Postives = 77/90 (85.56%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            +KPPYSYIALITM+IL +  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKGNYW+LDPA+  MF+NGS
Sbjct:  107 AKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGS 196          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: unc-130 (pep chromosome:WBcel235:II:11281986:11283953:1 gene:WBGene00006853.1 transcript:C47G2.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-130)

HSP 1 Score: 166.777 bits (421), Expect = 2.279e-50
Identity = 76/102 (74.51%), Postives = 85/102 (83.33%), Query Frame = 3
Query:   84 SKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            S H+KPPYSYIALI MSIL+S EK+LTL+EIC FII  F YY+E+FP+WQNSIRHNLSLNDCFVK  R PG+ GKGNYW LDP    MF+NGSFLRRR RYK
Sbjct:  123 SSHAKPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK 224          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 119.398 bits (298), Expect = 9.357e-32
Identity = 56/100 (56.00%), Postives = 72/100 (72.00%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
             SKPPYSYI+LITM+I  S  ++LTL+EI ++I+  FPYY+     WQNSIRH+LS NDCFVK  R P   GKG++W L     +MFENG +LRR+ R+K
Sbjct:  139 QSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 238          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 119.783 bits (299), Expect = 1.066e-31
Identity = 56/100 (56.00%), Postives = 72/100 (72.00%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
             SKPPYSYI+LITM+I  S  ++LTL+EI ++I+  FPYY+     WQNSIRH+LS NDCFVK  R P   GKG++W L     +MFENG +LRR+ R+K
Sbjct:  170 QSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 269          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 120.168 bits (300), Expect = 1.487e-31
Identity = 56/100 (56.00%), Postives = 72/100 (72.00%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
             SKPPYSYI+LITM+I  S  ++LTL+EI ++I+  FPYY+     WQNSIRH+LS NDCFVK  R P   GKG++W L     +MFENG +LRR+ R+K
Sbjct:  234 QSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFK 333          
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Match: fkh-6 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:Q10924])

HSP 1 Score: 113.235 bits (282), Expect = 6.252e-30
Identity = 59/120 (49.17%), Postives = 75/120 (62.50%), Query Frame = 3
Query:   45 HLLNRIFTFMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRE----RFPSWQNSIRHNLSLNDCFVKQPREPGSSG---KGNYWNLDPAAVSMFENGSFLRRRTR 383
            H  +  F  ++  +   KPPYSY+ALI M+I  S +KR+TLN+I  FI   FPYYR+    R   WQNSIRHNLSLNDCFVK+ R+  S     KGNYW +       F+NG+F RRR +
Sbjct:    4 HQTHLPFHIVQEGNSIDKPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYWQMVADNAPQFDNGNFKRRRVK 123          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: fd59A (gene:FBgn0004896 transcript:FBtr0071898)

HSP 1 Score: 167.933 bits (424), Expect = 1.299e-49
Identity = 72/105 (68.57%), Postives = 88/105 (83.81%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRK 410
            KPPYSYIALITM+IL S  K+LTL+ IC FI+  FPYY+++FP+WQNSIRHNLSLNDCF+K PREPG+ GKGN+W LDP A  MF+NGSFLRRR RYK +  +++
Sbjct:   85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQR 189          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: fd96Cb (gene:FBgn0004898 transcript:FBtr0084771)

HSP 1 Score: 130.954 bits (328), Expect = 3.897e-37
Identity = 62/116 (53.45%), Postives = 80/116 (68.97%), Query Frame = 3
Query:   72 MKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQS 419
            +K      KPPYSYI+L  M+I+HS ++ L L+EI  FI+  FP+YR+    WQNS+RHNLS NDCF+K PR    +GKG+YW L P A  MFENGS LRRR R++  KQ+ K+ S
Sbjct:    5 LKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFR-VKQLEKDIS 119          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 129.798 bits (325), Expect = 1.000e-35
Identity = 67/131 (51.15%), Postives = 80/131 (61.07%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEE-----EFNKFHKTINDEKSCS 473
            KPPYSYI+L  M+I  S EK L L++I  FI   FPYYR+    WQNS+RHNLS NDCF+K PR P   GKG YW L P A  MFENGS LRRR R+K  K  +   +EE       N+F  T  +  S +
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSAA 143          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 129.798 bits (325), Expect = 1.000e-35
Identity = 67/131 (51.15%), Postives = 80/131 (61.07%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEE-----EFNKFHKTINDEKSCS 473
            KPPYSYI+L  M+I  S EK L L++I  FI   FPYYR+    WQNS+RHNLS NDCF+K PR P   GKG YW L P A  MFENGS LRRR R+K  K  +   +EE       N+F  T  +  S +
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSAA 143          
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0300259)

HSP 1 Score: 131.339 bits (329), Expect = 1.409e-35
Identity = 64/134 (47.76%), Postives = 89/134 (66.42%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKFHKTINDEKSCSSTDSKK 491
            H+KPPYSYI+LITM+I ++  + LTL+EI  FI+  FP+YR+    WQNSIRH+LS NDCFVK PR P   GKG++W L P + +MFENG +LRR+ R+K  K+       E   + HK+ +     +++  KK
Sbjct:  208 HAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKDEKK-------EAIRQLHKSPSHSSLEATSPGKK 334          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 156.762 bits (395), Expect = 3.418e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   74 KPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 162          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxd2 (forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6])

HSP 1 Score: 156.377 bits (394), Expect = 8.397e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   95 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 183          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 154.066 bits (388), Expect = 6.992e-45
Identity = 69/96 (71.88%), Postives = 78/96 (81.25%), Query Frame = 3
Query:   75 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            K  S   KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   89 KPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 184          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 151.754 bits (382), Expect = 1.532e-44
Identity = 68/99 (68.69%), Postives = 79/99 (79.80%), Query Frame = 3
Query:   66 TFMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            T     S   KPPYSYIALITM+IL S  K+LTL+ IC FI   FPYY+E+FP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW+LDPA+  MF+NGS
Sbjct:   63 TVAPKQSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGS 161          
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Match: foxd5 (forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4])

HSP 1 Score: 151.754 bits (382), Expect = 1.532e-44
Identity = 68/99 (68.69%), Postives = 79/99 (79.80%), Query Frame = 3
Query:   66 TFMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            T     S   KPPYSYIALITM+IL S  K+LTL+ IC FI   FPYY+E+FP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW+LDPA+  MF+NGS
Sbjct:   63 TVAPKQSSSVKPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWSLDPASEDMFDNGS 161          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: foxd1 (forkhead box D1 [Source:NCBI gene;Acc:493510])

HSP 1 Score: 155.606 bits (392), Expect = 7.890e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 156          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: FOXD2 (forkhead box D2 [Source:NCBI gene;Acc:100495241])

HSP 1 Score: 155.606 bits (392), Expect = 1.356e-45
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   78 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 166          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:496851])

HSP 1 Score: 152.91 bits (385), Expect = 2.259e-44
Identity = 67/89 (75.28%), Postives = 76/89 (85.39%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   92 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 180          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: ankra2 (ankyrin repeat family A member 2 [Source:Xenbase;Acc:XB-GENE-1002386])

HSP 1 Score: 149.443 bits (376), Expect = 3.417e-43
Identity = 65/89 (73.03%), Postives = 76/89 (85.39%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S  K+LTL+ IC FI   FPYY+++FP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDPA+  MF+NGS
Sbjct:   97 KPPYSYIALITMAILQSPHKKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASEDMFDNGS 185          
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Match: arhgef28 (Rho guanine nucleotide exchange factor 28 [Source:Xenbase;Acc:XB-GENE-952324])

HSP 1 Score: 146.747 bits (369), Expect = 2.423e-42
Identity = 67/98 (68.37%), Postives = 80/98 (81.63%), Query Frame = 3
Query:   81 DSKHS----KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            DSK S    KPPYSYIALITM+I+ S  ++LTL+ IC FI   FPYY+++FP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDPA+  MF+NGS
Sbjct:   88 DSKASRAFLKPPYSYIALITMAIVQSPYRKLTLSGICDFISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMFDNGS 185          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxd1 (forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463])

HSP 1 Score: 157.147 bits (396), Expect = 2.379e-45
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  130 KPPYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 218          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxd2 (forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471])

HSP 1 Score: 156.377 bits (394), Expect = 7.898e-45
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  129 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 217          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxd4 (forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467])

HSP 1 Score: 154.836 bits (390), Expect = 1.416e-44
Identity = 69/99 (69.70%), Postives = 79/99 (79.80%), Query Frame = 3
Query:   66 TFMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            T      + +KPPYSYIALITM+IL S  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKGNYW+LDPA+  MF+NGS
Sbjct:   93 TTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGS 191          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 153.295 bits (386), Expect = 9.755e-44
Identity = 67/89 (75.28%), Postives = 76/89 (85.39%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  131 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 219          
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Match: Foxd3 (forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473])

HSP 1 Score: 153.295 bits (386), Expect = 9.755e-44
Identity = 67/89 (75.28%), Postives = 76/89 (85.39%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  131 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGS 219          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q02361|FD3_DROME (Fork head domain-containing protein FD3 OS=Drosophila melanogaster OX=7227 GN=fd59A PE=2 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 1.302e-48
Identity = 72/105 (68.57%), Postives = 88/105 (83.81%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRK 410
            KPPYSYIALITM+IL S  K+LTL+ IC FI+  FPYY+++FP+WQNSIRHNLSLNDCF+K PREPG+ GKGN+W LDP A  MF+NGSFLRRR RYK +  +++
Sbjct:   85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQR 189          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q12950|FOXD4_HUMAN (Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4)

HSP 1 Score: 165.236 bits (417), Expect = 9.683e-48
Identity = 73/99 (73.74%), Postives = 84/99 (84.85%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            +KPP SYIALITM+IL S  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKGNYW+LDPA+  MF+NGSFLRRR R++
Sbjct:  103 AKPPSSYIALITMAILQSPHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSLDPASQDMFDNGSFLRRRKRFQ 201          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q63251|FOXD1_RAT (Forkhead box protein D1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.473e-47
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:    3 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 91          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q63249|FOXD4_RAT (Forkhead box protein D4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd4 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.795e-46
Identity = 68/90 (75.56%), Postives = 77/90 (85.56%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            +KPPYSYIALITM+IL S  KRLTL+ IC+FI   FPYYR +FP+WQNSIRHNLSLNDCFVK PREPG  GKGNYW+LDPA+  MF+NGS
Sbjct:    2 AKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGS 91          
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9PSY4|FOXD1_XENLA (Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 1.707e-45
Identity = 70/89 (78.65%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITMSIL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   68 KPPYSYIALITMSILQSPKKRLTLSEICDFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 156          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A564Z848 (Fork-head domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12925 PE=4 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 3.245e-54
Identity = 80/107 (74.77%), Postives = 95/107 (88.79%), Query Frame = 3
Query:   69 FMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            F+ SDS  +KPPYSYIALITM+++HS++ RLTL+ IC +I+ NFPYYR RFP+WQNSIRHNLSLNDCFVK PREPGS+GKGNYW+LDP AV MF+NGSFLRR+ RYK
Sbjct:   57 FVDSDSSSTKPPYSYIALITMALIHSRDNRLTLSGICDYIMQNFPYYRVRFPAWQNSIRHNLSLNDCFVKVPREPGSTGKGNYWSLDPEAVDMFKNGSFLRRKKRYK 163          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A0R3SWD2 (Fork-head domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9978 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 3.705e-54
Identity = 80/107 (74.77%), Postives = 95/107 (88.79%), Query Frame = 3
Query:   69 FMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            F+ SDS  +KPPYSYIALITM+++HS++ RLTL+ IC +I+ NFPYYR RFP+WQNSIRHNLSLNDCFVK PREPGS+GKGNYW+LDP AV MF+NGSFLRR+ RYK
Sbjct:   69 FVDSDSSSTKPPYSYIALITMALIHSRDNRLTLSGICDYIMQNFPYYRVRFPAWQNSIRHNLSLNDCFVKVPREPGSTGKGNYWSLDPEAVDMFKNGSFLRRKKRYK 175          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A0R3TE89 (Fork-head domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5376 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.364e-52
Identity = 79/107 (73.83%), Postives = 91/107 (85.05%), Query Frame = 3
Query:   69 FMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            F   DS   KPP+SYIALITM+++HS+E RLTL+ IC +I+ NFPYYR RFP+WQNSIRHNLSLNDCFVK PREPGS+GKGNYW LDP AV MF+NGSFLRR+ RYK
Sbjct:   63 FGDHDSSSIKPPFSYIALITMALMHSRENRLTLSSICDYIMQNFPYYRVRFPAWQNSIRHNLSLNDCFVKVPREPGSTGKGNYWALDPEAVDMFKNGSFLRRKKRYK 169          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: A0A183ANY6 (Fork-head domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8671 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.057e-50
Identity = 78/108 (72.22%), Postives = 93/108 (86.11%), Query Frame = 3
Query:   69 FMKSDSKHS-KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            F+ +  +HS KPPYSYIALITM+ILHS +++LTL+ IC+FI+  FPYYRERFP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDP +  MF+NGSFLRRR RYK
Sbjct:   55 FVPTGPRHSVKPPYSYIALITMAILHSPQRKLTLSGICNFIMDKFPYYRERFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWILDPNSEDMFDNGSFLRRRKRYK 162          
BLAST of Fork-head domain-containing protein vs. TrEMBL
Match: F1BVN2 (Forkhead box d (Fragment) OS=Patiria miniata OX=46514 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.299e-50
Identity = 78/105 (74.29%), Postives = 88/105 (83.81%), Query Frame = 3
Query:   75 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            K+ S   KPPYSYIALITM+IL S +KRLTL+ IC FI+  FPYYRE+FP WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDPA+  MF+NGSFLRRR RYK
Sbjct:  120 KAKSSTVKPPYSYIALITMAILQSPQKRLTLSGICEFIMNRFPYYREKFPIWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASEDMFDNGSFLRRRKRYK 224          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: zgc:162612 (zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88])

HSP 1 Score: 156.377 bits (394), Expect = 6.267e-47
Identity = 71/96 (73.96%), Postives = 79/96 (82.29%), Query Frame = 3
Query:   75 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            K  S   KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   37 KLKSGTVKPPYSYIALITMAILQSPKKRLTLSEICDFISRRFPYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSADMFDNGS 132          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxd1 (forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2094])

HSP 1 Score: 157.147 bits (396), Expect = 2.262e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   68 KPPYSYIALITMAILQSPKKRLTLSEICDFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 156          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxd2 (forkhead box protein D2 [Source:NCBI gene;Acc:103022344])

HSP 1 Score: 157.147 bits (396), Expect = 8.922e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:  113 KPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGS 201          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxd3 (forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-143])

HSP 1 Score: 154.451 bits (389), Expect = 3.361e-45
Identity = 76/115 (66.09%), Postives = 91/115 (79.13%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKF 440
            KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGSFLRRR R+K    + ++Q+    + F
Sbjct:   65 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRQPDILRDQAALVMHGF 179          
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Match: foxc1b (forkhead box C1b [Source:NCBI gene;Acc:79375])

HSP 1 Score: 134.035 bits (336), Expect = 5.281e-39
Identity = 68/107 (63.55%), Postives = 80/107 (74.77%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQ 416
            KPPYSYIALITM+I  S EKR+TLN I  FI+  FP+YRE    WQNSIRHNLSLN+CFVK PR+    GKG+YW LDP + +MFENGSFLRRR R+K    +R  +
Sbjct:   72 KPPYSYIALITMAIQSSAEKRVTLNGIYQFIMERFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLRDKE 178          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 130.183 bits (326), Expect = 1.259e-38
Identity = 60/92 (65.22%), Postives = 73/92 (79.35%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLR 371
            KPPYSYIALITM+I  + +K++TLN I  FI+  FP+YRE    WQNSIRHNLSLN+CFVK PR+    GKG+YW+LDP + +MFENGSFLR
Sbjct:   77 KPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFENGSFLR 168          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005206.1 (pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 gene:ENSPMAG00000004735.1 transcript:ENSPMAT00000005206.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.494 bits (332), Expect = 3.076e-38
Identity = 62/104 (59.62%), Postives = 77/104 (74.04%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQ 401
            H+KPPYSYI+LITM+I  S  K LTLNEI S+I   FP+YR+    WQNSIRH+LS NDCFVK PR P   GKG++W L P + +MFENG +LRR+ R+K  K+
Sbjct:  153 HAKPPYSYISLITMAIQQSSGKMLTLNEIYSWITDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCDKK 256          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxb2 (forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-320])

HSP 1 Score: 132.494 bits (332), Expect = 1.059e-37
Identity = 62/98 (63.27%), Postives = 71/98 (72.45%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            KPPYSYI+L  M+I  S EK L L+EI  FI+  FPYYRE    WQNS+RHNLS NDCF+K PR P   GKG++W L PA   MFENGSFLRRR R+K
Sbjct:   13 KPPYSYISLTAMAIQSSAEKMLPLSEIYKFIMERFPYYRENTQRWQNSLRHNLSFNDCFIKIPRRPDQPGKGSFWALHPACGDMFENGSFLRRRKRFK 110          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxa2 (forkhead box A2 [Source:NCBI gene;Acc:30126])

HSP 1 Score: 132.88 bits (333), Expect = 4.813e-37
Identity = 61/109 (55.96%), Postives = 80/109 (73.39%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQ 416
            H+KPPYSYI+LITM+I  S  K +TLNEI S+I+  FP+YR+    WQNSIRH+LS NDCFVK PR P   GKG++W L P + +MFENG +LRR+ R+K  ++ +  Q
Sbjct:  159 HAKPPYSYISLITMAIQQSTHKMMTLNEIYSWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDKPGKGSFWALHPDSGNMFENGCYLRRQKRFKCDRKQKMPQ 267          
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Match: foxl2b (forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-1])

HSP 1 Score: 122.094 bits (305), Expect = 3.857e-36
Identity = 56/90 (62.22%), Postives = 66/90 (73.33%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSF 365
            KPPYSY+ALI M+I  S +KRLTL+ I  +II  FP+Y +    WQNSIRHNLSLN+CFVK PRE G   KGNYW LDPA   MFE G++
Sbjct:   22 KPPYSYVALIAMAIRESSDKRLTLSGIYQYIISKFPFYEKNKKGWQNSIRHNLSLNECFVKVPREGGGERKGNYWTLDPACEDMFEKGNY 111          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 98.5969 bits (244), Expect = 1.796e-24
Identity = 46/88 (52.27%), Postives = 63/88 (71.59%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENG 359
            KPPYSY  LI ++IL S+E +LTL++I  +I ++FPYY+++  SWQNSIRHNLSLND F+K   E    GKG++W + P A + F  G
Sbjct:  109 KPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKT--EKSCDGKGHFWEVRPGAETKFFKG 194          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 81.6481 bits (200), Expect = 1.330e-18
Identity = 39/80 (48.75%), Postives = 51/80 (63.75%), Query Frame = 3
Query:   81 DSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYW 320
            ++++ KPP+SY  +IT +IL S E  ++L +I  +I  N+ YYR     WQNSIRHNLSLN  F K PR P   GKG  W
Sbjct:  335 ENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKW 414          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 78.1814 bits (191), Expect = 1.565e-17
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 3
Query:   81 DSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNL 326
            ++++ KPP SY ++IT +IL + E  ++L +I  FI  N+ +YR    +WQNS+RHNLSLN  F K P+  G  GKG  W +
Sbjct:  298 ENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKI 379          
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 59.6918 bits (143), Expect = 4.242e-11
Identity = 36/80 (45.00%), Postives = 48/80 (60.00%), Query Frame = 3
Query:   93 SKPPYSYIALITMSIL-HSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLD 329
            +KP  SY A++T  I  +S  K ++L+EI + I   FPYY+     WQ+S+RHNLSLN  F K  +E    GKG  W LD
Sbjct:  460 TKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKE----GKGWLWGLD 535          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 154.451 bits (389), Expect = 7.970e-49
Identity = 69/90 (76.67%), Postives = 79/90 (87.78%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            SKPPYSYIALITM+IL S +++LTL++IC FI   FPYYRE+FPSWQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDPA+  MF+NGS
Sbjct:    2 SKPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPASEGMFDNGS 91          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO42098 (Forkhead domain protein D1; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q3LUS9])

HSP 1 Score: 135.191 bits (339), Expect = 3.572e-39
Identity = 63/120 (52.50%), Postives = 83/120 (69.17%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKFHKTIN 455
            +PPYSYIALI M++ +S EKRLTL+ IC FI   FP+YRE +PSW+  IR+NLSLNDCF+K   +     KGNYW LDP + +MFENGSFLRR+TR+K  ++  +    E    F   ++
Sbjct:   74 RPPYSYIALIAMAVQNSPEKRLTLDGICKFIRDRFPFYRETYPSWKICIRNNLSLNDCFIKTGIKSDEPLKGNYWTLDPESYNMFENGSFLRRKTRFKKQERAARESKGETSQSFSSPLD 193          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO42492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E3])

HSP 1 Score: 135.576 bits (340), Expect = 4.112e-39
Identity = 63/104 (60.58%), Postives = 77/104 (74.04%), Query Frame = 3
Query:   90 HSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQ 401
            H+KPPYSYI+LITM+I  S  K LTL+EI  FI+  FPYYR+    WQNSIRH+LS NDCFVK PR P   GKG+YW L P   +MFENG +LRR+ R+K+ K+
Sbjct:   38 HAKPPYSYISLITMAIQQSPNKMLTLSEIYQFIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVPRSPDRPGKGSYWTLHPDCGNMFENGCYLRRQKRFKAEKK 141          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO39562 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9S5])

HSP 1 Score: 130.183 bits (326), Expect = 2.199e-37
Identity = 60/103 (58.25%), Postives = 76/103 (73.79%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQ 401
            +KPPYSYI+L  M+I  S +K L+L+EI  FI+ +FP+YR+    WQNS+RHNLS NDCFVK PR P   GKG+ W L P   +MFENGSFLRRR R+KS ++
Sbjct:   12 AKPPYSYISLTAMAIQSSPQKMLSLSEIYQFIMDHFPFYRDNTQRWQNSLRHNLSFNDCFVKIPRRPDQPGKGSLWALHPDCGTMFENGSFLRRRKRFKSERE 114          
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Match: EDO47812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL76])

HSP 1 Score: 124.79 bits (312), Expect = 3.638e-37
Identity = 58/90 (64.44%), Postives = 66/90 (73.33%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSF 365
            KPPYSY+ALI M+I  S EKRLTLN I  +II  FPYY +    WQNSIRHNLSLN+CF+K PRE G   KGNYW LDPA   MFE G++
Sbjct:    1 KPPYSYVALIAMAIRESPEKRLTLNGIYQYIISKFPYYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY 90          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: FOXD2 (forkhead box D1 [Source:NCBI gene;Acc:100302451])

HSP 1 Score: 156.377 bits (394), Expect = 6.449e-46
Identity = 69/89 (77.53%), Postives = 77/89 (86.52%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   FPYYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MF+NGS
Sbjct:   89 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPDSADMFDNGS 177          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000004708.2 (forkhead box protein D1-like [Source:NCBI gene;Acc:101160044])

HSP 1 Score: 154.066 bits (388), Expect = 7.521e-46
Identity = 68/90 (75.56%), Postives = 76/90 (84.44%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            SKPPYSYIALITM+IL S +K+LTL EIC FI   F YY+ERFP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDP +  MFENGS
Sbjct:   54 SKPPYSYIALITMAILQSPKKKLTLGEICEFISQRFVYYQERFPAWQNSIRHNLSLNDCFIKMPREPGNPGKGNYWTLDPMSADMFENGS 143          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: foxd3 (forkhead box D3 [Source:NCBI gene;Acc:100301607])

HSP 1 Score: 156.377 bits (394), Expect = 1.352e-45
Identity = 69/99 (69.70%), Postives = 80/99 (80.81%), Query Frame = 3
Query:   66 TFMKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            T  K  S   KPPYSYIALITM+IL S +K+LTL+ IC FI   FPYYRE+FP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW +DPA+  MF+NGS
Sbjct:  109 TMQKPKSSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTMDPASEDMFDNGS 207          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: zgc:162612 (forkhead box D4 [Source:NCBI gene;Acc:100301608])

HSP 1 Score: 153.295 bits (386), Expect = 3.458e-45
Identity = 69/89 (77.53%), Postives = 76/89 (85.39%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            KPPYSYIALITM+IL S +KRLTL+EIC FI   F YYRE+FP+WQNSIRHNLSLNDCFVK PREPG+ GKGNYW LDP +  MFENGS
Sbjct:   65 KPPYSYIALITMAILQSPKKRLTLSEICDFISQRFVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMFENGS 153          
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Match: foxe3 (forkhead box E3 [Source:NCBI gene;Acc:100301611])

HSP 1 Score: 137.887 bits (346), Expect = 1.595e-38
Identity = 62/92 (67.39%), Postives = 71/92 (77.17%), Query Frame = 3
Query:   87 KHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGS 362
            +  KPPYSYIALI M+I +S E++LTL  I  FI+  FP+YRE    WQNSIRHNL+LNDCFVK PREPG  GKGNYW LDPAA  MF+NGS
Sbjct:   77 QRGKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHNLTLNDCFVKIPREPGRPGKGNYWTLDPAAEDMFDNGS 168          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000065690.1 (SMESG000065690.1)

HSP 1 Score: 312.383 bits (799), Expect = 3.104e-110
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:   72 MKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKFHKTINDEKSCSSTDSKKYLEFSIEALLE 524
            MKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKFHKTINDEKSCSSTDSKKYLEFSIEALLE
Sbjct:    1 MKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQVRKNQSEEEFNKFHKTINDEKSCSSTDSKKYLEFSIEALLE 151          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000077075.1 (SMESG000077075.1)

HSP 1 Score: 167.933 bits (424), Expect = 7.260e-50
Identity = 75/105 (71.43%), Postives = 89/105 (84.76%), Query Frame = 3
Query:   75 KSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            KS S + KPPYSYIALITM+IL S +++LTL+ IC FI+  FPYY++RFP+WQNSIRHNLSLNDCF+K PREPG+ GKGNYW LDP +  MF+NGSFLRRR RYK
Sbjct:  144 KSKSHNVKPPYSYIALITMAILRSPQRKLTLSGICEFIMGRFPYYKDRFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPRSEDMFDNGSFLRRRKRYK 248          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000021761.1 (SMESG000021761.1)

HSP 1 Score: 136.732 bits (343), Expect = 4.713e-40
Identity = 60/89 (67.42%), Postives = 72/89 (80.90%), Query Frame = 3
Query:   93 SKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENG 359
            SKPPYSYIALI M+I  S  K+LTL+EIC FI+  F YYR+RFP WQNSIRHNLSLNDCF+K PR+  + GKGN+W+LDP +  MF+NG
Sbjct:   26 SKPPYSYIALIAMAISSSPSKKLTLSEICDFIMKKFSYYRDRFPVWQNSIRHNLSLNDCFIKIPRDSNNPGKGNFWSLDPQSEGMFDNG 114          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000015673.1 (SMESG000015673.1)

HSP 1 Score: 140.969 bits (354), Expect = 1.383e-39
Identity = 70/128 (54.69%), Postives = 88/128 (68.75%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYKSSKQV------RKNQSEEEFNKFHKTINDE 461
            KPPYSYIALITM++    EK++TL+ I  FI+  FPYYRE    WQNSIRHNLSLN+CF+K PR+    GKG+YW L P A +MFENGSFLRRR R+K+   +      ++ Q E+E N F  T  D+
Sbjct:   73 KPPYSYIALITMAVHAHPEKKVTLSGIYQFIMEKFPYYRENKQGWQNSIRHNLSLNECFIKIPRDDKKPGKGSYWALHPQAYNMFENGSFLRRRRRFKAKDVLQDREDRKRKQQEDECNIFTSTSKDD 200          
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Match: SMESG000004239.1 (SMESG000004239.1)

HSP 1 Score: 132.494 bits (332), Expect = 1.031e-36
Identity = 64/98 (65.31%), Postives = 72/98 (73.47%), Query Frame = 3
Query:   96 KPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERFPSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLRRRTRYK 389
            KPPYSYIALITM+I    + R+TLN I  FI   FPYYRE    WQNSIRHNLSLN+CF+K  R    SGKG+YW L P A +MFENGSFLRRR R+K
Sbjct:  146 KPPYSYIALITMAITSQPDHRITLNGIYQFISERFPYYRENKQGWQNSIRHNLSLNECFIKVSRGDQRSGKGSYWTLHPNAYNMFENGSFLRRRRRFK 243          
The following BLAST results are available for this feature:
BLAST of Fork-head domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXD42.016e-4873.74forkhead box D4 [Source:HGNC Symbol;Acc:HGNC:3805][more]
FOXD15.383e-4570.27forkhead box D1 [Source:HGNC Symbol;Acc:HGNC:3802][more]
FOXD21.133e-4477.53forkhead box D2 [Source:HGNC Symbol;Acc:HGNC:3803][more]
FOXD4L15.325e-4474.44forkhead box D4 like 1 [Source:HGNC Symbol;Acc:HGN... [more]
FOXD4L39.266e-4474.44forkhead box D4 like 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1302.279e-5074.51pep chromosome:WBcel235:II:11281986:11283953:1 gen... [more]
pha-49.357e-3256.00Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.066e-3156.00Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.487e-3156.00Defective pharyngeal development protein 4 [Sourc... [more]
fkh-66.252e-3049.17ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd59A1.299e-4968.57gene:FBgn0004896 transcript:FBtr0071898[more]
fd96Cb3.897e-3753.45gene:FBgn0004898 transcript:FBtr0084771[more]
fd96Ca1.000e-3551.15gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca1.000e-3551.15gene:FBgn0004897 transcript:FBtr0084770[more]
fkh1.409e-3547.76gene:FBgn0000659 transcript:FBtr0300259[more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd13.418e-4677.53forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
foxd28.397e-4677.53forkhead box D2 [Source:ZFIN;Acc:ZDB-GENE-980605-6... [more]
foxd36.992e-4571.88forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
foxd51.532e-4468.69forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
foxd51.532e-4468.69forkhead box D5 [Source:ZFIN;Acc:ZDB-GENE-980605-4... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxd17.890e-4677.53forkhead box D1 [Source:NCBI gene;Acc:493510][more]
FOXD21.356e-4577.53forkhead box D2 [Source:NCBI gene;Acc:100495241][more]
foxd32.259e-4475.28forkhead box D3 [Source:NCBI gene;Acc:496851][more]
ankra23.417e-4373.03ankyrin repeat family A member 2 [Source:Xenbase;A... [more]
arhgef282.423e-4268.37Rho guanine nucleotide exchange factor 28 [Source:... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxd12.379e-4577.53forkhead box D1 [Source:MGI Symbol;Acc:MGI:1347463... [more]
Foxd27.898e-4577.53forkhead box D2 [Source:MGI Symbol;Acc:MGI:1347471... [more]
Foxd41.416e-4469.70forkhead box D4 [Source:MGI Symbol;Acc:MGI:1347467... [more]
Foxd39.755e-4475.28forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
Foxd39.755e-4475.28forkhead box D3 [Source:MGI Symbol;Acc:MGI:1347473... [more]
back to top
BLAST of Fork-head domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02361|FD3_DROME1.302e-4868.57Fork head domain-containing protein FD3 OS=Drosoph... [more]
sp|Q12950|FOXD4_HUMAN9.683e-4873.74Forkhead box protein D4 OS=Homo sapiens OX=9606 GN... [more]
sp|Q63251|FOXD1_RAT8.473e-4777.53Forkhead box protein D1 (Fragment) OS=Rattus norve... [more]
sp|Q63249|FOXD4_RAT6.795e-4675.56Forkhead box protein D4 (Fragment) OS=Rattus norve... [more]
sp|Q9PSY4|FOXD1_XENLA1.707e-4578.65Forkhead box protein D1 OS=Xenopus laevis OX=8355 ... [more]
back to top
BLAST of Fork-head domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Z8483.245e-5474.77Fork-head domain-containing protein OS=Hymenolepis... [more]
A0A0R3SWD23.705e-5474.77Fork-head domain-containing protein OS=Hymenolepis... [more]
A0A0R3TE899.364e-5273.83Fork-head domain-containing protein OS=Rodentolepi... [more]
A0A183ANY61.057e-5072.22Fork-head domain-containing protein OS=Echinostoma... [more]
F1BVN21.299e-5074.29Forkhead box d (Fragment) OS=Patiria miniata OX=46... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1626126.267e-4773.96zgc:162612 [Source:ZFIN;Acc:ZDB-GENE-070410-88][more]
foxd12.262e-4677.53forkhead box D1 [Source:ZFIN;Acc:ZDB-GENE-040426-2... [more]
foxd28.922e-4677.53forkhead box protein D2 [Source:NCBI gene;Acc:1030... [more]
foxd33.361e-4566.09forkhead box D3 [Source:ZFIN;Acc:ZDB-GENE-980526-1... [more]
foxc1b5.281e-3963.55forkhead box C1b [Source:NCBI gene;Acc:79375][more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXC21.259e-3865.22forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
ENSPMAT00000005206.13.076e-3859.62pep scaffold:Pmarinus_7.0:GL479371:8768:18483:1 ge... [more]
foxb21.059e-3763.27forkhead box B2 [Source:ZFIN;Acc:ZDB-GENE-081104-3... [more]
foxa24.813e-3755.96forkhead box A2 [Source:NCBI gene;Acc:30126][more]
foxl2b3.857e-3662.22forkhead box L2b [Source:ZFIN;Acc:ZDB-GENE-170803-... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HCM11.796e-2452.27Forkhead transcription factor; drives S-phase acti... [more]
FKH21.330e-1848.75Forkhead family transcription factor; rate-limitin... [more]
FKH11.565e-1743.90Forkhead family transcription factor; rate-limitin... [more]
FHL14.242e-1145.00Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451057.970e-4976.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420983.572e-3952.50Forkhead domain protein D1; Predicted protein [So... [more]
EDO424924.112e-3960.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395622.199e-3758.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478123.638e-3764.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fork-head domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXD26.449e-4677.53forkhead box D1 [Source:NCBI gene;Acc:100302451][more]
ENSORLT00000004708.27.521e-4675.56forkhead box protein D1-like [Source:NCBI gene;Acc... [more]
foxd31.352e-4569.70forkhead box D3 [Source:NCBI gene;Acc:100301607][more]
zgc:1626123.458e-4577.53forkhead box D4 [Source:NCBI gene;Acc:100301608][more]
foxe31.595e-3867.39forkhead box E3 [Source:NCBI gene;Acc:100301611][more]
back to top
BLAST of Fork-head domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065690.13.104e-110100.00SMESG000065690.1[more]
SMESG000077075.17.260e-5071.43SMESG000077075.1[more]
SMESG000021761.14.713e-4067.42SMESG000021761.1[more]
SMESG000015673.11.383e-3954.69SMESG000015673.1[more]
SMESG000004239.11.031e-3665.31SMESG000004239.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013740 ID=SMED30013740|Name=Fork-head domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=639bp
TAAAATCATTGGTGCATAAAAATGCATGGAAAATAAAATAATTTCACTTG
TTAAATCGTATTTTTACATTCATGAAATCCGACAGCAAGCATAGCAAACC
CCCTTACTCCTATATTGCCCTCATTACAATGTCAATTCTCCACTCAAAAG
AAAAGAGATTAACTCTGAATGAAATTTGTTCATTTATTATATTAAATTTC
CCTTACTATCGTGAGAGATTTCCATCGTGGCAGAATTCCATCAGGCACAA
TCTCTCATTGAATGATTGTTTTGTCAAACAGCCTCGGGAACCCGGAAGTT
CCGGCAAAGGAAATTATTGGAATTTAGACCCTGCAGCGGTCAGCATGTTT
GAGAACGGAAGTTTTCTGAGACGTCGAACAAGATACAAATCATCGAAACA
AGTGAGAAAAAATCAAAGTGAAGAAGAATTCAACAAATTTCACAAAACAA
TAAATGATGAAAAATCGTGTTCATCGACAGATAGTAAAAAATATTTGGAA
TTTTCCATTGAAGCTTTATTAGAGTGACCGAAATTGACCGGTTGATCATA
AATTGTGAATATAAGATTCACTGGAAAAATTCCCCCAACAATTGAAAGAT
CTGGTTGGATTTTATGTAAAATAAAGATTCTCCAGATCG
back to top

protein sequence of SMED30013740-orf-1

>SMED30013740-orf-1 ID=SMED30013740-orf-1|Name=SMED30013740-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MKSDSKHSKPPYSYIALITMSILHSKEKRLTLNEICSFIILNFPYYRERF
PSWQNSIRHNLSLNDCFVKQPREPGSSGKGNYWNLDPAAVSMFENGSFLR
RRTRYKSSKQVRKNQSEEEFNKFHKTINDEKSCSSTDSKKYLEFSIEALL
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
IPR030456TF_fork_head_CS_2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001755neural crest cell migration
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007398ectoderm development
GO:0007399nervous system development
GO:0007498mesoderm development
GO:0030154cell differentiation
GO:0030336negative regulation of cell migration
GO:0030900forebrain development
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 53..70
score: 79.85
coord: 30..47
score: 53.57
coord: 9..22
score: 72.96
IPR001766Fork head domainSMARTSM00339forkneu4coord: 7..97
e-value: 7.2E-54
score: 195.0
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 8..93
e-value: 3.4E-35
score: 120.2
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 9..103
score: 36.324
IPR001766Fork head domainCDDcd00059FHcoord: 9..86
e-value: 3.81752E-47
score: 145.389
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 7..109
e-value: 1.2E-42
score: 146.0
NoneNo IPR availablePANTHERPTHR11829FORKHEAD BOX PROTEINcoord: 2..116
NoneNo IPR availablePANTHERPTHR11829:SF346FORK HEAD DOMAIN-CONTAINING PROTEIN FD3coord: 2..116
IPR030456Fork head domain conserved site 2PROSITEPS00658FORK_HEAD_2coord: 53..59
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 8..102