Elongation factor 1-alpha

Overview
NameElongation factor 1-alpha
Smed IDSMED30013735
Length (bp)1638
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongation factor 1-alpha (SMED30013735) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongation factor 1-alpha (SMED30013735) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongation factor 1-alpha (SMED30013735) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongation factor 1-alpha (SMED30013735) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013735

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v4_30_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v4_30_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v4_30_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v4_30_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013735SMESG000061164.1 SMESG000061099.1 OX_Smed_1.0.18844ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v6_30_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v6_30_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013735SMESG000061164.1 SMESG000061099.1 dd_Smed_v6_30_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Match: EEF1A1 (eukaryotic translation elongation factor 1 alpha 1 [Source:HGNC Symbol;Acc:HGNC:3189])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Match: EEF1A2 (eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:HGNC:3192])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 403/443 (90.97%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFETTK+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + EKR+DEI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E S NMPW+KGW+V R+     E   +G +LL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGIL+PGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNVC DSKSDP ++A  F +QVII+NHPG+I AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERK-----EGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Match: EEF1A2 (eukaryotic translation elongation factor 1 alpha 2 [Source:HGNC Symbol;Acc:HGNC:3192])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 403/443 (90.97%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFETTK+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + EKR+DEI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E S NMPW+KGW+V R+     E   +G +LL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGIL+PGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNVC DSKSDP ++A  F +QVII+NHPG+I AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERK-----EGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVLVVA GTGEFEAGISKNGQTREHALLA TLGVKQ+IV  NKMDSTEPPF E RF EI  EVS ++KK+GY P +V FVPISG+NGDNM+E SSNMPW+KGW V R+     E   +GKTLL+ALD++ PP RPT++PLRLPLQDVYKIGGIGTVPVGRVETGI+KPGMVVTFAPQ +TTEVKSVEMHHE+L EA+PGDNVGFN+KNVSVK+IRRG+VCSDSK DPA++A  F AQVIIMNHPG+I  GY+PVLDCHTAHIACKF+EL +K+DRR+GK++ED PK  KSGDAG+V LIP+KP+CVE+F++Y PLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERK-----EGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVLVVA GTGEFEAGISKNGQTREHALLA TLGVKQ+IV  NKMDSTEPPF E RF EI  EVS ++KK+GY P +V FVPISG+NGDNM+E SSNMPW+KGW V R+     E   +GKTLL+ALD++ PP RPT++PLRLPLQDVYKIGGIGTVPVGRVETGI+KPGMVVTFAPQ +TTEVKSVEMHHE+L EA+PGDNVGFN+KNVSVK+IRRG+VCSDSK DPA++A  F AQVIIMNHPG+I  GY+PVLDCHTAHIACKF+EL +K+DRR+GK++ED PK  KSGDAG+V LIP+KP+CVE+F++Y PLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERK-----EGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVLVVA GTGEFEAGISKNGQTREHALLA TLGVKQ+IV  NKMDSTEPPF E RF EI  EVS ++KK+GY P +V FVPISG+NGDNM+E SSNMPW+KGW V R+     E   +GKTLL+ALD++ PP RPT++PLRLPLQDVYKIGGIGTVPVGRVETGI+KPGMVVTFAPQ +TTEVKSVEMHHE+L EA+PGDNVGFN+KNVSVK+IRRG+VCSDSK DPA++A  F AQVIIMNHPG+I  GY+PVLDCHTAHIACKF+EL +K+DRR+GK++ED PK  KSGDAG+V LIP+KP+CVE+F++Y PLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERK-----EGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Match: eef-1A.2 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVLVVA GTGEFEAGISKNGQTREHALLA TLGVKQ+IV  NKMDSTEPPF E RF EI  EVS ++KK+GY P +V FVPISG+NGDNM+E SSNMPW+KGW V R+     E   +GKTLL+ALD++ PP RPT++PLRLPLQDVYKIGGIGTVPVGRVETGI+KPGMVVTFAPQ +TTEVKSVEMHHE+L EA+PGDNVGFN+KNVSVK+IRRG+VCSDSK DPA++A  F AQVIIMNHPG+I  GY+PVLDCHTAHIACKF+EL +K+DRR+GK++ED PK  KSGDAG+V LIP+KP+CVE+F++Y PLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERK-----EGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Match: eef-1A.1 (Elongation factor 1-alpha [Source:UniProtKB/Swiss-Prot;Acc:P53013])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVLVVA GTGEFEAGISKNGQTREHALLA TLGVKQ+IV  NKMDSTEPPF E RF EI  EVS ++KK+GY P +V FVPISG+NGDNM+E SSNMPW+KGW V R+     E   +GKTLL+ALD++ PP RPT++PLRLPLQDVYKIGGIGTVPVGRVETGI+KPGMVVTFAPQ +TTEVKSVEMHHE+L EA+PGDNVGFN+KNVSVK+IRRG+VCSDSK DPA++A  F AQVIIMNHPG+I  GY+PVLDCHTAHIACKF+EL +K+DRR+GK++ED PK  KSGDAG+V LIP+KP+CVE+F++Y PLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLGVKQLIVACNKMDSTEPPFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSSNMPWFKGWAVERK-----EGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELKEKVDRRTGKKVEDFPKFLKSGDAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085835)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 355/443 (80.14%), Postives = 395/443 (89.16%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAGTGEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ E R++EIKKEVSSY+KK+GY P SVAFVPISGW+GDNM+E S  MPW+KGW V R+  K E     GK L+DALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVV FAP  L TEVKSVEMHHEALTEA+PGDNVGFN+KNVSVKE+RRG V  DSK++P R A DF AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE+ +K DRR+GK  E  PK  KSGDA ++ L+PSKP+CVE+F E+PPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE-----GKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085834)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 355/443 (80.14%), Postives = 395/443 (89.16%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAGTGEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ E R++EIKKEVSSY+KK+GY P SVAFVPISGW+GDNM+E S  MPW+KGW V R+  K E     GK L+DALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVV FAP  L TEVKSVEMHHEALTEA+PGDNVGFN+KNVSVKE+RRG V  DSK++P R A DF AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE+ +K DRR+GK  E  PK  KSGDA ++ L+PSKP+CVE+F E+PPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE-----GKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085832)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 355/443 (80.14%), Postives = 395/443 (89.16%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAGTGEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ E R++EIKKEVSSY+KK+GY P SVAFVPISGW+GDNM+E S  MPW+KGW V R+  K E     GK L+DALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVV FAP  L TEVKSVEMHHEALTEA+PGDNVGFN+KNVSVKE+RRG V  DSK++P R A DF AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE+ +K DRR+GK  E  PK  KSGDA ++ L+PSKP+CVE+F E+PPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE-----GKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Match: eEF1alpha2 (gene:FBgn0000557 transcript:FBtr0085833)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 355/443 (80.14%), Postives = 395/443 (89.16%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAGTGEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ E R++EIKKEVSSY+KK+GY P SVAFVPISGW+GDNM+E S  MPW+KGW V R+  K E     GK L+DALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVV FAP  L TEVKSVEMHHEALTEA+PGDNVGFN+KNVSVKE+RRG V  DSK++P R A DF AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE+ +K DRR+GK  E  PK  KSGDA ++ L+PSKP+CVE+F E+PPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHGDNMLEPSEKMPWFKGWSVERKEGKAE-----GKCLIDALDAILPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELRRGYVAGDSKNNPPRGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFSEIKEKCDRRTGKTTETEPKAIKSGDAAIIVLVPSKPLCVESFQEFPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Match: eEF1alpha1 (gene:FBgn0284245 transcript:FBtr0088035)

HSP 1 Score: 736.487 bits (1900), Expect = 0.000e+0
Identity = 353/443 (79.68%), Postives = 398/443 (89.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAGTGEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDS+EPP+ E R++EIKKEVSSY+KK+GY P +VAFVPISGW+GDNM+E S+NMPW+KGW+V R+     E    GKTL+DALDA+ PPARPT+K LRLPLQDVYKIGGIGTVPVGRVETG+LKPG VV FAP  +TTEVKSVEMHHEAL EA+PGDNVGFN+KNVSVKE+RRG V  DSK++P + A DF AQVI++NHPG+I  GY+PVLDCHTAHIACKF+E+ +K+DRRSGK  E+NPK  KSGDA +V L+PSKP+CVE F E+PPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERK-----EGNADGKTLIDALDAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVVFAPANITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVKELRRGYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYTPVLDCHTAHIACKFAEIKEKVDRRSGKTTEENPKFIKSGDAAIVNLVPSKPLCVEAFQEFPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Match: eef1a1a (eukaryotic translation elongation factor 1 alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-8278])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 361/443 (81.49%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++TR+     E    G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A +F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRK-----EGNAAGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Match: eef1a1a (eukaryotic translation elongation factor 1 alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-8278])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 361/443 (81.49%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++TR+     E    G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A +F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPSYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMSWFKGWKITRK-----EGNAAGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGLLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Match: eef1a1b (eukaryotic translation elongation factor 1 alpha 1b [Source:ZFIN;Acc:ZDB-GENE-050417-327])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 360/443 (81.26%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++TR++        +G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPG+VVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS-----SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Match: eef1a1l2 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 360/443 (81.26%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++TR++        +G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPG+VVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS-----SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Match: eef1a1l2 (eukaryotic translation elongation factor 1 alpha 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-050706-188])

HSP 1 Score: 755.362 bits (1949), Expect = 0.000e+0
Identity = 360/443 (81.26%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++TR++        +G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPG+VVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEASPNMTWFKGWKITRKDGSS-----SGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAASFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Match: eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:NCBI gene;Acc:496898])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 360/443 (81.26%), Postives = 402/443 (90.74%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET K+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NKMDSTEPP+ EKR+DEI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E S NMPW+KGW+V R+     E    G +LL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNVC DSKSDP ++A  F +QVII+NHPG+I AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETNKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERK-----EGNANGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAGFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Match: eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:NCBI gene;Acc:549446])

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 407/443 (91.87%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+++R+     E   +G TLL+ALD + PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EA+PGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRK-----EGSGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEAMPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGTFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-1008434])

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 358/443 (80.81%), Postives = 406/443 (91.65%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLA TLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+++R+     E   +G TLL+ALD + PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EA+PGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA-TLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRK-----EGSGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEAMPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGTFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 437          
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Match: anp32b (acidic nuclear phosphoprotein 32 family member B [Source:Xenbase;Acc:XB-GENE-988727])

HSP 1 Score: 744.191 bits (1920), Expect = 0.000e+0
Identity = 356/443 (80.36%), Postives = 399/443 (90.07%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET KFY+T+IDAPGHRDFIKNMITGTSQAD AVL+VA G GEFEAGISKNGQTREHALLA+TLGVKQ+I+GVNKMDSTEPPF +KRF+EI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E S+NMPW+KGW++ R+     E   +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL EALPGDNVGFN+KN+SVK+IRRGNV  DSK+DP  QA  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED+PK  KSGDA +V +IP KPMCVETFS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETGKFYITIIDAPGHRDFIKNMITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIIGVNKMDSTEPPFSQKRFEEITKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEASTNMPWFKGWKIERK-----EGNASGVTLLEALDCIIPPQRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPSNVTTEVKSVEMHHEALQEALPGDNVGFNVKNISVKDIRRGNVAGDSKNDPPMQAGTFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKQKIDRRSGKKLEDDPKFLKSGDAAIVEMIPGKPMCVETFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Match: eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:NCBI gene;Acc:549446])

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 336/428 (78.50%), Postives = 384/428 (89.72%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGR 1356
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+++R+     E   +G TLL+ALD + PP+RPT+KPLRLPLQDVYKIGGIGTVPV   +     PGMVVTFAP  +TTEVKSVEMHHEAL+EA+PGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FS+YPPLG+
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKISRK-----EGSGSGTTLLEALDCILPPSRPTDKPLRLPLQDVYKIGGIGTVPVSCGDW--CPPGMVVTFAPVNVTTEVKSVEMHHEALSEAMPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGTFTAQVIILNHPGQIGAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGK 421          
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Match: Eef1a2 (eukaryotic translation elongation factor 1 alpha 2 [Source:MGI Symbol;Acc:MGI:1096317])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 358/443 (80.81%), Postives = 403/443 (90.97%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFETTK+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + EKR+DEI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E S NMPW+KGW+V R+     E   +G +LL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGIL+PGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNVC DSK+DP ++A  F +QVII+NHPG+I AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETTKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPAYSEKRYDEIVKEVSAYIKKIGYNPATVPFVPISGWHGDNMLEPSPNMPWFKGWKVERK-----EGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKADPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 427.943 bits (1099), Expect = 1.100e-148
Identity = 207/254 (81.50%), Postives = 233/254 (91.73%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLP 834
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLP
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----SASGTTLLEALDCILPPTRPTDKPLRLP 249          
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Match: Eef1a1 (eukaryotic translation elongation factor 1 alpha 1 [Source:MGI Symbol;Acc:MGI:1096881])

HSP 1 Score: 346.665 bits (888), Expect = 8.126e-118
Identity = 163/186 (87.63%), Postives = 178/186 (95.70%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPD 630
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPD 186          
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Match: Hbs1l (Hbs1-like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1891704])

HSP 1 Score: 308.916 bits (790), Expect = 1.372e-96
Identity = 171/442 (38.69%), Postives = 257/442 (58.14%), Query Frame = 1
Query:   85 KTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMI--EESSNM-PWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            K  +N+VVIGHVD+GKST  GH++Y  G ++KRT+ K+E+E+++ GK SF YAWVLD+   ERERG+T+D+ + KFETT   +T++DAPGH+DFI NMITG +QAD AVLVV A  GEFEAG    GQTREH LL  +LGV Q+ V VNKMD     + ++RF EI  ++  +LK+ G++   VAF+P SG +G+N+    +SS++  WYKG  +  +                 +D+ +PP R  +KP RL + DV+K  G G    G++E G ++ G  +   P   T   K + +H E +  A  GD+V   +  + + +I  G +    K +P +  T F A++++ N    I  G+  +L   T         L+  +++ +G+  +  PK    G   LV L   +P+ +E + ++  LGRF +R    TVA GV+
Sbjct:  253 KQLLNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITGAAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVN--WQQERFQEITGKLGHFLKQAGFKESDVAFIPTSGLSGENLTARSQSSDLTTWYKGMCLLEQ-----------------IDSFKPPQRSIDKPFRLCVSDVFKDQGSGFCVTGKIEAGYIQTGDRLLAMPPNETCTAKGITLHDEPVDWAAAGDHVNLTLVGMDIIKINVGCIFCGPK-EPIKACTRFRARILVFNIEVPITKGFPVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKLLTKGQNALVELQTQRPVALELYKDFKELGRFMLRYGGSTVAAGVV 674          
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q90835|EF1A_CHICK (Elongation factor 1-alpha 1 OS=Gallus gallus OX=9031 GN=EEF1A PE=2 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 361/443 (81.49%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E SSNMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSSNMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMIPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Match: sp|P62630|EF1A1_RAT (Elongation factor 1-alpha 1 OS=Rattus norvegicus OX=10116 GN=Eef1a1 PE=2 SV=1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----SASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Match: sp|P68105|EF1A1_RABIT (Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus OX=9986 GN=EEF1A1 PE=1 SV=1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q5R4R8|EF1A1_PONAB (Elongation factor 1-alpha 1 OS=Pongo abelii OX=9601 GN=EEF1A1 PE=2 SV=2)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Match: sp|Q5R1X2|EF1A1_PANTR (Elongation factor 1-alpha 1 OS=Pan troglodytes OX=9598 GN=EEF1A1 PE=2 SV=1)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEPP+ +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S+NMPW+KGW+VTR++        +G TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LED PK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDG-----NASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. TrEMBL
Match: A0A1S6KMF9 (Elongation factor 1-alpha OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 443          
BLAST of Elongation factor 1-alpha vs. TrEMBL
Match: Q23959 (Elongation factor 1-alpha (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 783.482 bits (2022), Expect = 0.000e+0
Identity = 382/407 (93.86%), Postives = 397/407 (97.54%), Query Frame = 1
Query:  130 KSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPL 1350
            KSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLD+LKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQAD AVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPF E RFDEIKKEVS YLKKVGYQPD+VAFVPISGWNGDNMI+ESSNMPWYKGWE+TR+NAKKEE K TG+TLLDALD+LEPP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAP+  TTEVKSVEMHHEALTEALPGDNVGFN+KNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKF+EL++KIDRRSGK+LED PKQFKSGDAGLVRL+PSKPMCVETFSEYPPL
Sbjct:    1 KSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDQLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADCAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFSEPRFDEIKKEVSGYLKKVGYQPDAVAFVPISGWNGDNMIDESSNMPWYKGWEITRKNAKKEEIKTTGRTLLDALDSLEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPKVFTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFAELVEKIDRRSGKDLEDFPKQFKSGDAGLVRLVPSKPMCVETFSEYPPL 407          
BLAST of Elongation factor 1-alpha vs. TrEMBL
Match: E1XUM3 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=efa1a PE=2 SV=1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 369/443 (83.30%), Postives = 409/443 (92.33%), Query Frame = 1
Query:   76 PSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRR-NAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            PS K H+NIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEK+EKEAQE+GKGSFKYAWVLDKLKAERERGITIDIALWKFET K+YVTVIDAPGHRDFIKNMITGTSQAD AVL++AAG GEFEAGISKNGQTREHALLAYTLGVKQMI+GVNKMDSTEPP+ E R++EIKKEVS+Y+KKVGY PD+VAFVPISGW+GDNMIEES+NM W+KGW + R+   KKEET   GKTL++ALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQ L+TEVKSVEMHHE L EA+PGDNVGFN+KNVSVK+IRRGNVC DSK+DP ++  DFVAQVI++NHPG+I  GY+PVLDCHTAHIACKFSE +KKIDRRSGKELED+PK  KSGDA +++LIPSK MCVE F++YPPLGRFAVRDMKQTVAVGVI
Sbjct:    3 PSPKIHVNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQILSTEVKSVEMHHEQLAEAVPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPKETGDFVAQVIVLNHPGQIQPGYAPVLDCHTAHIACKFSEFLKKIDRRSGKELEDSPKILKSGDAAMIKLIPSKAMCVEPFAQYPPLGRFAVRDMKQTVAVGVI 445          
BLAST of Elongation factor 1-alpha vs. TrEMBL
Match: A0A267F9J4 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017901g1 PE=3 SV=1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 368/443 (83.07%), Postives = 409/443 (92.33%), Query Frame = 1
Query:   76 PSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRR-NAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            PS K H+NIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEK+EKEAQE+GKGSFKYAWVLDKLKAERERGITIDIALWKFET K+YVTVIDAPGHRDFIKNMITGTSQAD AVL++AAG GEFEAGISKNGQTREHALLAYTLGVKQMI+GVNKMDSTEPP+ E R++EIKKEVS+Y+KKVGY PD+VAFVPISGW+GDNMIEES+NM W+KGW + R+   KKEET   GKTL++ALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQ L+TEVKSVEMHHE L EA+PGDNVGFN+KNVSVK+IRRGNVC DSK+DP ++  DF+AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE +KKIDRRSGKELED+PK  KSGDA +++LIPSK MCVE F++YPPLGRFAVRDMKQTVAVGVI
Sbjct:    3 PSPKIHVNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQILSTEVKSVEMHHEQLAEAVPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPKETGDFIAQVIVLNHPGQIQPGYAPVLDCHTAHIACKFSEFLKKIDRRSGKELEDSPKILKSGDAAMIKLIPSKAMCVEPFAQYPPLGRFAVRDMKQTVAVGVI 445          
BLAST of Elongation factor 1-alpha vs. TrEMBL
Match: A0A267FSI2 (Elongation factor 1-alpha OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017901g2 PE=3 SV=1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 368/443 (83.07%), Postives = 409/443 (92.33%), Query Frame = 1
Query:   76 PSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRR-NAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            PS K H+NIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEK+EKEAQE+GKGSFKYAWVLDKLKAERERGITIDIALWKFET K+YVTVIDAPGHRDFIKNMITGTSQAD AVL++AAG GEFEAGISKNGQTREHALLAYTLGVKQMI+GVNKMDSTEPP+ E R++EIKKEVS+Y+KKVGY PD+VAFVPISGW+GDNMIEES+NM W+KGW + R+   KKEET   GKTL++ALDA+ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQ L+TEVKSVEMHHE L EA+PGDNVGFN+KNVSVK+IRRGNVC DSK+DP ++  DF+AQVI++NHPG+I  GY+PVLDCHTAHIACKFSE +KKIDRRSGKELED+PK  KSGDA +++LIPSK MCVE F++YPPLGRFAVRDMKQTVAVGVI
Sbjct:    3 PSPKIHVNIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKYEKEAQELGKGSFKYAWVLDKLKAERERGITIDIALWKFETEKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIIGVNKMDSTEPPYSEARYNEIKKEVSAYIKKVGYNPDAVAFVPISGWHGDNMIEESNNMSWFKGWSIKRKLPGKKEETTTEGKTLIEALDAIIPPERPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQILSTEVKSVEMHHEQLAEAVPGDNVGFNVKNVSVKDIRRGNVCGDSKNDPPKETGDFIAQVIVLNHPGQIQPGYAPVLDCHTAHIACKFSEFLKKIDRRSGKELEDSPKILKSGDAAMIKLIPSKAMCVEPFAQYPPLGRFAVRDMKQTVAVGVI 445          
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Match: EEF1A1 (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:103021740])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 361/443 (81.49%), Postives = 406/443 (91.65%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NKMDSTEP + +KR++EI KEVS+Y+KK+GY P++VAFVPISGWNGDNM+E S NM W+KGW++TR+     E  V+G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPETVAFVPISGWNGDNMLEASPNMTWFKGWKITRK-----EGNVSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAAVFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Match: eef1a2 (elongation factor 1-alpha 2 [Source:NCBI gene;Acc:103045590])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 358/443 (80.81%), Postives = 404/443 (91.20%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IV VNKMDSTEPP+ EKR+DEI KEVS+Y+KK+GY P +V FVPISGW+GDNM+E SSNMPW+KGW++ R+     E   TG TLL+ALD + PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+L+PGMVVTFAP  +TTEVKSVEMHHE+LTEALPGDNVGFN+KNVSVK+IRRGNVC DS+SDP ++A+ F AQVII+NHPG+I AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVAVNKMDSTEPPYSEKRYDEIVKEVSAYIKKIGYSPAAVPFVPISGWHGDNMLESSSNMPWFKGWKLDRK-----ELHATGVTLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLRPGMVVTFAPVNITTEVKSVEMHHESLTEALPGDNVGFNVKNVSVKDIRRGNVCGDSRSDPPQEASGFTAQVIILNHPGQICAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIVDMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Match: eef1a1l2 (elongation factor 1-alpha 1-like [Source:NCBI gene;Acc:103029695])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 405/443 (91.42%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVGVNKMDSTEP + +KR++EI KEVS+Y+KK+GY P++VAFVPISGWNGDNM+E S NM W+KGW++ R++       V+G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPG+VVTFAP  +TTEVKSVEMHHEAL+EALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A  F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPNYSQKRYEEIVKEVSTYIKKIGYNPETVAFVPISGWNGDNMLEASPNMTWFKGWKINRKDG-----SVSGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGLVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAATFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Match: ENSAMXT00000043242.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 357/443 (80.59%), Postives = 403/443 (90.97%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ +KRF+EI KEVS+Y+KK+GY P +VAFVPISGW+GDNM+E SSNM W+KGW++ R+     E   +G TLL+ALD++ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHE+L EALPGDNVGFN+KNVSVKEIRRGNV  DSK+DP  +A +F AQVII+NHPG+I  GY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA ++ +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQKRFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERK-----EGGSSGTTLLEALDSILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVAVTTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPMEAGNFTAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIITMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Match: ENSAMXT00000040958.1 (elongation factor 1-alpha [Source:NCBI gene;Acc:103044018])

HSP 1 Score: 748.429 bits (1931), Expect = 0.000e+0
Identity = 356/443 (80.36%), Postives = 403/443 (90.97%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+Y+T+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ +KRF+EI KEVS+Y+KK+GY P +VAFVPISGW+GDNM+E SSNM W+KGW++ R+     E   +G TLL+ALD++ PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHE+L EALPGDNVGFN+KNVSVKEIRRGNV  DSK+DP  +A +F AQVII+NHPG+I  GY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA ++ +IP KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYITIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQKRFEEITKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEPSSNMGWFKGWKIERK-----EGGSSGTTLLEALDSILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVAVTTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPMEAGNFTAQVIILNHPGQISQGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKNLKSGDAAIITMIPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011427.1 (pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene:ENSPMAG00000010399.1 transcript:ENSPMAT00000011427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 354/443 (79.91%), Postives = 402/443 (90.74%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +KTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQ+IVG+NKMDSTEPP+   R++EI KEV +Y+KK+GY P +V FVPISGW+GDNM+E S+NMPW+KGW+V R++        +G TLL+ALDA+ PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEALTEA+PGDNVGFN+KNVSVK++RRGNV  DSK+DP  +A  F AQVI++NHPG+I+AGYSPV+DCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETQKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIVGINKMDSTEPPYSSDRYNEIVKEVGTYIKKIGYNPAAVGFVPISGWHGDNMLEASTNMPWFKGWKVERKDG-----NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEAVPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAGVFTAQVIVLNHPGQINAGYSPVVDCHTAHIACKFAELKEKIDRRSGKKLEDNPKFLKSGDAAMVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Match: hbs1l (HBS1-like translational GTPase [Source:ZFIN;Acc:ZDB-GENE-030131-2987])

HSP 1 Score: 318.546 bits (815), Expect = 4.399e-101
Identity = 173/442 (39.14%), Postives = 261/442 (59.05%), Query Frame = 1
Query:   85 KTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSN---MPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            K  IN+VVIGHVD+GKST  GHL+Y  G ++KR + K+E+E+++ GK SF YAWVLD+   ERERG+T+D+ L KFE+    VT++DAPGH+DFI NMITG +QAD A+LVV + TGEFEAG    GQTREHALL  +LGV Q+ V +NKMD     + ++RF+EI  ++  +LK+ G++   V ++P SG +G+N+   S +     WY                 +G  LLD +D+  PP RP +KP RL + DV+K  G G    G+VE G ++ G  +   P      VK + +H E +  A  GD+V  N+  + + ++  G+V  D K +P R +T   A+++I N    I  G+  +L   T        +L+  + + +G+ ++  P+  + G   +V L   +P+C+E + ++  LGRF +R    T+A GV+
Sbjct:  258 KQLINLVVIGHVDAGKSTLMGHLLYLLGNVNKRAMHKYEQESKKAGKASFAYAWVLDETGEERERGVTMDVGLTKFESKTKLVTLMDAPGHKDFIPNMITGAAQADVALLVVDSITGEFEAGFEAGGQTREHALLVRSLGVTQLAVAINKMDMLN--WSKERFEEITSKLGQFLKQAGFKESDVTYIPTSGLSGENLAMRSKDEKLTSWY-----------------SGPCLLDCIDSFRPPQRPVDKPCRLCVSDVFKDVGAGFSVAGKVEAGYVQTGDRLVVMPANEMCTVKGITLHDEPMDWAAAGDHVTLNVTGMDMIKVGVGSVVCDPK-EPIRASTRVRARILIFNIDLPITRGFPVLLHYQTVSEPAVIKKLISVLHKSTGEVVKTKPRCLQKGQNAMVELQMQRPVCLERYKDFRELGRFMLRYSGSTIAAGVV 679          
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Match: eefsec (eukaryotic elongation factor, selenocysteine-tRNA-specific [Source:ZFIN;Acc:ZDB-GENE-051120-72])

HSP 1 Score: 66.6254 bits (161), Expect = 7.085e-12
Identity = 69/289 (23.88%), Postives = 111/289 (38.41%), Query Frame = 1
Query:  250 LDKLKAERERGITIDIALWKFET---------------TKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTRE-HALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCS 1068
             DK    RERGIT+D+    F                     VT++D PGH   I+ +I G    D  +LV+          ++K  QT+    LL   +   +M+V +NK D           +++ K++   L+   ++      + ++   G     E+                 +E   + G   L       P   P   PL + +   + I G GTV  G V +G +     V      +T +VKS++M  + +T A  GD VG  +     K + RG VCS
Sbjct:   36 FDKNPQSRERGITLDLGFSAFGAPLPAHLRDDPRAGGYEALQVTLVDCPGHASLIRTIIGGAQIIDLMMLVI---------DVTKGMQTQSAECLLIGEITCPRMMVVLNKTDMLPEAKRATLIEKMTKKMHKTLENTRFK--GAPIISVAAKPGGPDAPEA-----------------QEAEGIAGLIELLLSQTYLPQRDPAG-PLLMAVDHCFCIRGQGTVMTGTVLSGSVSVNDTVEIPALKVTKKVKSMQMFRKPVTSAAQGDRVGLCVTQFDPKLLERGLVCS 295          
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Match: gtpbp1 (GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030909-12])

HSP 1 Score: 51.2174 bits (121), Expect = 2.935e-7
Identity = 33/125 (26.40%), Postives = 57/125 (45.60%), Query Frame = 1
Query:  817 KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGL----TTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQAT-DFVAQVIIMNHPGEIHAGYSPVLDC 1176
            +P    + D Y + G+GTV  G V  G+++    +   P  L       VKS+      + E   G    F +K +    IR+G V    + +P  QA  +F A++++++HP  I   Y  ++ C
Sbjct:   74 EPAEFQIDDTYSVPGVGTVVSGTVLRGLIRLNDTLLLGPDPLGAFTAIAVKSIHRKRMPVREVRGGQTASFALKKIKRAWIRKGMVMVSPRVNP--QAYWEFEAEILVLHHPTTISPRYQAMVHC 196          
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001336.1 (pep scaffold:Pmarinus_7.0:GL476352:246829:320669:1 gene:ENSPMAG00000001142.1 transcript:ENSPMAT00000001336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 4.784e-7
Identity = 45/139 (32.37%), Postives = 61/139 (43.88%), Query Frame = 1
Query:   70 AMPSDKTHI-NIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITI--------------DIALWKF--ETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTG 435
            A+   K++I N+ VI HVD GKST T  L+ K G I               G+  F      D  K E+ER ITI              D+A  K   +   F + +ID+PGH DF   +       DGA++VV   +G
Sbjct:   11 AIMDKKSNIRNMSVIAHVDHGKSTLTDSLVCKAGII----------AGSRAGETRFT-----DTRKDEQERCITIKSTAISLYYELQETDLAFIKQCKDGNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 134          
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Match: TEF1 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; may also have a role in tRNA re-export from the nucleus; TEF1 has a paralog, TEF2, that arose from the whole genome duplication [Source:SGD;Acc:S000006284])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 344/446 (77.13%), Postives = 391/446 (87.67%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETK---VTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K+HIN+VVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAERERGITIDIALWKFET K+ VTVIDAPGHRDFIKNMITGTSQAD A+L++A G GEFEAGISK+GQTREHALLA+TLGV+Q+IV VNKMDS +  + E RF EI KE S+++KKVGY P +V FVPISGWNGDNMIE ++N PWYKGWE        +ETK   V GKTLL+A+DA+E P+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFAP G+TTEVKSVEMHHE L + +PGDNVGFN+KNVSVKEIRRGNVC D+K+DP +    F A VI++NHPG+I AGYSPVLDCHTAHIAC+F EL++K DRRSGK+LED+PK  KSGDA LV+ +PSKPMCVE FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWE--------KETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVI 436          
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Match: TEF2 (Translational elongation factor EF-1 alpha; in the GTP-bound active form, binds to and delivers aminoacylated tRNA to the A-site of ribosomes for elongation of nascent polypeptides; associates with vacuolar Rho1p GTPase; TEF2-RFP levels increase during replicative aging; may also have a role in tRNA re-export from the nucleus; TEF2 has a paralog, TEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000000322])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 344/446 (77.13%), Postives = 391/446 (87.67%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETK---VTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K+HIN+VVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA E+GKGSFKYAWVLDKLKAERERGITIDIALWKFET K+ VTVIDAPGHRDFIKNMITGTSQAD A+L++A G GEFEAGISK+GQTREHALLA+TLGV+Q+IV VNKMDS +  + E RF EI KE S+++KKVGY P +V FVPISGWNGDNMIE ++N PWYKGWE        +ETK   V GKTLL+A+DA+E P+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTFAP G+TTEVKSVEMHHE L + +PGDNVGFN+KNVSVKEIRRGNVC D+K+DP +    F A VI++NHPG+I AGYSPVLDCHTAHIAC+F EL++K DRRSGK+LED+PK  KSGDA LV+ +PSKPMCVE FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVK--WDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWE--------KETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVI 436          
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Match: SUP35 (Translation termination factor eRF3; has a role in mRNA deadenylation and decay; altered protein conformation creates the [PSI(+)] prion that modifies cellular fitness, alters translational fidelity by affecting reading frame selection, and results in a nonsense suppressor phenotype; many stress-response genes are repressed in the presence of [PSI(+)] [Source:SGD;Acc:S000002579])

HSP 1 Score: 270.011 bits (689), Expect = 8.903e-83
Identity = 167/443 (37.70%), Postives = 256/443 (57.79%), Query Frame = 1
Query:   85 KTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDS-VAFVPISGWNGDNMIE--ESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTE-ALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            K H++++ +GHVD+GKST  G+L+Y  G +DKRTIEK+E+EA++ G+  +  +WV+D  K ER  G TI++    FET K   T++DAPGH+ ++  MI G SQAD  VLV++A  GE+E G  + GQTREHALLA T GV +M+V VNKMD     + ++R+D+    VS++L+ +GY   + V F+P+SG++G N+ +  +    PWY                 TG TLL+ LD +    R  N P  LP+    K+  +GT+  G++E+G +K G      P     E++++    E   + A+ G+ V   IK V  ++I  G V +  K +P +  T FVAQ+ I+     I AG+S V+  HTA       +L+ K+++ + ++ +  P   K G   +  L    P+CVET+ +YP LGRF +RD   T+A+G I
Sbjct:  258 KDHVSLIFMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGVLVISARKGEYETGFERGGQTREHALLAKTQGVNKMVVVVNKMDDPTVNWSKERYDQCVSNVSNFLRAIGYNIKTDVVFMPVSGYSGANLKDHVDPKECPWY-----------------TGPTLLEYLDTMNHVDRHINAPFMLPI--AAKMKDLGTIVEGKIESGHIKKGQSTLLMPNKTAVEIQNIYNETENEVDMAMCGEQVKLRIKGVEEEDISPGFVLTSPK-NPIKSVTKFVAQIAIVELKSIIAAGFSCVMHVHTAIEEVHIVKLLHKLEKGTNRKSKKPPAFAKKGMKVIAVLETEAPVCVETYQDYPQLGRFTLRDQGTTIAIGKI 680          
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Match: HBS1 (GTPase with similarity to translation release factors; together with binding partner Dom34p, facilitates ribosomal subunit dissociation and peptidyl-tRNA release when translation is stalled, particularly in 3' UTRs; genetically implicated in mRNA no-go decay; HBS1 has a paralog, SKI7, that arose from the whole genome duplication [Source:SGD;Acc:S000001792])

HSP 1 Score: 218.009 bits (554), Expect = 6.653e-64
Identity = 146/475 (30.74%), Postives = 241/475 (50.74%), Query Frame = 1
Query:   40 PQIFN*F*NSAMPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNM--IEESSNM-PWYKGWEV--TRRNA----KKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEM--------HHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDR---RSGKELED-NPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            P   + F  SA+P    H++ VV+GHVD+GKST  G L+Y    +++  + K ++E++ MGK SFK+AW++D+   ERERG+T+ I    F T +   T++DAPGHRDF+ N I G SQAD A+L V   T  FE+G   +GQT+EH LLA +LG+  +I+ +NKMD+ +  + ++RF+EIK ++  YL  +G+  D++ +VPISG++G+ +  IE +  +  WY G  +  T  NA     KE   +              P++ T+  L L                G++E+G ++PG  +T  P   +  V  +++        +HE    A+ GD V   ++    ++I+ G++ +         A  FV ++   +    +  G   +L         +   L+  ID+    S K++     KQ    +  L+ +    P+   T  E   LGR  +R   +T+A G I
Sbjct:  154 PHDISAFVKSALP----HLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLASSLGIHNLIIAMNKMDNVD--WSQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKIEYTDEVRQWYNGPNLMSTLENAAFKISKENEGINKDDPFLFSVLEIIPSKKTSNDLAL--------------VSGKLESGSIQPGESLTIYPSEQSCIVDKIQVGSQQGQSTNHEETDVAIKGDFVTLKLRKAYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKRLISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLL--TAHENDRLGRVVLRKDGRTIAAGKI 606          
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Match: TUF1 (Mitochondrial translation elongation factor Tu (EF-Tu); involved in fundamental pathway of mtDNA homeostasis; comprises both GTPase and guanine nucleotide exchange factor activities, while these activities are found in separate proteins in S. pombe and humans; rare mutations in human mitochondrial elongation factor Tu (EFTu) associated with severe lactic acidosis, rapidly progressive fatal encephalopathy, severe infantile macrocystic leukodystrophy with micropolygyria [Source:SGD;Acc:S000005713])

HSP 1 Score: 175.637 bits (444), Expect = 1.145e-49
Identity = 142/457 (31.07%), Postives = 210/457 (45.95%), Query Frame = 1
Query:   67 SAMPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEET--KVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPG---MVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMN-HPGEIHAG----YSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVR--LIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            +A    K H+NI  IGHVD GK+T T  +                K     G  +F     +DK   ER RGITI  A  ++ET K + + +D PGH D+IKNMITG +Q DGA++VVAA  G+         QTREH LLA  +GV+ ++V VNK+D+ + P   +  + ++ E+   L + G+  D                    N P   G  +     ++ E   +   K L    + +  P R  NKP  +P++D++ I G GTV  GRVE G LK G    +V      L T V  +EM  + L  A+ GDN G  ++ +   +++RG V   +K    +  T  +A + I++   G  H+G    Y P +   TA +             R  KE+ED+  Q   GD   +   LI   P+ V          RF +R+  +TV  G+I
Sbjct:   40 AAFDRSKPHVNIGTIGHVDHGKTTLTAAIT---------------KTLAAKGGANFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMP-------QTREHLLLARQVGVQHIVVFVNKVDTIDDP---EMLELVEMEMRELLNEYGFDGD--------------------NAPIIMGSALCALEGRQPEIGEQAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEELEIVGHNSTPLKTTVTGIEMFRKELDSAMAGDNAGVLLRGIRRDQLKRGMVL--AKPGTVKAHTKILASLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVM---------RFPKEVEDHSMQVMPGDNVEMECDLIHPTPLEVGQ--------RFNIREGGRTVGTGLI 432          
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Match: EF1ALPHA (Elongation factor 1-alpha [Source:UniProtKB/TrEMBL;Acc:A7SSW8])

HSP 1 Score: 731.48 bits (1887), Expect = 0.000e+0
Identity = 347/444 (78.15%), Postives = 397/444 (89.41%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRN-AKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            MP +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKE+ EMGKGSFKYAWVLDKLKAERERGITIDIALWKFET K+YVTVIDAPGHRDFIKNMITGTSQAD AVL++A+GTGEFEAGISKNGQTREHALLAYTLGVKQM+V  NKMDSTEPP+ E RF EI+KEV+++LKKVG+ P +V F+PISG++GDNM+E+S NMPW+K W + R + A K+E   +G TL + LD++ PP+RP+  PLRLPLQDVYKIGGIGTVPVGRVETG+LKPG VVTF+P  +TTEVKSVEMHHE+L EALPGDNVGFN+KNVSVK+I+RGNV  D K++P +    F AQVI+MNHPGEIHAGYSPVLDCHTAHIACKF +L++KIDRRSGK+LEDNPK  K+GDA +V +IPSKPMCVETF+E+PPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MPKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKESSEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETLKYYVTVIDAPGHRDFIKNMITGTSQADCAVLIIASGTGEFEAGISKNGQTREHALLAYTLGVKQMLVCANKMDSTEPPYSEARFKEIQKEVANFLKKVGFNPKAVPFIPISGFHGDNMLEKSENMPWFKQWTIERVDPATKKEANASGVTLFEGLDSILPPSRPSGLPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVTFSPSNITTEVKSVEMHHESLAEALPGDNVGFNVKNVSVKDIKRGNVAGDFKNNPPKPCKSFTAQVIVMNHPGEIHAGYSPVLDCHTAHIACKFDKLLEKIDRRSGKKLEDNPKMIKTGDAAMVEMIPSKPMCVETFTEFPPLGRFAVRDMKQTVAVGVI 444          
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Match: EDO48034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR5])

HSP 1 Score: 309.301 bits (791), Expect = 5.851e-100
Identity = 166/438 (37.90%), Postives = 257/438 (58.68%), Query Frame = 1
Query:   91 HINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDS-VAFVPISGWNGDNMIE--ESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVG 1395
            H+NI+ IGHVD+GKST  GH++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + ER++G T+++    F+T   + T++DAPGH+ F+ NMI+G +QAD  VLV++A  GEFE G  + GQTREHA+LA T GVK +++ VNKMD     ++E+R++EIK +++ +LKKVG+ P + + ++P SG  G N+ E  +    PWY                 +GK  L  +D L    R  + P+RLP+ D Y+   +GT+ +G+VE+G +  G  +   P  +  E+ +V    E +T A  GDNV   +K V  +++  G V   S  +       F AQV+I+ H   I AGYS VL  H       F  L+  ID+++GK+ +  P+  K     + RL     +C+E FS++  +GRF +RD   T+A+G
Sbjct:   29 HVNIIFIGHVDAGKSTIGGHVMYLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAFDTDTKHFTLLDAPGHKSFVPNMISGAAQADLGVLVISARKGEFETGFERGGQTREHAMLAKTAGVKHLVILVNKMDDPTVKWNEERYEEIKVKLTPFLKKVGFNPKTDIMYMPCSGLTGANLKEPLDPQVCPWY-----------------SGKPFLKYIDQLPSLTRSVDGPVRLPIADKYR--DMGTIVLGKVESGTINKGQTLVLMPNKVNVELTTVIYDEEEMTSARAGDNVKLRLKGVEEEDVSPGFVLC-SPHNLCHTVRTFDAQVVILEHKSIICAGYSAVLHIHNVVEEVSFLTLIALIDKKTGKKGQTRPRFIKQDQIAIARLETQGVICIEKFSDFQQMGRFTLRDEGHTIAIG 446          
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Match: EDO47521 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM15])

HSP 1 Score: 283.108 bits (723), Expect = 1.219e-89
Identity = 162/455 (35.60%), Postives = 246/455 (54.07%), Query Frame = 1
Query:   85 KTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFE-------------KEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIE---ESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            K  +N+V+IGHVD+GKST  GHL++  G + K+ + K+               E+++ GK SF YAWVLD+   ERERGIT+D+ L +F+T    +T++DAPGH+DFI NMITG +QAD A+LVV A TGEFEAG    GQTREHA+L  +LGV Q+IV +NK+D     + E+R+  I  ++  +LK+VG++   V +VP+SG +G+N+++   E     WY+G  +  R                 +D  + P R  +KP R  + DVYK  G G    G++E G ++ G      P G    +K++ +H E    A  GD+V   +  + +  +  G V  D  S P R      A++I+ N    I  G+  +             +L   +++ +G+ ++  P+         V L  S+P+CVE + +Y  LGRF +R    T+A GVI
Sbjct:   36 KELLNLVIIGHVDAGKSTLMGHLLFLLGDVSKKAMHKYPFFFLIIIFNLKACTESKKAGKASFAYAWVLDETGEERERGITMDVGLTRFQTKNKVITLMDAPGHKDFIPNMITGAAQADVAILVVDAITGEFEAGFESGGQTREHAILVRSLGVTQLIVAINKLDMMS--WSEERYLHIVSKLKHFLKQVGFKDSDVVYVPVSGLSGENLVKPCTEEKLKKWYQGQCLVDR-----------------IDEFKSPKRDMDKPWRFCVSDVYKGLGTGINLAGKMEAGHIQTGDKALAMPAGEKGLLKALNIHDEPTQWACAGDHVTLTLSGIDMMHVGVGTVLCDPAS-PIRGTCRIKARIIVFNIEVPITNGFMVLFHYQNLSEPATIKKLHALLNKSTGEVIQRKPRCLPKNSNAEVELQTSRPVCVELYKDYKDLGRFMLRYGGNTIAAGVI 470          
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Match: EDO39883 (Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc:A7S8T2])

HSP 1 Score: 167.162 bits (422), Expect = 1.881e-46
Identity = 138/449 (30.73%), Postives = 206/449 (45.88%), Query Frame = 1
Query:   82 DKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLA-----YTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTG--KTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQG--LTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            DK H+NI  IGHVD GK+T T  +                K   + G  +FK    +D    ER RGITI+ A  +++T K +   +D PGH D+IKNMITG +Q DGA+LVVA   G+         QTREH LLA      ++GVK ++V VNK D  + P   +  +   +E+ S                  G++GDN        P   G  +     K ++  +    K L      +  PAR  +KP  LP++DV+ I G GTV  GR+E G++K G  V F   G  + T V  +EM H+ L     GDN+G  ++ V  ++++RG V     +   +  + F AQV I+    E    + P +  +T  +  +  ++   I    GKE    P +  S    L+  +P +              RF +R+  +TV  GV+
Sbjct:   12 DKPHVNIGTIGHVDHGKTTLTAAIT---------------KVLADTGAANFKSYGDIDNAPEERARGITINTAHVEYQTEKRHYGHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGQMP-------QTREHLLLANQASKCSVGVKDIVVYVNKADMIDDPELLELVELELRELLSEY----------------GYDGDNT-------PIIIGSALCALEGKNDDLGINSIKKLLEAVDSHIPTPARDLDKPFLLPIEDVFSISGRGTVVTGRIERGVIKKGDEVEFVGHGSKIKTTVTGIEMFHKILDRGEAGDNLGALVRGVKREDVKRGMVLCQPGT--VKSHSKFEAQVYILKK--EEGGRHKPFVTSYTPQMYVRTGDVAATITLPEGKEFV-MPGEDASFTVQLLFDVPLEQGL-----------RFTLREGSKTVGTGVV 399          
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Match: EDO48035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR6])

HSP 1 Score: 100.138 bits (248), Expect = 1.323e-25
Identity = 42/93 (45.16%), Postives = 68/93 (73.12%), Query Frame = 1
Query:   91 HINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFI 369
            H+NI+ IGHVD+GKST  GH++Y  G +DKRT+EK+E+EA+E  + ++  +W LD  + ER++G T+++    F+T   + T++DAPGH+ F+
Sbjct:    2 HVNIIFIGHVDAGKSTIGGHVMYLTGQVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAAFDTDTKHFTLLDAPGHKSFV 94          
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Match: ENSORLT00000009507.2 (elongation factor 1-alpha [Source:NCBI gene;Acc:101170939])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 359/443 (81.04%), Postives = 401/443 (90.52%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ + RF+EI+KEVS+Y+KK+GY P +VAFVPISGW+GDNM+E S  M W+KGW++ R+     E   TG TLL+ALD++ PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAP  LTTEVKSVEMHHE+LTEALPGDNVGFNIKNVSVKEIRRGNV  DSK+DP   A +F AQVII+NHPG+I  GY+PVLDCHTAHIACKFSEL +KIDRRSGK+LEDNPK  KSGDA ++ ++P KPMCVE+FS+YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSAYIKKIGYNPATVAFVPISGWHGDNMLEASDKMSWFKGWKIERK-----EGGATGVTLLEALDSILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPPNLTTEVKSVEMHHESLTEALPGDNVGFNIKNVSVKEIRRGNVAGDSKNDPPLAAENFTAQVIILNHPGQIAQGYAPVLDCHTAHIACKFSELKEKIDRRSGKKLEDNPKALKSGDAAIITMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Match: eef1a (elongation factor 1 alpha [Source:NCBI gene;Acc:100049188])

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 356/443 (80.36%), Postives = 399/443 (90.07%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDIALWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLA+TLGVKQ+IVGVNKMDSTEPP+ + RF+EI+KEVS+Y+KK+GY P +VAFVPISGW+GDNM+E S  M W+KGW++ R++        +G TLL+ALDA+ PP+RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  LTTEVKSVEMHHE+L EA+PGDNVGFNIKNVSVKEIRRG V  DSK+DP + A  F AQVII+NHPG+I+ GY+PVLDCHTAHIACKF+EL++KIDRRSGK+LEDNPK  KSGDA +V+LIP KPM VE FS YPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKIHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSQARFEEIQKEVSTYIKKIGYNPAAVAFVPISGWHGDNMLEASDKMSWFKGWKIERKDG-----NASGTTLLEALDAILPPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPPNLTTEVKSVEMHHESLPEAVPGDNVGFNIKNVSVKEIRRGYVAGDSKNDPPKAAASFNAQVIILNHPGQINQGYAPVLDCHTAHIACKFNELIEKIDRRSGKKLEDNPKFVKSGDAAIVKLIPQKPMVVEPFSNYPPLGRFAVRDMRQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 336/446 (75.34%), Postives = 382/446 (85.65%), Query Frame = 1
Query:   64 NSAMPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            ++ M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQT                         +P + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++ R+     E   +G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEALTEALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A +F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:   13 SATMGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQT-------------------------QPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRK-----EGNASGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 428          
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Match: eef1a1a (elongation factor 1-alpha 1 [Source:NCBI gene;Acc:101166076])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 336/443 (75.85%), Postives = 380/443 (85.78%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKST+TGHLIYKCGGIDKRTIEKFEKEA EMGKGSFKYAWVLDKLKAERERGITIDI+LWKFET+K+YVT+IDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQT                         +P + +KR++EI KEVS+Y+KK+GY PD+VAFVPISGWNGDNM+E S NM W+KGW++ R+     E   +G TLL+ALDA++PP RPT+KPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFAP  +TTEVKSVEMHHEALTEALPGDNVGFN+KNVSVK+IRRGNV  DSK+DP ++A +F AQVII+NHPG+I AGY+PVLDCHTAHIACKF+EL +KIDRRSGK+LEDNPK  KSGDA +V +IP KPMCVE+FSEYPPLGRFAVRDM+QTVAVGVI
Sbjct:    1 MGKEKLHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQT-------------------------QPNYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSPNMTWFKGWKINRK-----EGNASGTTLLEALDAIQPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALTEALPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPQEAANFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVDMIPGKPMCVESFSEYPPLGRFAVRDMRQTVAVGVI 413          
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Match: si:dkey-37o8.1 (42Sp50 [Source:NCBI gene;Acc:100049338])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 297/443 (67.04%), Postives = 367/443 (82.84%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K H+N+VVIGHVDSGKST+TGHL+YKCGGID R +EKFEK A ++GK SFK+AWVLDKLKAERERGITIDI+L KF T K+ +T+IDAPGHRDFIKNMITGTSQAD A+L+V+A  GE+EAG+S++GQTREHALLAYTLGVKQ+IV VNKMD TEPP+ +KR++E+ + VS +L+K+GY  ++V FVP+SGW G+NMI  +  MPWY+GW++ RR     E   TGKTLL+ LD+++PP R  NKPLRLPLQDVYKIGG+GTVPVG++ETG+LKPGM + F+P  LT EVKS+EMHH+ L  ALPG NVGFNIKNVSVK +RRG+V  +++ DP      F AQVII+NHPG+I AGYSPVLDCHT H+ C+F+EL +K+DRR+GK+LE+ P+   SGDA  V+L+P KPMCVE+F  YPPLGRFA RD+KQTVAVGVI
Sbjct:    1 MAKEKVHVNVVVIGHVDSGKSTTTGHLVYKCGGIDPRKLEKFEKAAAQLGKSSFKFAWVLDKLKAERERGITIDISLLKFNTQKYTMTIIDAPGHRDFIKNMITGTSQADVALLMVSAAKGEYEAGVSRSGQTREHALLAYTLGVKQIIVCVNKMDLTEPPYSQKRYEEVMRGVSGFLRKIGYDTNAVPFVPVSGWTGENMISVTQKMPWYQGWKIRRR-----EGPSTGKTLLEVLDSIQPPVRTINKPLRLPLQDVYKIGGVGTVPVGKIETGVLKPGMTLVFSPAKLTAEVKSIEMHHQGLQTALPGHNVGFNIKNVSVKNLRRGDVAGNAQQDPPSDVRSFEAQVIILNHPGKIKAGYSPVLDCHTTHVTCRFTELKEKLDRRTGKKLEEQPQTLVSGDAATVKLVPVKPMCVESFFTYPPLGRFAARDLKQTVAVGVI 438          
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Match: SMESG000061164.1 (SMESG000061164.1)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 443          
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Match: SMESG000061099.1 (SMESG000061099.1)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 443          
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Match: SMESG000052648.1 (SMESG000052648.1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 367/444 (82.66%), Postives = 411/444 (92.57%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRN-AKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  DKTHINIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ +YVTVIDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQMIVG+NK+DSTEPP+ E R++EIKKEVS Y+KKVGY PDSVAFVPISGW GDNM+  S+NMPW+KGW + R+N A K+E  ++G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVV+FAP GLTTEVKSVEMHHE++ EA+PGDNVGFN+KNVSVK+I+RGNVCSDSK+ PA  A DF AQVI+MNHPG+IH GY+PVLDCHTAHIACKFSE +KKIDRR+GKE+ED PKQ KSGD+ +VR++PSKPMCVETF E+PPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MVCDKTHINIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSENRYNEIKKEVSGYIKKVGYNPDSVAFVPISGWVGDNMVLPSTNMPWFKGWTIKRKNGATKKEESLSGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVSFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNAPALGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFSEFLKKIDRRTGKEVEDAPKQLKSGDSAIVRMVPSKPMCVETFMEFPPLGRFAVRDMKQTVAVGVI 444          
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Match: SMESG000078056.1 (SMESG000078056.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 361/444 (81.31%), Postives = 408/444 (91.89%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDNMIEESSNMPWYKGWEVTRRN-AKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFKSGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            M  +K HINIVVIGHVDSGKSTSTGH+IYKCGGIDKRTIEKFEKEAQ+MGKGSFKYAWVLDKLKAERERGITIDIALWKFET+ +YVTVIDAPGHRDFIKNMITGTSQAD AVL+VAAG GEFEAGISKNGQTREHALLAYTLGVKQMIVG+NK+DSTEPP+ E R++EIKKEVS Y+KKVGY P+SVAFVPISGW GDNM+  S+NMPW+KGW + R+N A K+E  + G TLL+A+DA++PPARPT KPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVV FAP GLTTEVKSVEMHHE++ EA+PGDNVGFN+KNVSVK+I+RGNVCSDSK+ PA  A DF AQVI+MNHPG+IH GY+PVLDCHTAHIACKF+E +KKIDRR+GKE+ED PKQ KSGD+ +++++PSKPMCVE+F EYPPLGRFAVRDMKQTVAVGVI
Sbjct:    1 MVCEKLHINIVVIGHVDSGKSTSTGHMIYKCGGIDKRTIEKFEKEAQDMGKGSFKYAWVLDKLKAERERGITIDIALWKFETSNYYVTVIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQMIVGINKIDSTEPPYSESRYNEIKKEVSGYIKKVGYNPESVAFVPISGWVGDNMVLPSTNMPWFKGWSIKRKNGATKKEESLAGVTLLEAMDAIDPPARPTEKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVCFAPHGLTTEVKSVEMHHESIPEAVPGDNVGFNVKNVSVKDIKRGNVCSDSKNSPAMGAVDFEAQVIVMNHPGQIHEGYTPVLDCHTAHIACKFAEFIKKIDRRTGKEVEDAPKQLKSGDSAIIKMVPSKPMCVESFMEYPPLGRFAVRDMKQTVAVGVI 444          
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Match: SMESG000067151.1 (SMESG000067151.1)

HSP 1 Score: 276.944 bits (707), Expect = 2.369e-86
Identity = 165/448 (36.83%), Postives = 260/448 (58.04%), Query Frame = 1
Query:   73 MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIKNMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIVGVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDS-VAFVPISGWNGDNMIEESS--NMPWYKGWEVTRRNAKKEETKVTGKTXXXXXXXXEPPARPTNKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMHHEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVIIMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKE-LEDNPKQFKSGDAGLVRL-IPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVI 1401
            +PS K  +N+V IGHVD+GKST  GHL+Y  G +D+R +EK  ++A+EM + S+ ++W LD  + ER +GIT++     FET K + T++DAPGH+ +I NMI+G+SQAD A+LV++A  GEFEAG  K GQT+EH +L  T GV+++IV +NKMD     + E+R+   + ++  +L+K G+ P + V F+P SG+ G  + E  S    PWY+                 G TLL+ L+ + P  R  N PLRL + D YK   +GT  +G+VE G +K        P   T E+  +          + GDNV   +KN+  +EI  G V   S+++  + +  F AQ+++ +    I AG+S ++  H+        +++  +D+++ K  ++  PK  ++GD  +VRL I    +C+E F ++P LGRF +R+  QT+A G I
Sbjct:   83 VPS-KEFVNVVFIGHVDAGKSTIGGHLLYLTGNVDQRDLEKNMRKAKEMNRESWFHSWALDLNEDERAKGITVECGRAAFETEKKHFTLLDAPGHKSYITNMISGSSQADIAILVISARIGEFEAGFEKGGQTQEHTVLVKTSGVRRLIVLINKMDDLSVGWKEERYKYCRDKLIPFLRKTGFNPKTDVFFMPCSGYTGAFLKELGSIDECPWYR-----------------GPTLLEFLNEMAPLERNINGPLRLTVLDKYK--DMGTNIIGKVENGYIKKNQSYVLMPIEKTVEIIQITKDDVESDIGIAGDNVRLKVKNIEEEEIGSGFVLC-SQNNLCKASNLFDAQILVGDIKSIICAGFSAMIHLHSLSREVAIYKILGLLDKKNPKVCVQKFPKFIRAGDLVMVRLEIKEGIVCLENFKDFPQLGRFVLREQMQTIAQGKI 509          
The following BLAST results are available for this feature:
BLAST of Elongation factor 1-alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEF1A10.000e+081.04eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A10.000e+081.04eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A10.000e+081.04eukaryotic translation elongation factor 1 alpha 1... [more]
EEF1A20.000e+081.04eukaryotic translation elongation factor 1 alpha 2... [more]
EEF1A20.000e+081.04eukaryotic translation elongation factor 1 alpha 2... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef-1A.20.000e+079.91Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.20.000e+079.91Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.20.000e+079.91Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.20.000e+079.91Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
eef-1A.10.000e+079.91Elongation factor 1-alpha [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eEF1alpha20.000e+080.14gene:FBgn0000557 transcript:FBtr0085835[more]
eEF1alpha20.000e+080.14gene:FBgn0000557 transcript:FBtr0085834[more]
eEF1alpha20.000e+080.14gene:FBgn0000557 transcript:FBtr0085832[more]
eEF1alpha20.000e+080.14gene:FBgn0000557 transcript:FBtr0085833[more]
eEF1alpha10.000e+079.68gene:FBgn0284245 transcript:FBtr0088035[more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1a1a0.000e+081.49eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1a0.000e+081.49eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1b0.000e+081.26eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l20.000e+081.26eukaryotic translation elongation factor 1 alpha 1... [more]
eef1a1l20.000e+081.26eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1a20.000e+081.26eukaryotic translation elongation factor 1 alpha 2... [more]
eef1a10.000e+081.04eukaryotic translation elongation factor 1 alpha 1... [more]
map3k10.000e+080.81mitogen-activated protein kinase kinase kinase 1, ... [more]
anp32b0.000e+080.36acidic nuclear phosphoprotein 32 family member B [... [more]
eef1a10.000e+078.50eukaryotic translation elongation factor 1 alpha 1... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eef1a10.000e+081.04eukaryotic translation elongation factor 1 alpha 1... [more]
Eef1a20.000e+080.81eukaryotic translation elongation factor 1 alpha 2... [more]
Eef1a11.100e-14881.50eukaryotic translation elongation factor 1 alpha 1... [more]
Eef1a18.126e-11887.63eukaryotic translation elongation factor 1 alpha 1... [more]
Hbs1l1.372e-9638.69Hbs1-like (S. cerevisiae) [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Elongation factor 1-alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90835|EF1A_CHICK0.000e+081.49Elongation factor 1-alpha 1 OS=Gallus gallus OX=90... [more]
sp|P62630|EF1A1_RAT0.000e+081.04Elongation factor 1-alpha 1 OS=Rattus norvegicus O... [more]
sp|P68105|EF1A1_RABIT0.000e+081.04Elongation factor 1-alpha 1 OS=Oryctolagus cunicul... [more]
sp|Q5R4R8|EF1A1_PONAB0.000e+081.04Elongation factor 1-alpha 1 OS=Pongo abelii OX=960... [more]
sp|Q5R1X2|EF1A1_PANTR0.000e+081.04Elongation factor 1-alpha 1 OS=Pan troglodytes OX=... [more]
back to top
BLAST of Elongation factor 1-alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMF90.000e+0100.00Elongation factor 1-alpha OS=Schmidtea mediterrane... [more]
Q239590.000e+093.86Elongation factor 1-alpha (Fragment) OS=Dugesia ja... [more]
E1XUM30.000e+083.30Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
A0A267F9J40.000e+083.07Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
A0A267FSI20.000e+083.07Elongation factor 1-alpha OS=Macrostomum lignano O... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEF1A10.000e+081.49elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
eef1a20.000e+080.81elongation factor 1-alpha 2 [Source:NCBI gene;Acc:... [more]
eef1a1l20.000e+081.04elongation factor 1-alpha 1-like [Source:NCBI gene... [more]
ENSAMXT00000043242.10.000e+080.59elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
ENSAMXT00000040958.10.000e+080.36elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011427.10.000e+079.91pep scaffold:Pmarinus_7.0:GL499053:103:1494:1 gene... [more]
hbs1l4.399e-10139.14HBS1-like translational GTPase [Source:ZFIN;Acc:ZD... [more]
eefsec7.085e-1223.88eukaryotic elongation factor, selenocysteine-tRNA-... [more]
gtpbp12.935e-726.40GTP binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ENSPMAT00000001336.14.784e-732.37pep scaffold:Pmarinus_7.0:GL476352:246829:320669:1... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TEF10.000e+077.13Translational elongation factor EF-1 alpha; in the... [more]
TEF20.000e+077.13Translational elongation factor EF-1 alpha; in the... [more]
SUP358.903e-8337.70Translation termination factor eRF3; has a role in... [more]
HBS16.653e-6430.74GTPase with similarity to translation release fact... [more]
TUF11.145e-4931.07Mitochondrial translation elongation factor Tu (EF... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EF1ALPHA0.000e+078.15Elongation factor 1-alpha [Source:UniProtKB/TrEMB... [more]
EDO480345.851e-10037.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475211.219e-8935.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398831.881e-4630.73Elongation factor Tu [Source:UniProtKB/TrEMBL;Acc... [more]
EDO480351.323e-2545.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation factor 1-alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000009507.20.000e+081.04elongation factor 1-alpha [Source:NCBI gene;Acc:10... [more]
eef1a0.000e+080.36elongation factor 1 alpha [Source:NCBI gene;Acc:10... [more]
eef1a1a0.000e+075.34elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
eef1a1a0.000e+075.85elongation factor 1-alpha 1 [Source:NCBI gene;Acc:... [more]
si:dkey-37o8.10.000e+067.0442Sp50 [Source:NCBI gene;Acc:100049338][more]
back to top
BLAST of Elongation factor 1-alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061164.10.000e+0100.00SMESG000061164.1[more]
SMESG000061099.10.000e+0100.00SMESG000061099.1[more]
SMESG000052648.10.000e+082.66SMESG000052648.1[more]
SMESG000078056.10.000e+081.31SMESG000078056.1[more]
SMESG000067151.12.369e-8636.83SMESG000067151.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013735 ID=SMED30013735|Name=Elongation factor 1-alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1638bp
ATAAATCTGAACAAAGTGGTGTGGTAAGCACTTTTAGTTCCTCAAATTTT
TAACTGATTTTGAAATTCAGCTATGCCAAGTGATAAAACCCATATTAATA
TTGTCGTAATTGGTCACGTAGATAGTGGTAAATCCACTTCTACTGGTCAT
CTTATTTACAAATGTGGCGGTATCGACAAAAGAACAATCGAAAAATTTGA
AAAGGAAGCCCAAGAAATGGGAAAAGGTTCTTTCAAATATGCATGGGTTC
TTGATAAATTGAAAGCAGAGCGAGAAAGAGGTATAACAATTGATATCGCA
CTGTGGAAATTCGAAACAACTAAGTTCTACGTTACTGTAATTGACGCACC
TGGTCACAGAGATTTCATTAAGAACATGATTACTGGCACCAGTCAAGCTG
ATGGTGCAGTTTTGGTTGTTGCGGCTGGAACTGGTGAATTTGAAGCTGGT
ATTTCCAAAAACGGTCAAACTCGCGAGCATGCTTTGTTAGCTTATACACT
TGGAGTCAAGCAAATGATTGTTGGTGTGAATAAAATGGATTCAACTGAAC
CACCATTTCATGAAAAAAGATTTGATGAAATTAAAAAAGAAGTCTCGAGC
TATTTAAAAAAAGTTGGATATCAACCAGATAGTGTTGCATTTGTTCCAAT
TTCTGGTTGGAACGGAGATAATATGATTGAAGAAAGTAGTAATATGCCTT
GGTATAAAGGTTGGGAAGTCACAAGACGAAATGCAAAGAAAGAAGAGACA
AAGGTAACAGGAAAAACATTGCTTGATGCTCTAGATGCTTTGGAACCGCC
AGCAAGACCTACAAATAAACCTCTTCGACTTCCACTACAAGATGTTTACA
AAATTGGTGGAATTGGTACTGTTCCGGTAGGTCGTGTTGAAACTGGTATC
TTAAAACCTGGTATGGTTGTTACATTTGCTCCACAAGGTCTCACAACGGA
AGTAAAATCAGTTGAAATGCATCATGAAGCTTTAACTGAGGCTCTTCCCG
GAGATAATGTTGGCTTTAATATTAAAAATGTGTCCGTCAAAGAAATCAGA
CGAGGAAATGTATGTAGTGATTCTAAAAGTGATCCTGCTCGTCAGGCAAC
AGATTTTGTTGCACAGGTGATCATAATGAATCATCCAGGTGAAATTCACG
CTGGTTACTCTCCAGTATTGGATTGCCATACAGCACATATTGCTTGCAAG
TTTTCTGAATTAATGAAAAAAATCGATCGTCGTTCTGGAAAAGAATTAGA
AGATAATCCAAAGCAGTTTAAATCTGGTGATGCAGGTCTTGTTCGTCTTA
TTCCATCAAAACCAATGTGCGTGGAAACATTTAGTGAATATCCACCGCTT
GGTCGATTTGCAGTGCGAGATATGAAACAAACTGTAGCCGTTGGTGTTAT
TAAAGAAGTCACTAAAAAAGCCGTTGAAGGCAAAACAACAAAAGCCGCTG
CTAAGAAAAAATAACTTTGATGTAGAATAAAATTTTGGATTAAGTTTATG
GCGTTGAATTTTGTTTCTGCATTAATTATTTTAATGTTTAATTGTGCAAG
TTTGTCTTAGTAATATTTTTAATTTAGTTGTGAGAATATTGATTTAAATT
CTGTCTTTGTAACAAAATTTAGTATCTTAATAAATTGC
back to top

protein sequence of SMED30013735-orf-1

>SMED30013735-orf-1 ID=SMED30013735-orf-1|Name=SMED30013735-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MPSDKTHINIVVIGHVDSGKSTSTGHLIYKCGGIDKRTIEKFEKEAQEMG
KGSFKYAWVLDKLKAERERGITIDIALWKFETTKFYVTVIDAPGHRDFIK
NMITGTSQADGAVLVVAAGTGEFEAGISKNGQTREHALLAYTLGVKQMIV
GVNKMDSTEPPFHEKRFDEIKKEVSSYLKKVGYQPDSVAFVPISGWNGDN
MIEESSNMPWYKGWEVTRRNAKKEETKVTGKTLLDALDALEPPARPTNKP
LRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFAPQGLTTEVKSVEMH
HEALTEALPGDNVGFNIKNVSVKEIRRGNVCSDSKSDPARQATDFVAQVI
IMNHPGEIHAGYSPVLDCHTAHIACKFSELMKKIDRRSGKELEDNPKQFK
SGDAGLVRLIPSKPMCVETFSEYPPLGRFAVRDMKQTVAVGVIKEVTKKA
VEGKTTKAAAKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000120progenitor cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004539Transl_elong_EF1A_euk/arc
IPR000795TF_GTP-bd_dom
IPR004160Transl_elong_EFTu/EF1A_C
IPR004161EFTu-like_2
IPR027417P-loop_NTPase
IPR031157G_TR_CS
IPR009000Transl_B-barrel_sf
IPR009001Transl_elong_EF1A/Init_IF2_C
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003746translation elongation factor activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006414translational elongation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000795Transcription factor, GTP-binding domainPRINTSPR00315ELONGATNFCTcoord: 104..115
score: 65.67
coord: 88..98
score: 70.19
coord: 9..22
score: 74.83
coord: 68..76
score: 77.92
coord: 148..157
score: 54.72
IPR000795Transcription factor, GTP-binding domainPFAMPF00009GTP_EFTUcoord: 5..239
e-value: 8.1E-54
score: 182.1
IPR000795Transcription factor, GTP-binding domainPROSITEPS51722G_TR_2coord: 5..247
score: 60.234
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 245..337
e-value: 3.1E-43
score: 147.7
NoneNo IPR availableGENE3DG3DSA:2.40.30.10coord: 340..447
e-value: 6.8E-50
score: 169.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..243
e-value: 8.7E-92
score: 308.7
NoneNo IPR availablePANTHERPTHR23115:SF236ELONGATION FACTOR 1-ALPHA 1coord: 2..461
NoneNo IPR availablePANTHERPTHR23115TRANSLATION FACTORcoord: 2..461
NoneNo IPR availableCDDcd03693EF1_alpha_IIcoord: 247..337
e-value: 2.44694E-60
score: 190.092
NoneNo IPR availableCDDcd03705EF1_alpha_IIIcoord: 340..443
e-value: 1.14878E-67
score: 209.357
NoneNo IPR availableCDDcd01883EF1_alphacoord: 9..243
e-value: 6.09998E-157
score: 441.545
IPR004539Translation elongation factor EF1A, eukaryotic/archaealTIGRFAMTIGR00483TIGR00483coord: 1..449
e-value: 2.5E-218
score: 722.6
IPR004160Translation elongation factor EFTu/EF1A, C-terminalPFAMPF03143GTP_EFTU_D3coord: 339..446
e-value: 1.1E-39
score: 135.2
IPR004161Translation elongation factor EFTu-like, domain 2PFAMPF03144GTP_EFTU_D2coord: 265..331
e-value: 4.4E-14
score: 52.6
IPR031157Tr-type G domain, conserved sitePROSITEPS00301G_TR_1coord: 61..76
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..266
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 243..338
IPR009001Translation elongation factor EF1A/initiation factor IF2gamma, C-terminalSUPERFAMILYSSF50465EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domaincoord: 343..446