Cleavage and polyadenylation specificity factor subunit 6

Overview
NameCleavage and polyadenylation specificity factor subunit 6
Smed IDSMED30013733
Length (bp)1843
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cleavage and polyadenylation specificity factor subunit 6 (SMED30013733) t-SNE clustered cells

Violin plots show distribution of expression levels for Cleavage and polyadenylation specificity factor subunit 6 (SMED30013733) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cleavage and polyadenylation specificity factor subunit 6 (SMED30013733) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cleavage and polyadenylation specificity factor subunit 6 (SMED30013733) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013733SMESG000077480.1 SmedASXL_010334SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013733SMESG000077480.1 SmedASXL_010334SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30013733SMESG000077480.1 dd_Smed_v4_4839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013733SMESG000077480.1 dd_Smed_v4_4839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30013733SMESG000077480.1 dd_Smed_v4_4839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30013733SMESG000077480.1 dd_Smed_v4_4839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Match: CPSF6 (cleavage and polyadenylation specific factor 6 [Source:HGNC Symbol;Acc:HGNC:13871])

HSP 1 Score: 137.117 bits (344), Expect = 5.097e-34
Identity = 76/168 (45.24%), Postives = 102/168 (60.71%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.013 bits (297), Expect = 5.684e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  340 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 412          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Match: CPSF6 (cleavage and polyadenylation specific factor 6 [Source:HGNC Symbol;Acc:HGNC:13871])

HSP 1 Score: 137.887 bits (346), Expect = 6.197e-34
Identity = 76/168 (45.24%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 8.774e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Match: CPSF6 (cleavage and polyadenylation specific factor 6 [Source:HGNC Symbol;Acc:HGNC:13871])

HSP 1 Score: 137.502 bits (345), Expect = 1.100e-33
Identity = 76/168 (45.24%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 1.220e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  450 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 522          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Match: CPSF7 (cleavage and polyadenylation specific factor 7 [Source:HGNC Symbol;Acc:HGNC:30098])

HSP 1 Score: 107.842 bits (268), Expect = 9.482e-25
Identity = 49/73 (67.12%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFEDI++RN+ +SSSAI++AV  ASAGDY+ AIETL+TAI++IKQS++A+D RC+VLI+SL+D L GIE+KSY
Sbjct:  260 EFEDIMKRNRAISSSAISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSY 332          

HSP 2 Score: 91.2781 bits (225), Expect = 3.802e-19
Identity = 59/162 (36.42%), Postives = 84/162 (51.85%), Query Frame = 1
Query:  118 IDLYDNMEDNWKRE-----SLDLYDDVESHSN--SDNQ----------RDVKSCSQNN--------YTG---RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            ID+Y + E N   E      +DLYDDV + ++  SD++          R   S   NN        Y+G   RR A YVG+  WWTTDQ L+  +  + + DV+E+KF ENR NGQSKG+  +V  S+ S  + +E LP   ++     V    +QNL+ FE
Sbjct:    8 IDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFE 169          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Match: CPSF7 (cleavage and polyadenylation specific factor 7 [Source:HGNC Symbol;Acc:HGNC:30098])

HSP 1 Score: 108.997 bits (271), Expect = 1.360e-24
Identity = 49/73 (67.12%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFEDI++RN+ +SSSAI++AV  ASAGDY+ AIETL+TAI++IKQS++A+D RC+VLI+SL+D L GIE+KSY
Sbjct:  327 EFEDIMKRNRAISSSAISKAVSGASAGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSY 399          

HSP 2 Score: 92.0485 bits (227), Expect = 4.418e-19
Identity = 59/162 (36.42%), Postives = 84/162 (51.85%), Query Frame = 1
Query:  118 IDLYDNMEDNWKRE-----SLDLYDDVESHSN--SDNQ----------RDVKSCSQNN--------YTG---RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            ID+Y + E N   E      +DLYDDV + ++  SD++          R   S   NN        Y+G   RR A YVG+  WWTTDQ L+  +  + + DV+E+KF ENR NGQSKG+  +V  S+ S  + +E LP   ++     V    +QNL+ FE
Sbjct:    8 IDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFE 169          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Match: cfim-2 (Cleavage Factor IM (CFIm) homolog [Source:UniProtKB/TrEMBL;Acc:C1P629])

HSP 1 Score: 95.9005 bits (237), Expect = 1.120e-21
Identity = 43/73 (58.90%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFED++ RN+TVSSSAI RA+ DAS GD   A ET++TAI LIK S+I  D RC+ L+  L+ TL G+ESK Y
Sbjct:  179 EFEDVMTRNQTVSSSAIARAITDASVGDIKGASETILTAIQLIKNSRIGHDERCRQLVYGLEHTLKGLESKGY 251          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Match: cfim-2 (Cleavage Factor IM (CFIm) homolog [Source:UniProtKB/TrEMBL;Acc:C1P629])

HSP 1 Score: 95.9005 bits (237), Expect = 1.120e-21
Identity = 43/73 (58.90%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFED++ RN+TVSSSAI RA+ DAS GD   A ET++TAI LIK S+I  D RC+ L+  L+ TL G+ESK Y
Sbjct:  179 EFEDVMTRNQTVSSSAIARAITDASVGDIKGASETILTAIQLIKNSRIGHDERCRQLVYGLEHTLKGLESKGY 251          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Match: cfim-2 (Cleavage Factor IM (CFIm) homolog [Source:UniProtKB/TrEMBL;Acc:C1P629])

HSP 1 Score: 95.9005 bits (237), Expect = 1.120e-21
Identity = 43/73 (58.90%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFED++ RN+TVSSSAI RA+ DAS GD   A ET++TAI LIK S+I  D RC+ L+  L+ TL G+ESK Y
Sbjct:  179 EFEDVMTRNQTVSSSAIARAITDASVGDIKGASETILTAIQLIKNSRIGHDERCRQLVYGLEHTLKGLESKGY 251          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Match: cfim-2 (Cleavage Factor IM (CFIm) homolog [Source:UniProtKB/TrEMBL;Acc:C1P629])

HSP 1 Score: 95.9005 bits (237), Expect = 1.120e-21
Identity = 43/73 (58.90%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFED++ RN+TVSSSAI RA+ DAS GD   A ET++TAI LIK S+I  D RC+ L+  L+ TL G+ESK Y
Sbjct:  179 EFEDVMTRNQTVSSSAIARAITDASVGDIKGASETILTAIQLIKNSRIGHDERCRQLVYGLEHTLKGLESKGY 251          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Match: cfim-2 (Cleavage Factor IM (CFIm) homolog [Source:UniProtKB/TrEMBL;Acc:C1P629])

HSP 1 Score: 95.9005 bits (237), Expect = 1.120e-21
Identity = 43/73 (58.90%), Postives = 54/73 (73.97%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFED++ RN+TVSSSAI RA+ DAS GD   A ET++TAI LIK S+I  D RC+ L+  L+ TL G+ESK Y
Sbjct:  179 EFEDVMTRNQTVSSSAIARAITDASVGDIKGASETILTAIQLIKNSRIGHDERCRQLVYGLEHTLKGLESKGY 251          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Fly
Match: Cpsf6 (gene:FBgn0035872 transcript:FBtr0076710)

HSP 1 Score: 122.094 bits (305), Expect = 9.002e-29
Identity = 56/73 (76.71%), Postives = 67/73 (91.78%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+++ RN+TVSSSAI RAV DA+AG+Y+SAIETLVTAISLIKQSK+A D RCK+LI+SLQDTL GIE+KSY
Sbjct:  447 EFEEVMSRNRTVSSSAIARAVSDAAAGEYSSAIETLVTAISLIKQSKVAHDERCKILISSLQDTLHGIEAKSY 519          

HSP 2 Score: 110.923 bits (276), Expect = 3.858e-25
Identity = 59/171 (34.50%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  103 ADESEIDLYDNMEDNWKRESLDLYDDV-----------------------------ESHSNSDNQRDVKSCSQNNYTG---RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            A++ + D     +D +  + +DLYDD+                                 NS     V   S  + T    RR   YVGNL WWTTDQD+ +++  + + D+ E+KF ENR NGQSKGF V+  GS+ S +  +++LPK E+H   P+VTY +KQ L  FE
Sbjct:   10 AEDLDKDFAGQAQDEFGGDGVDLYDDIGGPTESAASGGGGGGTPSADGAAGPGSGEPGERNSGGPNGVYHQSSGSLTPTMNRRYQLYVGNLTWWTTDQDIANSLRDIGVSDLQEVKFFENRANGQSKGFSVISLGSESSLRAVLDQLPKKEMHGQAPVVTYPSKQALTQFE 180          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Fly
Match: Cpsf6 (gene:FBgn0035872 transcript:FBtr0304628)

HSP 1 Score: 121.709 bits (304), Expect = 1.174e-28
Identity = 56/73 (76.71%), Postives = 67/73 (91.78%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+++ RN+TVSSSAI RAV DA+AG+Y+SAIETLVTAISLIKQSK+A D RCK+LI+SLQDTL GIE+KSY
Sbjct:  400 EFEEVMSRNRTVSSSAIARAVSDAAAGEYSSAIETLVTAISLIKQSKVAHDERCKILISSLQDTLHGIEAKSY 472          

HSP 2 Score: 110.923 bits (276), Expect = 3.721e-25
Identity = 59/171 (34.50%), Postives = 85/171 (49.71%), Query Frame = 1
Query:  103 ADESEIDLYDNMEDNWKRESLDLYDDV-----------------------------ESHSNSDNQRDVKSCSQNNYTG---RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            A++ + D     +D +  + +DLYDD+                                 NS     V   S  + T    RR   YVGNL WWTTDQD+ +++  + + D+ E+KF ENR NGQSKGF V+  GS+ S +  +++LPK E+H   P+VTY +KQ L  FE
Sbjct:   10 AEDLDKDFAGQAQDEFGGDGVDLYDDIGGPTESAASGGGGGGTPSADGAAGPGSGEPGERNSGGPNGVYHQSSGSLTPTMNRRYQLYVGNLTWWTTDQDIANSLRDIGVSDLQEVKFFENRANGQSKGFSVISLGSESSLRAVLDQLPKKEMHGQAPVVTYPSKQALTQFE 180          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 137.887 bits (346), Expect = 3.250e-34
Identity = 78/168 (46.43%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++E+ + +ES       +DLYDDV S S  N D   D                K    N    Y G+R+A Y+GNL WWTTD+DL DA+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ M+ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    1 MADGVDHIDIYADVEEEFNQESDYPVHDQIDLYDDVISPSANNGDAPEDRDYLDSLPAPGGNEGSKGAPANVVYTYNGKRIALYIGNLTWWTTDEDLTDAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLMDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.553 bits (301), Expect = 2.619e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  406 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 480          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 137.502 bits (345), Expect = 5.549e-34
Identity = 78/168 (46.43%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++E+ + +ES       +DLYDDV S S  N D   D                K    N    Y G+R+A Y+GNL WWTTD+DL DA+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ M+ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    1 MADGVDHIDIYADVEEEFNQESDYPVHDQIDLYDDVISPSANNGDAPEDRDYLDSLPAPGGNEGSKGAPANVVYTYNGKRIALYIGNLTWWTTDEDLTDAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLMDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.553 bits (301), Expect = 2.794e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  419 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 493          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 137.502 bits (345), Expect = 6.267e-34
Identity = 78/168 (46.43%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++E+ + +ES       +DLYDDV S S  N D   D                K    N    Y G+R+A Y+GNL WWTTD+DL DA+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ M+ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    1 MADGVDHIDIYADVEEEFNQESDYPVHDQIDLYDDVISPSANNGDAPEDRDYLDSLPAPGGNEGSKGAPANVVYTYNGKRIALYIGNLTWWTTDEDLTDAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLMDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.553 bits (301), Expect = 2.630e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  419 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 493          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 82.0333 bits (201), Expect = 2.947e-18
Identity = 40/49 (81.63%), Postives = 44/49 (89.80%), Query Frame = 1
Query: 1192 GDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
             DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:    1 ADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 49          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 67.0106 bits (162), Expect = 5.141e-13
Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
Query: 1222 VTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            VTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:    1 VTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 39          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Xenopus
Match: grm5 (glutamate receptor, metabotropic 5 [Source:Xenbase;Acc:XB-GENE-954112])

HSP 1 Score: 132.494 bits (332), Expect = 3.196e-32
Identity = 75/168 (44.64%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++ + + +E+       ++LY+DV S S  N D   D               VK    N    YTG+R+A Y+GNL WWTTD+DL DAV+ L + D+LEIKF ENR NGQSKGF ++   S+ S+K+ M+ LPK E+H   PIVT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGAHEQIELYEDVISPSANNGDAPEDRDYMDNLATSVGDDVVKGSVPNIVYTYTGKRIALYIGNLTWWTTDEDLTDAVHSLGVNDILEIKFFENRANGQSKGFALICVSSESSSKKLMDLLPKREMHGQKPIVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 7.256e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  405 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 477          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Xenopus
Match: grm5 (glutamate receptor, metabotropic 5 [Source:Xenbase;Acc:XB-GENE-954112])

HSP 1 Score: 132.494 bits (332), Expect = 3.439e-32
Identity = 75/168 (44.64%), Postives = 101/168 (60.12%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       ++LY+DV S S  N D   D               VK    N    YTG+R+A Y+GNL WWTTD+DL DAV+ L + D+LEIKF ENR NGQSKGF ++   S+ S+K+ M+ LPK E+H   PIVT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGAHEQIELYEDVISPSANNGDAPEDRDYMDNLATSVGDDVVKGSVPNIVYTYTGKRIALYIGNLTWWTTDEDLTDAVHSLGVNDILEIKFFENRANGQSKGFALICVSSESSSKKLMDLLPKREMHGQKPIVTPCNKQFLSQFE 168          

HSP 2 Score: 119.013 bits (297), Expect = 1.154e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  418 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 490          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Xenopus
Match: nkx6-1 (NK6 homeobox 1 [Source:Xenbase;Acc:XB-GENE-483574])

HSP 1 Score: 98.5969 bits (244), Expect = 4.516e-23
Identity = 67/169 (39.64%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  100 MADESE-IDLYDN----MEDNWKRESLDLYDDV-----------ESHSNS---DNQRDVKSCS--QNN-------YTGR-RVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD ++ ID+Y       E  +  E +DLYDDV           ES+ NS   +    V+S S   NN       ++GR RV+ Y+GN  WWTTDQ LL  +  + IKD +EIKF ENR NGQSKGF  ++  S+ S    +E LP+ +++     V   N+QNL++FE
Sbjct:    1 MADGADLIDIYAEEEFIQESEFAAEQVDLYDDVLAVPAISSSHVESNRNSSALEPTSPVQSTSPMSNNKTPEVLYHSGRNRVSMYIGNFSWWTTDQQLLALIRSVGIKDHVEIKFAENRANGQSKGFAEVILSSESSMNLILEHLPQKKLNGKKLDVRPANRQNLSFFE 169          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Xenopus
Match: nkx6-1 (NK6 homeobox 1 [Source:Xenbase;Acc:XB-GENE-483574])

HSP 1 Score: 98.9821 bits (245), Expect = 2.005e-21
Identity = 61/151 (40.40%), Postives = 84/151 (55.63%), Query Frame = 1
Query:  139 EDNWKRESLDLYDDV-----------ESHSNS---DNQRDVKSCS--QNN-------YTGR-RVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            E  +  E +DLYDDV           ES+ NS   +    V+S S   NN       ++GR RV+ Y+GN  WWTTDQ LL  +  + IKD +EIKF ENR NGQSKGF  ++  S+ S    +E LP+ +++     V   N+QNL++FE
Sbjct:   30 ESEFAAEQVDLYDDVLAVPAISSSHVESNRNSSALEPTSPVQSTSPMSNNKTPEVLYHSGRNRVSMYIGNFSWWTTDQQLLALIRSVGIKDHVEIKFAENRANGQSKGFAEVILSSESSMNLILEHLPQKKLNGKKLDVRPANRQNLSFFE 180          

HSP 2 Score: 91.2781 bits (225), Expect = 6.866e-19
Identity = 41/77 (53.25%), Postives = 63/77 (81.82%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRK 1344
            EFE+++ RN+ +S SA++ AV  A++GDYA+AI+TL TAI++IK+S++A+D RC+VL+ SL+D L GI+ K+  SRK
Sbjct:  344 EFEELMNRNRAISRSALSNAVCGATSGDYANAIKTLETAIAVIKESRVANDDRCRVLLTSLKDCLHGIQDKANSSRK 420          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Match: Cpsf6 (cleavage and polyadenylation specific factor 6 [Source:MGI Symbol;Acc:MGI:1913948])

HSP 1 Score: 135.961 bits (341), Expect = 1.879e-33
Identity = 75/168 (44.64%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  +P+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 6.079e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Match: Cpsf6 (cleavage and polyadenylation specific factor 6 [Source:MGI Symbol;Acc:MGI:1913948])

HSP 1 Score: 135.961 bits (341), Expect = 1.879e-33
Identity = 75/168 (44.64%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  +P+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 6.079e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Match: Cpsf6 (cleavage and polyadenylation specific factor 6 [Source:MGI Symbol;Acc:MGI:1913948])

HSP 1 Score: 135.961 bits (341), Expect = 1.898e-33
Identity = 75/168 (44.64%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  +P+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 6.121e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Match: Cpsf6 (cleavage and polyadenylation specific factor 6 [Source:MGI Symbol;Acc:MGI:1913948])

HSP 1 Score: 135.961 bits (341), Expect = 2.734e-33
Identity = 75/168 (44.64%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  +P+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 8.080e-28
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  450 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 522          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Match: Cpsf6 (cleavage and polyadenylation specific factor 6 [Source:MGI Symbol;Acc:MGI:1913948])

HSP 1 Score: 120.168 bits (300), Expect = 7.281e-31
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:   43 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 115          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Match: sp|Q6NWC6|CPSF6_DANRE (Cleavage and polyadenylation specificity factor subunit 6 OS=Danio rerio OX=7955 GN=cpsf6 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.453e-33
Identity = 78/168 (46.43%), Postives = 100/168 (59.52%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRD---------------VKSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++E+ + +ES       +DLYDDV S S  N D   D                K    N    Y G+R+A Y+GNL WWTTD+DL DA+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ M+ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    1 MADGVDHIDIYADVEEEFNQESDYPVHDQIDLYDDVISPSANNGDAPEDRDYLDSLPAPGGNEGSKGAPANVVYTYNGKRIALYIGNLTWWTTDEDLTDAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLMDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.553 bits (301), Expect = 1.977e-27
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  406 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 480          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Match: sp|Q16630|CPSF6_HUMAN (Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 2.976e-33
Identity = 76/168 (45.24%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 4.214e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Match: sp|Q0P5D2|CPSF6_BOVIN (Cleavage and polyadenylation specificity factor subunit 6 OS=Bos taurus OX=9913 GN=CPSF6 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 2.976e-33
Identity = 76/168 (45.24%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 4.214e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Match: sp|Q5ZL34|CPSF6_CHICK (Cleavage and polyadenylation specificity factor subunit 6 OS=Gallus gallus OX=9031 GN=CPSF6 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.910e-33
Identity = 76/168 (45.24%), Postives = 102/168 (60.71%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  NP+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDSLPPSVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 4.291e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Match: sp|Q6NVF9|CPSF6_MOUSE (Cleavage and polyadenylation specificity factor subunit 6 OS=Mus musculus OX=10090 GN=Cpsf6 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.315e-32
Identity = 75/168 (44.64%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  100 MADESE-IDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD  + ID+Y ++ + + +E+       +DLYDDV S S  N D   D                K  + N    YTG+R+A Y+GNL WWTTD+DL +AV+ L + D+LEIKF ENR NGQSKGF ++  GS+ S+K+ M+ LPK E+H  +P+VT CNKQ L+ FE
Sbjct:    1 MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQSPVVTPCNKQFLSQFE 168          

HSP 2 Score: 119.398 bits (298), Expect = 4.252e-27
Identity = 57/73 (78.08%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSY 1332
            EFE+I+ RN+ +SSSAI+RAV DASAGDY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSY
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSY 485          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Match: A0A5J4NZ24 (Cleavage and polyadenylation specificity factor subunit 6/7 OS=Paragonimus westermani OX=34504 GN=DEA37_0004503 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 7.619e-47
Identity = 90/154 (58.44%), Postives = 112/154 (72.73%), Query Frame = 1
Query:  100 MADE--SEIDLYDNMEDNWKRESLDL---YDDVESHSNSDNQRDVKSC-----SQNN---YTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQ 522
            MA E  +EIDLYDN+++++ +E  DL   YDDV + S S+      S      S NN   + GRR+ATYVGNL WWTTDQDLL+A NKL I DV+EIKFHENRQNGQSKGFC MVFGS++S + AM+K+PK EIH   P+VT+C KQNL+ FE+
Sbjct:    1 MAGEGGAEIDLYDNIDEDFVQECSDLTELYDDVIAPSTSEAAITAPSVVLSKPSLNNLGLHNGRRIATYVGNLTWWTTDQDLLEAANKLGINDVIEIKFHENRQNGQSKGFCAMVFGSEQSVRVAMDKMPKTEIHGQKPVVTHCTKQNLSVFEK 154          

HSP 2 Score: 140.584 bits (353), Expect = 1.455e-31
Identity = 75/100 (75.00%), Postives = 86/100 (86.00%), Query Frame = 1
Query: 1039 FDAFGRPIXXXXXXXXXXXXXXXXXEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            FD +GRP+ ++++ SS      S  +FEDILQRNKTVSSSAINRAVQDA+ GDYASAIETLVTAISLIKQSKIASD RC++LINSLQDTL GIESKSYG+
Sbjct:  345 FDNYGRPVIHTYTPSSTGKLSES--DFEDILQRNKTVSSSAINRAVQDAAGGDYASAIETLVTAISLIKQSKIASDDRCRILINSLQDTLHGIESKSYGT 442          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Match: A0A4S2LG73 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007412 PE=4 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 9.915e-47
Identity = 86/149 (57.72%), Postives = 108/149 (72.48%), Query Frame = 1
Query:  112 SEIDLYDNMEDNWKRESLDL---YDDVESHSNSDNQRD-------VKSC--SQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQ 522
            +EIDLYDN+++++ +E  DL   YDDV +    +N           KS   +  +++G+RV TYVGNL WWTTDQDLL+  N L I DV+EIKFHENRQNGQSKGFCVMVFGSD+SA+ AMEKLPK EIH  NP+VT+C K NL+ FE+
Sbjct:    7 AEIDLYDNIDEDFVQECADLNELYDDVMAPGAQNNTASKPESPVVTKSTLTTVASHSGKRVETYVGNLTWWTTDQDLLETTNALGINDVVEIKFHENRQNGQSKGFCVMVFGSDQSARTAMEKLPKTEIHGQNPVVTHCTKHNLSIFEK 155          

HSP 2 Score: 141.354 bits (355), Expect = 1.216e-32
Identity = 75/100 (75.00%), Postives = 88/100 (88.00%), Query Frame = 1
Query: 1039 FDAFGRPIXXXXXXXXXXXXXXXXXEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            FD +GRP+ ++++ SS+     S  EFEDILQRNKTVSSSAINRAVQDA++GDYASAIETLVTAISLIKQSKIA+D RC++LINSLQDTL GIESKSYG+
Sbjct:  347 FDNYGRPVIHTYTPSSSGKLSES--EFEDILQRNKTVSSSAINRAVQDAASGDYASAIETLVTAISLIKQSKIANDDRCRILINSLQDTLHGIESKSYGT 444          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Match: A0A3P6TLS9 (RRM domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS3073 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.384e-46
Identity = 83/145 (57.24%), Postives = 108/145 (74.48%), Query Frame = 1
Query:  112 SEIDLYDNMEDNWKRES---LDLYDDVESHSNSD--NQRDVK---SCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQ 522
            +EIDLYDN+E+++ ++S    +LYDDV +  +SD  +  D+K   +     +TGRR+ATYVGNL WWTTD DL  A N L I D+LEIKFHENRQNGQSKGFCV+VFGS++S + AMEKL KIEI+   P++TYC K NL+ FE+
Sbjct:    7 AEIDLYDNIEEDFVQDSSELTELYDDVIAPPSSDTTSHNDIKPNLATPSATHTGRRIATYVGNLTWWTTDVDLYTAFNNLGITDILEIKFHENRQNGQSKGFCVIVFGSEQSVRTAMEKLSKIEINGQTPVITYCTKHNLSLFEK 151          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Match: A0A4V3SDY8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007412 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 7.905e-46
Identity = 86/149 (57.72%), Postives = 108/149 (72.48%), Query Frame = 1
Query:  112 SEIDLYDNMEDNWKRESLDL---YDDVESHSNSDNQRD-------VKSC--SQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQ 522
            +EIDLYDN+++++ +E  DL   YDDV +    +N           KS   +  +++G+RV TYVGNL WWTTDQDLL+  N L I DV+EIKFHENRQNGQSKGFCVMVFGSD+SA+ AMEKLPK EIH  NP+VT+C K NL+ FE+
Sbjct:    7 AEIDLYDNIDEDFVQECADLNELYDDVMAPGAQNNTASKPESPVVTKSTLTTVASHSGKRVETYVGNLTWWTTDQDLLETTNALGINDVVEIKFHENRQNGQSKGFCVMVFGSDQSARTAMEKLPKTEIHGQNPVVTHCTKHNLSIFEK 155          

HSP 2 Score: 141.354 bits (355), Expect = 3.207e-32
Identity = 75/100 (75.00%), Postives = 88/100 (88.00%), Query Frame = 1
Query: 1039 FDAFGRPIXXXXXXXXXXXXXXXXXEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            FD +GRP+ ++++ SS+     S  EFEDILQRNKTVSSSAINRAVQDA++GDYASAIETLVTAISLIKQSKIA+D RC++LINSLQDTL GIESKSYG+
Sbjct:  347 FDNYGRPVIHTYTPSSSGKLSES--EFEDILQRNKTVSSSAINRAVQDAASGDYASAIETLVTAISLIKQSKIANDDRCRILINSLQDTLHGIESKSYGT 444          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Match: A0A4S2LI57 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007412 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.213e-45
Identity = 86/149 (57.72%), Postives = 108/149 (72.48%), Query Frame = 1
Query:  112 SEIDLYDNMEDNWKRESLDL---YDDVESHSNSDNQRD-------VKSC--SQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQ 522
            +EIDLYDN+++++ +E  DL   YDDV +    +N           KS   +  +++G+RV TYVGNL WWTTDQDLL+  N L I DV+EIKFHENRQNGQSKGFCVMVFGSD+SA+ AMEKLPK EIH  NP+VT+C K NL+ FE+
Sbjct:    7 AEIDLYDNIDEDFVQECADLNELYDDVMAPGAQNNTASKPESPVVTKSTLTTVASHSGKRVETYVGNLTWWTTDQDLLETTNALGINDVVEIKFHENRQNGQSKGFCVMVFGSDQSARTAMEKLPKTEIHGQNPVVTHCTKHNLSIFEK 155          

HSP 2 Score: 142.51 bits (358), Expect = 2.542e-32
Identity = 75/101 (74.26%), Postives = 89/101 (88.12%), Query Frame = 1
Query: 1039 FDAFGRPIXXXXXXXXXXXXXXXXXEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSR 1341
            FD +GRP+ ++++ SS+     S  EFEDILQRNKTVSSSAINRAVQDA++GDYASAIETLVTAISLIKQSKIA+D RC++LINSLQDTL GIESKSYG++
Sbjct:  347 FDNYGRPVIHTYTPSSSGKLSES--EFEDILQRNKTVSSSAINRAVQDAASGDYASAIETLVTAISLIKQSKIANDDRCRILINSLQDTLHGIESKSYGTK 445          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Cavefish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 136.346 bits (342), Expect = 8.879e-34
Identity = 71/163 (43.56%), Postives = 101/163 (61.96%), Query Frame = 1
Query:   64 NEVIIYSD---SLTKMAD---ESEIDLYDNM-----EDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            + + IY+D     T+ AD     +IDLYD++      +    E  D  D++ +   S+  +   S     YTG+R+A Y+GNL WWTTD+DL +A+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ ++ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    6 DHIDIYADVEEEFTQEADYPVHEQIDLYDDVISPSANNGDAPEDRDYLDNLPAPGGSEGSKGPPSNIVFTYTGKRIALYIGNLTWWTTDEDLTEAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLLDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.553 bits (301), Expect = 2.128e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  398 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 472          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Cavefish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 133.65 bits (335), Expect = 2.610e-33
Identity = 71/163 (43.56%), Postives = 101/163 (61.96%), Query Frame = 1
Query:   64 NEVIIYSD---SLTKMAD---ESEIDLYDNM-----EDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            + + IY+D     T+ AD     +IDLYD++      +    E  D  D++ +   S+  +   S     YTG+R+A Y+GNL WWTTD+DL +A+  + I DVLEIKF ENR NGQSKGF ++  GSD S+++ ++ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    6 DHIDIYADVEEEFTQEADYPVHEQIDLYDDVISPSANNGDAPEDRDYLDNLPAPGGSEGSKGPPSNIVFTYTGKRIALYIGNLTWWTTDEDLTEAIRSIGINDVLEIKFFENRANGQSKGFALVCVGSDSSSRKLLDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 119.783 bits (299), Expect = 1.631e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  314 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 388          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Cavefish
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:327069])

HSP 1 Score: 120.553 bits (301), Expect = 1.436e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  378 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 452          

HSP 2 Score: 95.5153 bits (236), Expect = 2.546e-20
Identity = 52/124 (41.94%), Postives = 73/124 (58.87%), Query Frame = 1
Query:   64 NEVIIYSD---SLTKMAD---ESEIDLYDNM-----EDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKG-FCV 399
            + + IY+D     T+ AD     +IDLYD++      +    E  D  D++ +   S+  +   S     YTG+R+A Y+GNL WWTTD+DL +A+  + I DVLEIKF ENR NGQSKG FC+
Sbjct:    6 DHIDIYADVEEEFTQEADYPVHEQIDLYDDVISPSANNGDAPEDRDYLDNLPAPGGSEGSKGPPSNIVFTYTGKRIALYIGNLTWWTTDEDLTEAIRSIGINDVLEIKFFENRANGQSKGSFCL 129          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Cavefish
Match: CPSF7 (cleavage and polyadenylation specific factor 7 [Source:NCBI gene;Acc:103027160])

HSP 1 Score: 100.523 bits (249), Expect = 3.315e-22
Identity = 60/162 (37.04%), Postives = 89/162 (54.94%), Query Frame = 1
Query:  100 MADESE-IDLYDNME-----DNWKRESLDLYDDVESHS------------NSDNQRDV----KSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MA  +E ID+YD ++     D    E+  LYDDV + S              DN+ +V    K C+ +    +R + YVGN  WWT+D+DL++    L +KDV++IKF ENR NGQS+GF  +V  S++S K+ M+ +P  +I+       Y  +QNL  FE
Sbjct:    1 MAAATEPIDIYDELKTEATGDILSTENDALYDDVVTGSVGSERPQETETTKDDNKPEVVYTYKGCTADK--SKRFSVYVGNFSWWTSDKDLVNVARTLGVKDVVDIKFAENRANGQSRGFAEIVVSSEESVKQLMDSIPHCQINGEKVECRYATRQNLAVFE 160          

HSP 2 Score: 98.2117 bits (243), Expect = 1.667e-21
Identity = 44/77 (57.14%), Postives = 63/77 (81.82%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRK 1344
            EFE+++ RN+T++SSAI +A+  A+ GD + AIETL+TAI++IKQS++ +D RC+ L+ SL+D L  IESKSYGSRK
Sbjct:  297 EFEELMNRNRTIASSAITKAMSGATTGDVSMAIETLLTAIAVIKQSRVYADDRCRALVESLKDCLYSIESKSYGSRK 373          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008931.1 (pep scaffold:Pmarinus_7.0:GL479459:41812:46915:1 gene:ENSPMAG00000008077.1 transcript:ENSPMAT00000008931.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 3.207e-30
Identity = 53/89 (59.55%), Postives = 66/89 (74.16%), Query Frame = 1
Query:  253 RVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            RV  YVGNL WWTTDQDL++A   + + DVL IKF+ENR NGQSKGF ++  GSD +A++ M+ LPK EIH  +PIVT CN Q L+ FE
Sbjct:   79 RVPIYVGNLTWWTTDQDLIEAFQAVGVSDVLGIKFYENRANGQSKGFAIVNLGSDVAARKLMDLLPKHEIHGQDPIVTPCNHQTLSQFE 167          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000721.1 (pep scaffold:Pmarinus_7.0:GL501311:459835:474664:-1 gene:ENSPMAG00000000657.1 transcript:ENSPMAT00000000721.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 1.717e-29
Identity = 58/75 (77.33%), Postives = 68/75 (90.67%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASAG+Y SAIETLVTAISLIKQSK++SD RCKVL++SLQD L GIESKSYGS
Sbjct:  423 EFEEIMNRNRAISSSAISRAVSDASAGEYGSAIETLVTAISLIKQSKVSSDERCKVLVSSLQDCLHGIESKSYGS 497          

HSP 2 Score: 119.783 bits (299), Expect = 9.141e-29
Identity = 61/153 (39.87%), Postives = 93/153 (60.78%), Query Frame = 1
Query:   61 FNEVIIYSDSLTKMADESEIDLYDNMEDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            +++VI+ + S  + ADE +            ++SL   D+   H+ S     +      +Y G+RVA YVGNL WWTTD+DL++A+  + + D+ EIKF+ENR NGQSKGF ++    + S ++ M+ LPK E+H  NPI+T CN+Q+LN  E
Sbjct:   14 YDDVIVPTASNGEEADERDF-----------QDSLAPLDEPGKHTTSTGGPSLNY----SYNGKRVALYVGNLTWWTTDEDLVNALQGIGVTDIQEIKFYENRANGQSKGFALVSVSLEASYRKVMDLLPKRELHGQNPIITPCNRQSLNQLE 151          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Nematostella
Match: EDO36855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHB1])

HSP 1 Score: 103.99 bits (258), Expect = 1.315e-23
Identity = 46/90 (51.11%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  250 RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            R    YVGNL WWTTDQ L +A+ +  + D++ IKF +NR NGQSKGF ++  GSDKS +   E+LPK +I   NP+VT   KQ+L+ FE
Sbjct:  100 RGKPLYVGNLTWWTTDQQLTEALQECGVTDLINIKFFDNRTNGQSKGFAMIELGSDKSIEMVTERLPKFDIEGQNPVVTPATKQHLHEFE 189          

HSP 2 Score: 82.4185 bits (202), Expect = 1.271e-16
Identity = 38/71 (53.52%), Postives = 55/71 (77.46%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESK 1326
            ++ + ++RN+ ++S+AI RA+ DA+AGDY S IETLVTA+SLIKQS  A++  C VL+ SLQ  L G+ES+
Sbjct:  374 DYAESMKRNQALASTAIKRAMSDANAGDYESGIETLVTAVSLIKQSVSANEESCLVLVQSLQSCLQGLESQ 444          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Medaka
Match: cpsf6 (cleavage and polyadenylation specific factor 6 [Source:NCBI gene;Acc:101163450])

HSP 1 Score: 136.346 bits (342), Expect = 1.017e-33
Identity = 78/168 (46.43%), Postives = 102/168 (60.71%), Query Frame = 1
Query:  100 MADE-SEIDLYDNMEDNWKRES-------LDLYDDVESHS--NSDNQRDV---------------KSCSQN---NYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            MAD    ID+Y ++E+ + +ES       +DLYDDV S S  N D   D                KS   N    YTG+R+A Y+GNL WWTTD+DL +A+  + I DVLEIKF ENR NGQSKGF ++  GS+ S+++ M+ L K E+H  NPIVT CNKQ+L+ FE
Sbjct:    1 MADGVDHIDIYADVEEEFNQESEYPVHEQIDLYDDVISPSANNGDAPEDRDYMDSMPPSGGSDGGKSNPPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAIRSVGITDVLEIKFFENRANGQSKGFALVCVGSEGSSRKLMDLLSKRELHGQNPIVTPCNKQSLSQFE 168          

HSP 2 Score: 120.168 bits (300), Expect = 2.368e-28
Identity = 58/75 (77.33%), Postives = 67/75 (89.33%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGS 1338
            EFE+I+ RN+ +SSSAI+RAV DASA DY SAIETLVTAISLIKQSK+++D RCKVLI+SLQD L GIESKSYGS
Sbjct:  413 EFEEIMNRNRAISSSAISRAVSDASAADYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGS 487          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Medaka
Match: CPSF7 (cleavage and polyadenylation specific factor 7 [Source:NCBI gene;Acc:101164290])

HSP 1 Score: 92.8189 bits (229), Expect = 1.185e-19
Identity = 39/90 (43.33%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  250 RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFE 519
            RR+A Y+GN  WWT+D+DL+    KL +KDV EI+F EN+ NGQS+G+  +V  +++S K+ +E++PK +I+       +  +QNL  FE
Sbjct:   86 RRLAIYIGNFPWWTSDKDLMSMAQKLGVKDVTEIRFAENKINGQSRGYAELVVETEESLKKMLERIPKCKINGERIDCRFATRQNLVMFE 175          

HSP 2 Score: 80.4925 bits (197), Expect = 1.214e-15
Identity = 36/78 (46.15%), Postives = 59/78 (75.64%), Query Frame = 1
Query: 1114 EFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRKT 1347
            +FE+++ RN+T++S+AI +AV  A+AGD   A+ETL+TAI++IKQS++  + RC+ L+ SL+D L  I+   YG R++
Sbjct:  312 DFEELMNRNQTIASTAITKAVSGATAGDLQMAMETLLTAIAVIKQSRVYGNERCEALVTSLKDCLVSIQG-DYGYRRS 388          
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Planmine SMEST
Match: SMESG000077480.1 (SMESG000077480.1)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 490/490 (100.00%), Postives = 490/490 (100.00%), Query Frame = 1
Query:  100 MADESEIDLYDNMEDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQXXXXXXXXXXXXXXXXKPKSDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFPGNMPISAIPGLGQNLLFNLSQYTQNTMNRAPNMLMQNPISTPLNVPTGQMNMSLAAQRXXXXXXXXXXXXXXXXXXXXXXXHLNPNFFNAAQTGGXXXXXXVTXXXXXXXXXXXXXXFDAFGRPIXXXXXXXXXXXXXXXXXEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRKTXXXXXXXXXXXXXXXXXXXXXYTXXXXXXXXXXXXXXXXXDYGRTNVQQXXXXXXXXXXXXXXXXXRYSNRYRH 1569
            MADESEIDLYDNMEDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQAAGGSSANSTNNNNGNKPKSDMNRSNNSSNMSNNNCNNNNNQMQMGPMPNNMRFPGNMPISAIPGLGQNLLFNLSQYTQNTMNRAPNMLMQNPISTPLNVPTGQMNMSLAAQRLMQPGMMMQPGLPMTGTGTGPTPHLNPNFFNAAQTGGLLNNLNVTNPSLNQSSSNQNQQFDAFGRPISNSFSSSSAISPKLSDSEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRKTRNRRRSFSESSSECDRDDSNEYTSRRVLRSRSRDRHRRSRDYGRTNVQQTSGSDFFSGMGSSSSTDRYSNRYRH
Sbjct:    1 MADESEIDLYDNMEDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTGRRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCVMVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQAAGGSSANSTNNNNGNKPKSDMNRSNNSSNMSNNNCNNNNNQMQMGPMPNNMRFPGNMPISAIPGLGQNLLFNLSQYTQNTMNRAPNMLMQNPISTPLNVPTGQMNMSLAAQRLMQPGMMMQPGLPMTGTGTGPTPHLNPNFFNAAQTGGLLNNLNVTNPSLNQSSSNQNQQFDAFGRPISNSFSSSSAISPKLSDSEFEDILQRNKTVSSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQDTLTGIESKSYGSRKTRNRRRSFSESSSECDRDDSNEYTSRRVLRSRSRDRHRRSRDYGRTNVQQTSGSDFFSGMGSSSSTDRYSNRYRH 490          
The following BLAST results are available for this feature:
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPSF65.097e-3445.24cleavage and polyadenylation specific factor 6 [So... [more]
CPSF66.197e-3445.24cleavage and polyadenylation specific factor 6 [So... [more]
CPSF61.100e-3345.24cleavage and polyadenylation specific factor 6 [So... [more]
CPSF79.482e-2567.12cleavage and polyadenylation specific factor 7 [So... [more]
CPSF71.360e-2467.12cleavage and polyadenylation specific factor 7 [So... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfim-21.120e-2158.90Cleavage Factor IM (CFIm) homolog [Source:UniProt... [more]
cfim-21.120e-2158.90Cleavage Factor IM (CFIm) homolog [Source:UniProt... [more]
cfim-21.120e-2158.90Cleavage Factor IM (CFIm) homolog [Source:UniProt... [more]
cfim-21.120e-2158.90Cleavage Factor IM (CFIm) homolog [Source:UniProt... [more]
cfim-21.120e-2158.90Cleavage Factor IM (CFIm) homolog [Source:UniProt... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cpsf69.002e-2976.71gene:FBgn0035872 transcript:FBtr0076710[more]
Cpsf61.174e-2876.71gene:FBgn0035872 transcript:FBtr0304628[more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpsf63.250e-3446.43cleavage and polyadenylation specific factor 6 [So... [more]
cpsf65.549e-3446.43cleavage and polyadenylation specific factor 6 [So... [more]
cpsf66.267e-3446.43cleavage and polyadenylation specific factor 6 [So... [more]
cpsf62.947e-1881.63cleavage and polyadenylation specific factor 6 [So... [more]
cpsf65.141e-1382.05cleavage and polyadenylation specific factor 6 [So... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
grm53.196e-3244.64glutamate receptor, metabotropic 5 [Source:Xenbase... [more]
grm53.439e-3244.64glutamate receptor, metabotropic 5 [Source:Xenbase... [more]
nkx6-14.516e-2339.64NK6 homeobox 1 [Source:Xenbase;Acc:XB-GENE-483574][more]
nkx6-12.005e-2140.40NK6 homeobox 1 [Source:Xenbase;Acc:XB-GENE-483574][more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpsf61.879e-3344.64cleavage and polyadenylation specific factor 6 [So... [more]
Cpsf61.879e-3344.64cleavage and polyadenylation specific factor 6 [So... [more]
Cpsf61.898e-3344.64cleavage and polyadenylation specific factor 6 [So... [more]
Cpsf62.734e-3344.64cleavage and polyadenylation specific factor 6 [So... [more]
Cpsf67.281e-3178.08cleavage and polyadenylation specific factor 6 [So... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NWC6|CPSF6_DANRE2.453e-3346.43Cleavage and polyadenylation specificity factor su... [more]
sp|Q16630|CPSF6_HUMAN2.976e-3345.24Cleavage and polyadenylation specificity factor su... [more]
sp|Q0P5D2|CPSF6_BOVIN2.976e-3345.24Cleavage and polyadenylation specificity factor su... [more]
sp|Q5ZL34|CPSF6_CHICK3.910e-3345.24Cleavage and polyadenylation specificity factor su... [more]
sp|Q6NVF9|CPSF6_MOUSE1.315e-3244.64Cleavage and polyadenylation specificity factor su... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NZ247.619e-4758.44Cleavage and polyadenylation specificity factor su... [more]
A0A4S2LG739.915e-4757.72RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A3P6TLS95.384e-4657.24RRM domain-containing protein (Fragment) OS=Diboth... [more]
A0A4V3SDY87.905e-4657.72RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LI571.213e-4557.72RRM domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cpsf68.879e-3443.56cleavage and polyadenylation specific factor 6 [So... [more]
cpsf62.610e-3343.56cleavage and polyadenylation specific factor 6 [So... [more]
cpsf61.436e-2877.33cleavage and polyadenylation specific factor 6 [So... [more]
CPSF73.315e-2237.04cleavage and polyadenylation specific factor 7 [So... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008931.13.207e-3059.55pep scaffold:Pmarinus_7.0:GL479459:41812:46915:1 g... [more]
ENSPMAT00000000721.11.717e-2977.33pep scaffold:Pmarinus_7.0:GL501311:459835:474664:-... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368551.315e-2351.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cpsf61.017e-3346.43cleavage and polyadenylation specific factor 6 [So... [more]
CPSF71.185e-1943.33cleavage and polyadenylation specific factor 7 [So... [more]
back to top
BLAST of Cleavage and polyadenylation specificity factor subunit 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077480.10.000e+0100.00SMESG000077480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013733 ID=SMED30013733|Name=Cleavage and polyadenylation specificity factor subunit 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1843bp
TGCAAATATTGTTTTACCAACTTGTCTTATCAATGATCTTTAAACATAAA
TAATGTTTGTTTCAATGAAGTAATTATTTATAGCGACAGTTTAACTAAAA
TGGCCGATGAAAGTGAAATTGATTTATATGACAATATGGAAGATAATTGG
AAGCGTGAAAGCTTGGATTTATACGATGATGTTGAAAGTCATTCAAACAG
TGACAATCAAAGAGATGTAAAATCATGCTCTCAAAATAATTATACTGGCA
GAAGAGTTGCTACTTATGTCGGAAATTTGAGATGGTGGACAACTGATCAA
GATCTATTAGACGCTGTCAATAAATTGGATATTAAAGATGTCCTTGAAAT
TAAATTTCATGAGAATAGACAAAATGGACAATCAAAAGGATTCTGTGTAA
TGGTATTTGGTTCTGACAAATCTGCGAAAGAGGCAATGGAAAAATTGCCA
AAAATTGAAATCCATAGCCTAAATCCTATAGTTACGTATTGCAACAAACA
AAATTTAAATTATTTTGAACAAGCTGCCGGAGGATCTAGTGCCAATAGCA
CTAATAATAATAATGGTAACAAGCCAAAATCAGATATGAATCGAAGTAAT
AATTCATCAAACATGAGTAATAATAACTGTAATAATAATAATAATCAAAT
GCAAATGGGTCCTATGCCTAACAATATGAGGTTTCCGGGTAATATGCCTA
TATCAGCTATTCCTGGATTAGGACAAAATCTGTTATTTAACCTCTCTCAA
TATACTCAGAACACAATGAATCGTGCACCAAATATGTTAATGCAGAATCC
TATAAGTACACCTCTAAATGTTCCAACAGGCCAGATGAATATGTCACTTG
CAGCTCAAAGGTTAATGCAACCAGGGATGATGATGCAACCAGGATTACCA
ATGACTGGTACCGGAACTGGTCCTACTCCACATCTTAACCCGAACTTTTT
CAATGCAGCTCAAACTGGAGGCTTATTAAACAATTTGAACGTCACAAATC
CGTCATTAAATCAGTCATCATCGAATCAAAATCAGCAATTTGATGCATTT
GGGAGACCAATTTCAAACTCGTTTAGTTCATCCTCTGCGATTTCACCGAA
ACTTTCTGACAGTGAATTCGAAGACATATTGCAAAGAAATAAAACAGTAT
CATCTAGTGCTATTAATCGAGCTGTTCAAGACGCGTCTGCGGGTGATTAT
GCGAGCGCTATAGAAACACTTGTAACTGCCATATCTTTAATAAAACAGTC
CAAAATTGCATCAGACAGTCGATGTAAAGTTTTAATCAACTCACTTCAAG
ACACATTAACTGGAATAGAATCCAAGTCGTATGGATCTAGGAAAACAAGA
AATCGTCGTAGGTCGTTTTCTGAAAGTAGTAGCGAATGTGATAGAGATGA
CTCTAATGAATATACAAGCAGACGAGTATTACGATCTCGATCGCGAGATA
GGCATCGTCGATCAAGAGACTATGGACGAACAAATGTTCAACAAACTAGT
GGTTCAGATTTTTTTTCGGGTATGGGATCAAGCAGCTCAACTGATCGGTA
CTCGAACAGATACCGGCATTAACATTTCAATCAATGCGTTTCTCTTTGTA
CTAATTTTGCATTGTTTTAATATACACAACATCAAAAGAATGTAATTACC
TATCCTCATACTTTTTAATAGGAGTTTAGAGGACTATTCAGTGCTATATT
GTACAATCGGATCTTGAATTATTATTCAAGATAATTTTGTTACTGTTTTG
TTTGCATTAAATATATTTATTGTTAATGTTTTATGAATTCATGTAAAAAT
AGAATTATTTTGTGACCATTACTCAAGTTAATAGATCGGAAGA
back to top

protein sequence of SMED30013733-orf-1

>SMED30013733-orf-1 ID=SMED30013733-orf-1|Name=SMED30013733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
MADESEIDLYDNMEDNWKRESLDLYDDVESHSNSDNQRDVKSCSQNNYTG
RRVATYVGNLRWWTTDQDLLDAVNKLDIKDVLEIKFHENRQNGQSKGFCV
MVFGSDKSAKEAMEKLPKIEIHSLNPIVTYCNKQNLNYFEQAAGGSSANS
TNNNNGNKPKSDMNRSNNSSNMSNNNCNNNNNQMQMGPMPNNMRFPGNMP
ISAIPGLGQNLLFNLSQYTQNTMNRAPNMLMQNPISTPLNVPTGQMNMSL
AAQRLMQPGMMMQPGLPMTGTGTGPTPHLNPNFFNAAQTGGLLNNLNVTN
PSLNQSSSNQNQQFDAFGRPISNSFSSSSAISPKLSDSEFEDILQRNKTV
SSSAINRAVQDASAGDYASAIETLVTAISLIKQSKIASDSRCKVLINSLQ
DTLTGIESKSYGSRKTRNRRRSFSESSSECDRDDSNEYTSRRVLRSRSRD
RHRRSRDYGRTNVQQTSGSDFFSGMGSSSSTDRYSNRYRH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005849mRNA cleavage factor complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR034772CPSF6/7
IPR034769CPSF6
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 54..129
e-value: 2.9E-8
score: 43.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 56..122
e-value: 2.9E-8
score: 33.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 53..133
score: 9.49
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 55..143
e-value: 1.3E-18
score: 69.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 418..444
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 410..490
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 460..483
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 145..170
NoneNo IPR availableCDDcd12643RRM_CFIm68coord: 54..130
e-value: 6.67922E-42
score: 141.802
IPR034772CPSF6/7 familyPANTHERPTHR23204CLEAVAGE AND POLYADENYLATION SPECIFIC FACTORcoord: 263..457
IPR034772CPSF6/7 familyPANTHERPTHR23204CLEAVAGE AND POLYADENYLATION SPECIFIC FACTORcoord: 19..198
IPR034769Cleavage and polyadenylation specificity factor subunit 6PANTHERPTHR23204:SF3CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR SUBUNIT 6coord: 263..457
IPR034769Cleavage and polyadenylation specificity factor subunit 6PANTHERPTHR23204:SF3CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR SUBUNIT 6coord: 19..198
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 56..157