Sterol O-acyltransferase 1

Overview
NameSterol O-acyltransferase 1
Smed IDSMED30013721
Uniprot Best hitAxonemal dynein light chain domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=AXDND1 PE=2 SV=2 (E=2.91598e-61)
Length (bp)3386
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sterol O-acyltransferase 1 (SMED30013721) t-SNE clustered cells

Violin plots show distribution of expression levels for Sterol O-acyltransferase 1 (SMED30013721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sterol O-acyltransferase 1 (SMED30013721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sterol O-acyltransferase 1 (SMED30013721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013721

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013721SMESG000039900.1 SmedASXL_014406SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013721SMESG000039900.1 SmedASXL_073099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013721SMESG000039900.1 dd_Smed_v4_17219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013721SMESG000039900.1 dd_Smed_v4_17219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013721SMESG000039900.1 dd_Smed_v6_17219_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013721SMESG000039900.1 dd_Smed_v4_17219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013721SMESG000039900.1 dd_Smed_v4_17219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013721SMESG000039900.1 dd_Smed_v4_17219_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 144.821 bits (364), Expect = 3.316e-61
Identity = 134/526 (25.48%), Postives = 250/526 (47.53%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDF-EDDYLSEQGQLIQPINQEETRKILNSVI----NWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEAR---RAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+   + NA ++ EYHDLY  QR+R+E ++ +L  ERD W +A Y++   V+E   +  A  L   E      +++F+ L+S  D + L+ ++  T +W N   K    +   EE+    L    + + + +E F E D LS                I NSV+     W+K ++E  E F G  +L + + LK +K L   + DI + +FNRH++  +G +  E   + +I K I ++  ++  ++ GDNG +  + +L +  +    +L N    L F   P  EW      +++  + L    N  G      I V+  S+   L+ + I   +  W  K  + I + N++L+  +  L  SMI+W   +++ + P+F D     +    +A    +G+  L+  A  L   +   S+++ +C K +VT +   K     +    D  ++ +L +    WI     LL  I
Sbjct:  309 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETLKIVKDGLIKWQEFFNEKDILSPNKG-----------NIFNSVLLDFKQWQKILNEKKEEFTGDVLLSKYDTLKIIKHLQENWADIGLGIFNRHKS-LEGEMPSERQYMEEIIKNIQKLYKEYEIRINGDNGYSKILPSLISSLDFCSFKLEN----LEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVP-QHIDVDSVSV---LQAY-IFNMIQQWLLKIGNEINNGNIELQHHMDELHISMIQWMVNLLILMIPNFTDQDCLLKLEEESAEKHDIGVARLELDAIELTRKLYQYSSYLSSCCKGMVTAMALSKSTNSHKNATEDLYEVDKLKKECYEWINTCSCLLSNI 813          

HSP 2 Score: 112.849 bits (281), Expect = 3.316e-61
Identity = 83/274 (30.29%), Postives = 139/274 (50.73%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIP-AFLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K+N    SK     +   F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN++FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   34 LPELKEKKNMVDRSKLLPTSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 306          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 144.821 bits (364), Expect = 3.251e-59
Identity = 126/486 (25.93%), Postives = 237/486 (48.77%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDF-EDDYLSEQGQLIQPINQEETRKILNSVI----NWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEAR---RAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKL 2309
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+   + NA ++ EYHDLY  QR+R+E ++ +L  ERD W +A Y++   V+E   +  A  L   E      +++F+ L+S  D + L+ ++  T +W N   K    +   EE+    L    + + + +E F E D LS                I NSV+     W+K ++E  E F G  +L + + LK +K L   + DI + +FNRH++  +G +  E   + +I K I ++  ++  ++ GDNG +  + +L +  +    +L N    L F   P  EW      +++  + L    N  G      I V+  S+   L+ + I   +  W  K  + I + N++L+  +  L  SMI+W   +++ + P+F D     +    +A    +G+  L+  A  L   +   S+++ +C K +VT +
Sbjct:  243 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETLKIVKDGLIKWQEFFNEKDILSPN-----------KGNIFNSVLLDFKQWQKILNEKKEEFTGDVLLSKYDTLKIIKHLQENWADIGLGIFNRHKS-LEGEMPSERQYMEEIIKNIQKLYKEYEIRINGDNGYSKILPSLISSLDFCSFKLEN----LEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVP-QHIDVDSVSV---LQAY-IFNMIQQWLLKIGNEINNGNIELQHHMDELHISMIQWMVNLLILMIPNFTDQDCLLKLEEESAEKHDIGVARLELDAIELTRKLYQYSSYLSSCCKGMVTAM 707          

HSP 2 Score: 106.301 bits (264), Expect = 3.251e-59
Identity = 66/211 (31.28%), Postives = 116/211 (54.98%), Query Frame = 1
Query:  244 VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN++FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   31 VDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 240          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 113.235 bits (282), Expect = 2.508e-43
Identity = 83/274 (30.29%), Postives = 139/274 (50.73%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIP-AFLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K+N    SK     +   F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN++FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   34 LPELKEKKNMVDRSKLLPTSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 306          

HSP 2 Score: 84.7297 bits (208), Expect = 2.508e-43
Identity = 48/158 (30.38%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKF 1349
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+   + NA ++ EYHDLY  QR+R+E ++ +L  ERD W +A Y++   V+E   +  A  L   E      +++F+ L+S  D + L+ ++  T +W N   K 
Sbjct:  309 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKL 466          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 113.235 bits (282), Expect = 2.508e-43
Identity = 83/274 (30.29%), Postives = 139/274 (50.73%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIP-AFLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K+N    SK     +   F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN++FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   34 LPELKEKKNMVDRSKLLPTSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 306          

HSP 2 Score: 84.7297 bits (208), Expect = 2.508e-43
Identity = 48/158 (30.38%), Postives = 91/158 (57.59%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKF 1349
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+   + NA ++ EYHDLY  QR+R+E ++ +L  ERD W +A Y++   V+E   +  A  L   E      +++F+ L+S  D + L+ ++  T +W N   K 
Sbjct:  309 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKL 466          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Match: AXDND1 (axonemal dynein light chain domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26564])

HSP 1 Score: 53.5286 bits (127), Expect = 8.754e-8
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  172 FLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD 351
            F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD
Sbjct:   16 FIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYD 90          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Zebrafish
Match: axdnd1 (axonemal dynein light chain domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-050208-341])

HSP 1 Score: 160.614 bits (405), Expect = 2.094e-65
Identity = 176/763 (23.07%), Postives = 363/763 (47.58%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEK-INRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENW---ITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASI-NKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARL---ASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI----MELEYETQNKMRSEKDTEEMPFVKENSTIDKEKRIEENEIEDYDAGALIGNLLDNVINATSDLFLPEDDNDEDDKIMEVPIPPPTVEGIGVDYNVHSKMLIQDPNEPYSRNKFRNTEPINMPNDLPKTEEAYLLIKIFENLQKRLRSLTVEAMTVEDQCAKKELENEKSKRYLKSLEEIYEKRIIELEQLQTEKKQTLPTPALFNGTSAMERHLSESTNRSTTPKSVTSSKRR 3128
             +A++ LDRRLTEE+L F+N+++ L+ ELS +K H+EN+++  ++AK +L +A+EE++ NA+++ EYH+LYE QR+RLE  +  L+ ERD WR A Y +   +++  ++     L   E      +  F   ++  D++  S I   T +W +    F   L IR EN +  + K     I + ++ FE+    +       +++    ++   +  W K +++ CE +GG+ ++  +E L+ +K+L   + ++ +++F RH    DG   +   A+  + + I E ++Q   ++ G++G+   ++ L    E+W   +  LS    E         +W++ K  L   + L  E+   + +T+  S    G +I + ++E+ ++++++  +     +  + EN++LR+ + +L   MI W   ++L + P   D+      A  L    ++ + +L+E A+ +   +   S +I +  + I+ ++  I+  +  +  + +  +L +L +    W+E    LL ++     EL+   +   RS K+  E    KE     ++     +E E+  AG                       +D+D  ++++         IG D N+  K L +D  +       + TE + +     K ++A+  ++    LQ+ L ++   A+  E +  K E E + +   ++ LE   + R     + ++ KK    TP+    TS  +   ++S N  ++PK    +K+R
Sbjct:  300 TLAQRALDRRLTEEILHFKNSIASLNMELSAMKVHDENVSKEAEEAKEELAKALEESQRNANIVAEYHELYELQRKRLEGQMSHLDGERDLWRKATYSLAVKIIKINKLHLVRRLHISEQTWAKAADRFTFFLTAKDSEYFSHIMDLTNRWKDTLANFMQNL-IRVENKQREIIKSFHSNIVKWQKFFEE----KSRHPTMKVDKSSDEELSQDLREWSKVLTQQCERYGGEDLVSGQETLELLKKLQESWIEVCLDLFKRHTG-PDGGPPKGQEAMRGLKRTITEFLSQLGIRINGESGIHAMLMFLIDTMESWSRILNPLSGPPKEQAL-----GDWLKLKEALGSLVNLSEEALLLVDSTQ--SEQDRGKNIPHIKIEMEDVLKTMKEFLFSQENFFDCENMRLRDEVTSLHNKMIHWMVDLLLLMVPIHSDDQEPFLPAPELNIVVNVSVEKLEEDARNISTKLDYFSKYITSSCQAIIEEV--IRKSSNQDETENELYELAKLQKECGEWLEACRLLLMDVKGSSAELKLNGKVVPRSPKEQSEEHTEKEEPLDLEDANEPYDEYEEEKAGK----------------------HDKDGSVIKL---------IGHDGNITEKTLREDTVQ------LKGTEELVITPHTEKAQDAFSSLETIRTLQQELLAVETRAINSEVRALKAEEELQAALDKIQDLERQLQAR--PSVETKSSKKNAPKTPSKPVATSEAK---TKSQNPESSPKLSRGTKKR 1005          

HSP 2 Score: 110.538 bits (275), Expect = 2.094e-65
Identity = 67/214 (31.31%), Postives = 118/214 (55.14%), Query Frame = 1
Query:  253 VWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPF-EFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            VW   +RR+K+++  + P  + GAG D++FL D L ++       P+ N   +       +   L    E L P E+ +  ++G++ +Q YD+ FT      K      P M P+      ++ +    +L+K+G+NE F E    + + NLL  ++ EQ++YN+VFHEVI++ +++C ERG+LLA +RQ+Y  L  +IP ++K  H + L ++
Sbjct:   95 VWHHPVRRKKYQYFLNQPTSLTGAGRDISFLCDCLGSQKDALPVIPMANRRSALHHGDHNDTNPL----ETLIPEEYHIIKNKGLKGLQCYDDKFTVLLEDEKNKLRVFPSMKPSGRLEVVQLMKVMDKMLEKAGVNEEFQELTEISQIENLLELIQTEQNIYNIVFHEVIRQVSVECAERGQLLAKLRQKYVALLDRIPRQVKGLHTQTLAQR 304          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:Xenbase;Acc:XB-GENE-5920309])

HSP 1 Score: 124.02 bits (310), Expect = 5.489e-56
Identity = 78/299 (26.09%), Postives = 162/299 (54.18%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNG 1772
            ++A++ LDR LT+E++ F+N++  ++ EL  V++H+  +++   QA  +L +A+ E K NA++L EY +LYE QR RLE++++ L  ERD W +A Y I   V+E  ++  A  L  CE    ++ ++F+ +++ T  + L  I+  T  W      F   +   EE+ +  +      +++ ++ F+++    +    + I ++    +   +  W+  ++E  + F G  +L  +E L     +  ++T++  ++  RH++ +D  L  E  AL+D+   I ++  Q+  ++ G+NG
Sbjct:  293 LLAQRALDRCLTKEIMNFKNSIEDMTNELYQVREHDLRVSRDANQAHAELAKALSEAKKNANILDEYRELYELQRSRLEKHLVDLTEERDLWSSATYMIASKVIERNQLHLARKLCMCEKTWTNIIRHFIVMLASTSAKDLIQIQQITESWRGHMAHFDQDVQRNEESNREKMRLIQNDLDKWQQHFQENVFVHER--FEEIREDVIESVSQDLRKWDSMLNEELQQFEGCQLLSYQESLSTALDIQKQWTELGEKLLRRHQS-SDKDLPPEEKALVDMKGKIQQLCEQYRRRIEGENG 588          

HSP 2 Score: 116.316 bits (290), Expect = 5.489e-56
Identity = 78/253 (30.83%), Postives = 135/253 (53.36%), Query Frame = 1
Query:  136 THSKPAVKPIPAFLSDEILTNLQQCTNA-----LVCPHEGKV-----SNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPL--INXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKI 858
            THS   +     ++ +EIL  L   T+A     L    + KV      N W   +RR KF H+ + P+C+ GAG D++FL D + ++        L  I+ +    + + I+        E L P E+ +  ++G+  ++ +++ +TT     +      P + P+  S   ++ +    +L  +G++E  +   PT +HNLL  +K EQ++YN+VFHEVI++ +++C+ERGELLA +RQRY  LF KIP ++
Sbjct:   43 THS-GTISQHKDYIPEEILQILTSATSASHKLDLETRKDAKVCLRSTDNAWHHQLRRSKFNHLIEQPVCLKGAGRDISFLCDVILSDKRNRSVTSLQPISHKNDTSKEEGIQ--------ESLVPEEYYIVKNKGILGLEYHEDKYTTLLKDDEKKLRLFPSLKPSGRSEVLQLIKVMDSMLKDAGVDEDLKLEGPTPIHNLLELLKAEQNIYNIVFHEVIRQVSVECVERGELLAKLRQRYAMLFDKIPRQV 286          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Xenopus
Match: wsb1 (WD repeat and SOCS box containing 1 [Source:Xenbase;Acc:XB-GENE-5920309])

HSP 1 Score: 88.5817 bits (218), Expect = 6.437e-36
Identity = 38/84 (45.24%), Postives = 61/84 (72.62%), Query Frame = 1
Query:  640 VLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            +L  +G++E  +   PT +HNLL  +K EQ++YN+VFHEVI++ +++C+ERGELLA +RQRY  LF KIP ++   ++  L ++
Sbjct:   31 MLKDAGVDEDLKLEGPTPIHNLLELLKAEQNIYNIVFHEVIRQVSVECVERGELLAKLRQRYAMLFDKIPRQVLSLYNDLLAQR 114          

HSP 2 Score: 84.7297 bits (208), Expect = 6.437e-36
Identity = 74/299 (24.75%), Postives = 139/299 (46.49%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNG 1772
            ++A++ LDR LT+E++ F+N++  ++ EL  V++H+  +++   QA  +L +A+ E K NA++L EY +LYE QR RLE++++ L  ERD W +A Y                                  +I+    + L  I+  T  W      F   +   EE+ +       EK+  ++ D +           Q   QE +  +   ++N E    E C+      +L  +E L     +  ++T++  ++  RH++ +D  L  E  AL+D+   I ++  Q+  ++ G+NG
Sbjct:  110 LLAQRALDRCLTKEIMNFKNSIEDMTNELYQVREHDLRVSRDANQAHAELAKALSEAKKNANILDEYRELYELQRSRLEKHLVDLTEERDLWSSATY----------------------------------MIASKSAKDLIQIQQITESWRGHMAHFDQDVQRNEESNR-------EKMRLIQNDLDK---------WQQHFQENSAGVCYIMLNEELQQFEGCQ------LLSYQESLSTALDIQKQWTELGEKLLRRHQS-SDKDLPPEEKALVDMKGKIQQLCEQYRRRIEGENG 351          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 151.754 bits (382), Expect = 4.319e-65
Identity = 136/552 (24.64%), Postives = 258/552 (46.74%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLK-EDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARR------AARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIME-----LEYETQNKMRSEKDTEEMPF 2495
            +V ++++D+R+ +EL  F+N +  L++EL  V+ H+  + +  ++ +  L EA+ E + NA ++ +YHDLY  QR R+E ++  L  ERD W +A Y++   V+E   +  A  L   E      +++F+ ++S  D   L  ++  T +W     KF   +   EE+ K     EI K   +K ++F ++ L +   +I P  +      LN    +EK + E  E F G  +L   + LK +K+L   +TDI   + +RH++  DG L  EH  + DI K+I ++  ++  ++ GDNG++  +  L    +  + +L N    L +  +P  EW+     +++    L    N I +         GA++     +  I + +  W  K  + I +  ++L   +  +  +MI+W   ++  + PDF D     +R            +GI EL+  A  L + ++  S+++ +C   +V  +   +     + P  D   L ++      WI     L+ +I       L YE   K+  E++  ++ F
Sbjct:  306 LVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERTEESTKE--KSEIVKAGIIKWQEFFNNNLGK--DVIIPSKRSPFAVALNDFKEYEKMLEEEKEKFTGDFLLSRYDALKVIKRLQENWTDIGFGILSRHKS-MDGLLPPEHEYMEDIVKIISKLYREYEIRINGDNGISKVLPNLVISLDMCVFKLENF---LDYSQVPTEEWLEIDEKINEMKFHLEALLNIIDSVPEGMDMEPGAAL-----LEHICEMIQQWLLKLGNEITNGQIELLRHMDEMHIAMIQWMVNLLTIMLPDFTDQDILPKREESSLETPEEHEIGIAELEINAIALVKRLARYSSYLHSCCIGMVRAMALSRAAHLQKNPAKDRQDLERMNRECYDWISTCSHLISDIKGRKIRLLSYEEAEKLLGEEEASKLYF 844          

HSP 2 Score: 118.627 bits (296), Expect = 4.319e-65
Identity = 87/278 (31.29%), Postives = 144/278 (51.80%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIPAFLSD-----EILTNLQQCTNALVCPHE---------------GKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K++   H    +KP+P   +D     E+L +L    NA  CP                   V +VW   IRR+KFK++ D+P+ + GAG D++FLYD   +  E +E    P  N     + S  +  K    L + L P EF + ++ G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E   +  PT +H LL  +K+EQ +YN VFHE+I++ ++DC +RGELL+ IR++Y  +   I +++ EF+
Sbjct:   33 LPELKEKKSMVNH----LKPLPPLQNDYRIPEEVLLSLNYAANAGPCPESLLPVKKPKAPKCALPRLVDHVWQHPIRRDKFKYLIDHPVSLTGAGRDISFLYDVKYVKGEAVEKKLCP-PNKSTQSQSSAMVPHKE-KTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERAGI-ENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFY 303          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 149.058 bits (375), Expect = 2.446e-64
Identity = 135/544 (24.82%), Postives = 254/544 (46.69%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLK-EDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARR------AARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLL-----KEIMELEYETQNKMRSE 2471
            +V ++++D+R+ +EL  F+N +  L++EL  V+ H+  + +  ++ +  L EA+ E + NA ++ +YHDLY  QR R+E ++  L  ERD W +A Y++   V+E   +  A  L   E      +++F+ ++S  D   L  ++  T +W     KF   +   EE+ K     EI K   +K ++F ++ L +   +I P  +      LN    +EK + E  E F G  +L   + LK +K+L   +TDI   + +RH++  DG L  EH  + DI K+I ++  ++  ++ GDNG++  +  L    +  + +L N    L +  +P  EW+     +++    L    N I +         GA++     +  I + +  W  K  + I +  ++L   +  +  +MI+W   ++  + PDF D     +R            +GI EL+  A  L + ++  S+++ +C   +V  +   +     + P  D   L ++      WI     L+     ++I  L YE   K+  E
Sbjct:  306 LVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERTEESTKE--KSEIVKAGIIKWQEFFNNNLGK--DVIIPSKRSPFAVALNDFKEYEKMLEEEKEKFTGDFLLSRYDALKVIKRLQENWTDIGFGILSRHKS-MDGLLPPEHEYMEDIVKIISKLYREYEIRINGDNGISKVLPNLVISLDMCVFKLENF---LDYSQVPTEEWLEIDEKINEMKFHLEALLNIIDSVPEGMDMEPGAAL-----LEHICEMIQQWLLKLGNEITNGQIELLRHMDEMHIAMIQWMVNLLTIMLPDFTDQDILPKREESSLETPEEHEIGIAELEINAIALVKRLARYSSYLHSCCIGMVRAMALSRAAHLQKNPAKDRQDLERMNRECYDWISTCSHLISDIKGRKIRLLSYEEAEKLLGE 836          

HSP 2 Score: 118.627 bits (296), Expect = 2.446e-64
Identity = 87/278 (31.29%), Postives = 144/278 (51.80%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIPAFLSD-----EILTNLQQCTNALVCPHE---------------GKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K++   H    +KP+P   +D     E+L +L    NA  CP                   V +VW   IRR+KFK++ D+P+ + GAG D++FLYD   +  E +E    P  N     + S  +  K    L + L P EF + ++ G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E   +  PT +H LL  +K+EQ +YN VFHE+I++ ++DC +RGELL+ IR++Y  +   I +++ EF+
Sbjct:   33 LPELKEKKSMVNH----LKPLPPLQNDYRIPEEVLLSLNYAANAGPCPESLLPVKKPKAPKCALPRLVDHVWQHPIRRDKFKYLIDHPVSLTGAGRDISFLYDVKYVKGEAVEKKLCP-PNKSTQSQSSAMVPHKE-KTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERAGI-ENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFY 303          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 144.436 bits (363), Expect = 2.094e-60
Identity = 131/524 (25.00%), Postives = 250/524 (47.71%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLK-EDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARR------AARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKE 2426
            +V ++++D+R+ +EL  F+N +  L++EL  V+ H+  + +  ++ +  L EA+ E + NA ++ +YHDLY  QR R+E ++  L  ERD W +A Y++   V+E   +  A  L   E      +++F+ ++S  D   L  ++  T +W     KF   +   EE+ K     EI K   +K ++F ++ L +   +I P  +      LN    +EK + E  E F G  +L   + LK +K+L   +TDI   + +RH++  DG L  EH  + DI K+I ++  ++  ++ GDNG++  +  L    +  + +L N    L +  +P  EW+     +++    L    N I +         GA++     +  I + +  W  K  + I +  ++L   +  +  +MI+W   ++  + PDF D     +R            +GI EL+  A  L + ++  S+++ +C   +V  +   +     + P  D   L ++   S S  EK+ + +K+
Sbjct:  241 LVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYELALKVIERNRVILAKKLYLSEKGWNKYAKHFIIMLSTKDTGDLGMVEKLTEKWKKLVNKFKQDVERTEESTKE--KSEIVKAGIIKWQEFFNNNLGK--DVIIPSKRSPFAVALNDFKEYEKMLEEEKEKFTGDFLLSRYDALKVIKRLQENWTDIGFGILSRHKS-MDGLLPPEHEYMEDIVKIISKLYREYEIRINGDNGISKVLPNLVISLDMCVFKLENF---LDYSQVPTEEWLEIDEKINEMKFHLEALLNIIDSVPEGMDMEPGAAL-----LEHICEMIQQWLLKLGNEITNGQIELLRHMDEMHIAMIQWMVNLLTIMLPDFTDQDILPKREESSLETPEEHEIGIAELEINAIALVKRLARYSSYLHSCCIGMVRAMALSRAAHLQKNPAKDRQDLERMNGPSPSTNEKTIRYIKK 751          

HSP 2 Score: 110.153 bits (274), Expect = 2.094e-60
Identity = 70/211 (33.18%), Postives = 120/211 (56.87%), Query Frame = 1
Query:  244 VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            V +VW   IRR+KFK++ D+P+ + GAG D++FLYD   +  E +E    P  N     + S  +  K    L + L P EF + ++ G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E   +  PT +H LL  +K+EQ +YN VFHE+I++ ++DC +RGELL+ IR++Y  +   I +++ EF+
Sbjct:   31 VDHVWQHPIRRDKFKYLIDHPVSLTGAGRDISFLYDVKYVKGEAVEKKLCP-PNKSTQSQSSAMVPHKE-KTLADTLVPEEFHIVSNTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVVQLSNVMDTMLERAGI-ENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFY 238          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Mouse
Match: Axdnd1 (axonemal dynein light chain domain containing 1 [Source:MGI Symbol;Acc:MGI:1924602])

HSP 1 Score: 105.145 bits (261), Expect = 5.114e-23
Identity = 89/337 (26.41%), Postives = 162/337 (48.07%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLK-EDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWI 1883
            +V ++++D+R+ +EL  F+N +  L++EL  V+ H+  + +  ++ +  L EA+ E + NA ++ +YHDLY  QR R+E ++  L  ERD W +A Y++                                  ++ D   L  ++  T +W     KF   +   EE+ K     EI K   +K ++F ++ L +   +I P  +      LN    +EK + E  E F G  +L   + LK +K+L   +TDI   + +RH++  DG L  EH  + DI K+I ++  ++  ++ GDNG++  +  L    +  + +L N    L +  +P  EW+
Sbjct:  144 LVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYEL----------------------------------ALKDTGDLGMVEKLTEKWKKLVNKFKQDVERTEESTKE--KSEIVKAGIIKWQEFFNNNLGKD--VIIPSKRSPFAVALNDFKEYEKMLEEEKEKFTGDFLLSRYDALKVIKRLQENWTDIGFGILSRHKS-MDGLLPPEHEYMEDIVKIISKLYREYEIRINGDNGISKVLPNLVISLDMCVFKLENF---LDYSQVPTEEWL 438          

HSP 2 Score: 62.003 bits (149), Expect = 3.266e-9
Identity = 27/59 (45.76%), Postives = 44/59 (74.58%), Query Frame = 1
Query:  640 VLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIR 816
            +L+++G+ E   +  PT +H LL  +K+EQ +YN VFHE+I++ ++DC +RGELL+ IR
Sbjct:   36 MLERAGI-ENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIR 93          
BLAST of Sterol O-acyltransferase 1 vs. UniProt
Match: sp|Q95LP5|AXDN1_MACFA (Axonemal dynein light chain domain-containing protein 1 OS=Macaca fascicularis OX=9541 GN=AXDND1 PE=2 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 2.916e-61
Identity = 132/522 (25.29%), Postives = 248/522 (47.51%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDF-EDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEAR---RAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+ + + NA ++ EYHDLY  QR+R+E ++ QL  ERD W +A Y++   V+E   +  A  L   E      +++ + L++  D + L+ ++  T +W N   KF   +   EE+ +  L    + + + +E F E D LS       P N      ++     W+K ++E  E F G  +L + + LK +K L   +TDI + +FNRH++  +G L  E   + +I K I ++  ++  ++ GDNG +  +  L +  +    +L N    L F   P  EW      +++    L    N  G      I ++  S+   L+ + I   +  W  K  + I + N++L+  +  L  SMI+W   +++ + P+F D     +    +A    +G+  L+  A  L   +   S ++ +  + +VT +   K  T       D  ++ +L +    WI     LL  I
Sbjct:  308 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLDAEKNAKMVEEYHDLYTLQRERMENDMKQLMAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHLIILLANKDTEDLALLQKLTQKWRNLVNKFKQEVEEMEESTRETLKIVEKGLTKWQESFNEKDILS-------PNNGNVFDSVILDFKQWQKMLNEKKEEFTGDVLLSKYDTLKIIKHLQENWTDIGLGIFNRHKS-LEGELPSERQYMEEIIKNIQKLYKEYEIRINGDNGYSKILPILISSLDFCSFKLEN----LEFPDTPLEEWQEIDEKINEMKLQLDLLLNLTGIVP-QHIDMDSVSV---LQAY-IFNMIQQWLLKIGNEINNGNIELQRHMDELHISMIQWMVNLLILMIPNFTDQDCLLKLEEESAEKHDIGVARLELDAIELTRKLYQYSRYLSSSCEGMVTAMALSKSTTSHRNATEDLYEVDKLKKECYEWINTCSCLLSNI 812          

HSP 2 Score: 117.087 bits (292), Expect = 2.916e-61
Identity = 84/274 (30.66%), Postives = 139/274 (50.73%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPA-VKPIPAFLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K+N    SKP     +  F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN +FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   33 LPELKEKKNMVDRSKPLPTSLLNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVKYTKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNTIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 305          
BLAST of Sterol O-acyltransferase 1 vs. UniProt
Match: sp|Q5T1B0|AXDN1_HUMAN (Axonemal dynein light chain domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AXDND1 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.467e-60
Identity = 134/526 (25.48%), Postives = 250/526 (47.53%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDF-EDDYLSEQGQLIQPINQEETRKILNSVI----NWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEAR---RAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            +V ++++D+R+ EEL  F++ +  L++EL  V+ H+  + +  ++A   L +A+   + NA ++ EYHDLY  QR+R+E ++ +L  ERD W +A Y++   V+E   +  A  L   E      +++F+ L+S  D + L+ ++  T +W N   K    +   EE+    L    + + + +E F E D LS                I NSV+     W+K ++E  E F G  +L + + LK +K L   + DI + +FNRH++  +G +  E   + +I K I ++  ++  ++ GDNG +  + +L +  +    +L N    L F   P  EW      +++  + L    N  G      I V+  S+   L+ + I   +  W  K  + I + N++L+  +  L  SMI+W   +++ + P+F D     +    +A    +G+  L+  A  L   +   S+++ +C K +VT +   K     +    D  ++ +L +    WI     LL  I
Sbjct:  309 LVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILARRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSETLKIVKDGLIKWQEFFNEKDILSPNKG-----------NIFNSVLLDFKQWQKILNEKKEEFTGDVLLSKYDTLKIIKHLQENWADIGLGIFNRHKS-LEGEMPSERQYMEEIIKNIQKLYKEYEIRINGDNGYSKILPSLISSLDFCSFKLEN----LEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVP-QHIDVDSVSV---LQAY-IFNMIQQWLLKIGNEINNGNIELQHHMDELHISMIQWMVNLLILMIPNFTDQDCLLKLEEESAEKHDIGVARLELDAIELTRKLYQYSSYLSSCCKGMVTAMALSKSTNSHKNATEDLYEVDKLKKECYEWINTCSCLLSNI 813          

HSP 2 Score: 112.849 bits (281), Expect = 1.467e-60
Identity = 83/274 (30.29%), Postives = 139/274 (50.73%), Query Frame = 1
Query:  103 LPLLKFKENYSTHSKPAVKPIP-AFLSDEILTNLQQCTNALVCPH-----------EGK----VSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYD--KLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            LP LK K+N    SK     +   F+  E+L +L    NA  CP            +G     V +VW   +RR KFK++ D+P+ + GAG D++FLYD      +  E    P   +   +     I       L + L P EF + +  G+  ++ YD+ +TT     +   +  P M PN      ++      +L+++G+ E  E+  PT +H LL  +KKEQ +YN++FHE+I++ ++DC +RGELL+ +R+RY  +  +I  ++ +F+
Sbjct:   34 LPELKEKKNMVDRSKLLPTSLQNEFIPKEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSLTGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHIVSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGV-ENQEYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIARQMIDFY 306          
BLAST of Sterol O-acyltransferase 1 vs. UniProt
Match: sp|Q3UZ57|AXDN1_MOUSE (Axonemal dynein light chain domain-containing protein 1 OS=Mus musculus OX=10090 GN=Axdnd1 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.307e-36
Identity = 89/337 (26.41%), Postives = 162/337 (48.07%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLK-EDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWI 1883
            +V ++++D+R+ +EL  F+N +  L++EL  V+ H+  + +  ++ +  L EA+ E + NA ++ +YHDLY  QR R+E ++  L  ERD W +A Y++                                  ++ D   L  ++  T +W     KF   +   EE+ K     EI K   +K ++F ++ L +   +I P  +      LN    +EK + E  E F G  +L   + LK +K+L   +TDI   + +RH++  DG L  EH  + DI K+I ++  ++  ++ GDNG++  +  L    +  + +L N    L +  +P  EW+
Sbjct:   97 LVTQRMMDQRILQELYNFKNVIEELTRELCLVQAHDRKLTKEAEKVQKNLAEALLEAEKNAKIVEDYHDLYTMQRGRMESDIKLLMTERDIWSSATYEL----------------------------------ALKDTGDLGMVEKLTEKWKKLVNKFKQDVERTEESTKE--KSEIVKAGIIKWQEFFNNNLGKD--VIIPSKRSPFAVALNDFKEYEKMLEEEKEKFTGDFLLSRYDALKVIKRLQENWTDIGFGILSRHKS-MDGLLPPEHEYMEDIVKIISKLYREYEIRINGDNGISKVLPNLVISLDMCVFKLENF---LDYSQVPTEEWL 391          

HSP 2 Score: 70.8626 bits (172), Expect = 4.307e-36
Identity = 31/77 (40.26%), Postives = 55/77 (71.43%), Query Frame = 1
Query:  640 VLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            +L+++G+ E   +  PT +H LL  +K+EQ +YN VFHE+I++ ++DC +RGELL+ IR++Y  +   I +++ EF+
Sbjct:   19 MLERAGI-ENENYVGPTKMHQLLNVLKREQSIYNTVFHELIRQVSVDCADRGELLSKIREKYVQMLDHIAQQMIEFY 94          
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|17222219 (tr|A0A3S1BDY7|A0A3S1BDY7_ELYCH Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006097 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 5.396e-113
Identity = 169/519 (32.56%), Postives = 299/519 (57.61%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYL-SEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            V+A++ LDRRLT+EL+RF+ T+ +L+ EL+ VK+H+  + +  ++A+  L+ A+ E++ NA LL EYHDLYE QR+RLER V  L  ER+ W  AAY +   V E Y++  A  L   E   + ++ +F  L+S  D   L+ I++    W +  + F + L  RE+ +K  L      I    + F+  ++ +E G + +P + +  R +L+ + +W++++    + +GG ++L  +E+L  +++    +TD A++VF RHR   D   +Q+   +  +N+ +D+++TQF  +++G+NGVA  II LQ+  E W T++++        PLPD+EW      L++W+ L+ ++   +GT++ +    +G   +  ++IH++++    W+  +S+ I+SE+ KL E + +L   M+RW  QV+LRLAPD   NS EA   A L ++ I +L E  K L E+I A SN++  C   IV +  Q + D   E  D +   L +L    + WI  ++ L+ ++
Sbjct:  305 VMAQRALDRRLTDELMRFKGTIGVLTSELTDVKEHDRKVTKEAQKAQEDLRSALIESQKNASLLAEYHDLYELQRRRLERQVFMLSEEREVWSTAAYSLALKVTEEYQLNTAKRLQLSEKGWVKMANHFTILLSDRDTDLLTKIQSYVENWRDLIEDFNIALRQREDEMKESLKGVRTSIESTLKTFQTRFVDTENGSVRRP-DDDFVRTLLSGIKSWDEAIVRETDVYGGDNLLNSQEELAQIRREMDGWTDAALKVFGRHRG-PDNKTHQDQHNMNALNEEVDQLLTQFHHRISGENGVAGLIINLQSSLETWETKVTSHAQGTL--PLPDTEWGAIYQTLEEWLVLVQQAYEYVGTSQRDEDRQDGRP-HVSIDIHDVVRKTQKWATTASNSIDSEDAKLVEQVSSLHSEMVRWMVQVLLRLAPDKEGNSKEAAEMALLGTVSIPQLIEVVKTLFESIEAFSNYVTLCCNGIVMENTQARQDNNEENADHELKDLAKLRSECEDWIHTAQILMSQL 818          

HSP 2 Score: 144.05 bits (362), Expect = 5.396e-113
Identity = 79/220 (35.91%), Postives = 139/220 (63.18%), Query Frame = 1
Query:  247 SNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNM-----PTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            +NVW+   RR++FKH+ +N  C CGAG D++FLYD +P   +      +++    +K    + +K L +LP  L P E+ +  ++G+  I  + + ++TKP  H+ H +  P M P +     ++ Q+  ++LDK+G+N+    +M     PT +HNLL  +KKEQ++YNVVFHE+I++T+++C+ERGELLA +R +Y +L  K+P++I   H++ + ++
Sbjct:   96 ANVWNHK-RRDRFKHLLENTPCACGAGKDISFLYD-VPQSTVHPPKPDILDKSAVRKSDGALPNKPL-QLPNTLLPDEYHIVKNKGVVGIDYHADRYSTKPEDHEKHLVVFPSMKPGSRYEVLQLKQALANMLDKAGVND---LDMEGGSGPTQMHNLLDLIKKEQNIYNVVFHELIRQTSVECVERGELLAELRSKYSDLLNKVPQQIMSLHEEVMAQR 309          
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18207796 (tr|A0A267FB17|A0A267FB17_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017795g2 PE=4 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 4.648e-112
Identity = 176/521 (33.78%), Postives = 294/521 (56.43%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKR---LEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            V+A++ LDRRLTEELLRF+ T+ +L+ EL+ VKDH+  I+   +  + +L++A+EE K +ADLL EYH LYE QR RLE  V QL  ER+ W + AY +   V+E  ++     L   E     L+ +F  L+S  D + L+ ++     W  +   F   L +R+++ +  L K  E +  L+E+FED +L    +L Q +  E T ++L  +   E  +++   +FGG  ML  +E +  M++L   + D  V +F RHR E DG+ + E   +  ++ L++++M Q   +L G+NGVA G+I LQ   E W TRL + +       LP+ EW RF  L++DW+ L+ E+ +A+G+T       E    N+R   L+ + ++  V  W+ K +SGI+SE+ ++ E+   L   M+RW  Q +LRLAPD+P NS EA +AA +AS    EL  + K L E ++  + ++ +    IV+ ++  ++  + E  D +  +L +L   ++ W   +  +L+++
Sbjct:  317 VMAQRALDRRLTEELLRFKTTIGVLTAELADVKDHDRQISGEARATQEELRKALEEAKRSADLLGEYHGLYELQRARLEDQVSQLTEERELWSHTAYCLALKVMEETQLVSCKRLHAAEKAWQHLAGHFSVLLSERDTEDLARVQALVDTWREKVDVFVGHLRVRDDSSRKNLTKLRELVTGLQENFEDQFLDGPARLKQLLTAENTSQVLGKLRELEALLNKEANAFGGDVMLDLQESMASMRRLMLTWNDTCVTLFARHRAE-DGAEFPEKKTMSAVSSLVEKLMRQLNIRLIGENGVARGVINLQNILETWTTRLQSVLNTGKL--LPEQEWTRFYALIEDWLGLIDETISAVGST-----AKEDQPANQREPSLDPNMVVTEVGKWANKVASGIDSEDTRMTESAKQLHIGMLRWMIQSLLRLAPDYPGNSQEAHQAALMASATPEELLASFKELGEWLTKFTVYLADSCSVIVSGIVAQRMAVKDEDFDNEQAELIRLKTEARDWCHAATCILEDL 829          

HSP 2 Score: 140.584 bits (353), Expect = 4.648e-112
Identity = 78/232 (33.62%), Postives = 133/232 (57.33%), Query Frame = 1
Query:  241 KVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEI--------IEHFSDPLI-------NXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            K SNVW+   RREK KH++D+ IC+CGAG D++FLYD  P+ +             DP +         ++ ++   +  +    RLP+ L P EF +  ++ +  ++      +T+   H+ H +  P + P +     ++ ++F  +L   G++E FE   PT +H LL  VK+EQD+YNVVFHE+I++ T++C+ERG+LL+ +R RY  L  K+P ++K  HD+ + ++
Sbjct:   91 KPSNVWNYPKRREKLKHLTDSTICVCGAGKDISFLYDA-PSAVKSLEAKATATATEDPSLVREQARKQKQQRRRLQAQGGEPKEARLPDTLIPEEFHVVKNKAVVGLEYNPSDHSTQLEDHEKHLVMFPSLKPTSRWEVLQLSKTFDQMLASVGVDEEFEVTGPTQMHRLLDLVKREQDVYNVVFHELIRQVTVECVERGQLLSTLRGRYNLLLSKVPAQVKSLHDEVMAQR 321          
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18235358 (tr|A0A267FME5|A0A267FME5_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006576g2 PE=4 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 1.832e-111
Identity = 176/521 (33.78%), Postives = 293/521 (56.24%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKR---LEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            V+A++ LDRRLTEELLRF+ T+ +L+ EL  VKDH+  I+   +  + +L++A+EE K +ADLL EYH LYE QR RLE  V QL  ER+ W + AY +   V+E  ++     L   E     L+ +F  L+S  D + L+ ++     W  +   F   L +R+++ +  L K  E +  L+E+FED +L    +L Q +  E T ++L  +   E  +++   +FGG  ML  +E +  M++L   + D  V +F RHR E DG+ + E   +  ++ L++++M Q   +L G+NGVA G+I LQ   E W TRL + +       LP+ EW RF  L++DW+ L+ E+ +A+G+T       E    N+R   L+ + ++  V  W+ K +SGI+SE+ ++ E+   L   M+RW  Q +LRLAPD+P NS EA +AA +AS    EL  + K L E ++  + ++ +    IV+ ++  ++  + E  D +  +L +L   ++ W   +  +L+++
Sbjct:  325 VMAQRALDRRLTEELLRFKTTIGVLTAELVDVKDHDRQISGEARATQEELRKALEEAKRSADLLGEYHGLYELQRARLEDQVSQLTEERELWSHTAYCLALKVMEETQLVSCKRLHAAEKAWQHLAGHFSVLLSERDTEDLARVQALVDTWREKVDVFVGHLRVRDDSSRKNLTKLRELVTGLQENFEDQFLDGPARLKQLLTAENTSQVLGKLRELEALLNKEANAFGGDVMLDLQESMASMRRLMLTWNDTCVTLFARHRAE-DGAEFPEKKTMSAVSSLVEKLMRQLNIRLIGENGVARGVINLQNILETWTTRLQSVLNTGKL--LPEQEWTRFYALIEDWLGLIDETISAVGST-----AKEDQPANQREPSLDPNMVVTEVGKWANKVASGIDSEDTRMTESAKQLHIGMLRWMIQSLLRLAPDYPGNSQEAHQAALMASATPEELLASFKELGEWLTKFTVYLADSCSVIVSGIVAQRMAVKDEDFDNEQAELIRLKTEARDWCHAATCILEDL 837          

HSP 2 Score: 140.584 bits (353), Expect = 1.832e-111
Identity = 78/232 (33.62%), Postives = 133/232 (57.33%), Query Frame = 1
Query:  241 KVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEI--------IEHFSDPLI-------NXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            K SNVW+   RREK KH++D+ IC+CGAG D++FLYD  P+ +             DP +         ++ ++   +  +    RLP+ L P EF +  ++ +  ++      +T+   H+ H +  P + P +     ++ ++F  +L   G++E FE   PT +H LL  VK+EQD+YNVVFHE+I++ T++C+ERG+LL+ +R RY  L  K+P ++K  HD+ + ++
Sbjct:   99 KPSNVWNYPKRREKLKHLTDSTICVCGAGKDISFLYDA-PSAVKSLEAKATATATEDPSLVREQARKQKQQRRRLQAQGGEPKEARLPDTLIPEEFHVVKNKAVVGLEYNPSDHSTQLEDHEKHLVMFPSLKPTSRWEVLQLSKTFDQMLASVGVDEEFEVTGPTQMHRLLDLVKREQDVYNVVFHELIRQVTVECVERGQLLSTLRGRYNLLLSKVPAQVKSLHDEVMAQR 329          
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18200448 (tr|A0A267GIS2|A0A267GIS2_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008529g2 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 4.003e-111
Identity = 176/521 (33.78%), Postives = 293/521 (56.24%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKR---LEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEI 2429
            V+A++ LDRRLTEELLRF+ T+ +L+ EL  VKDH+  I+   +  + +L++A+EE K +ADLL EYH LYE QR RLE  V QL  ER+ W + AY +   V+E  ++     L   E     L+ +F  L+S  D + L+ ++     W  +   F   L +R+++ +  L K  E +  L+E+FED +L    +L Q +  E T ++L  +   E  +++   +FGG  ML  +E +  M++L   + D  V +F RHR E DG+ + E   +  ++ L++++M Q   +L G+NGVA G+I LQ   E W TRL + +       LP+ EW RF  L++DW++L+ E+  A+G+T       E    N+R   L+ + ++  V  W+ K +SGI+SE+ ++ E+   L   M+RW  Q +LRLAPD+P NS EA +AA +AS    EL  + K L E ++  + ++ +    IV+ ++  ++  + E  D +  +L +L   ++ W   +  +L+++
Sbjct:  323 VMAQRALDRRLTEELLRFKTTIGVLTAELVDVKDHDRQISGEARATQEELRKALEEAKRSADLLGEYHGLYELQRARLEDQVSQLTEERELWSHTAYCLALKVMEETQLVSCKRLHAAEKAWQHLAGHFSVLLSERDTEDLARVQALVDTWREKVDVFVGHLRVRDDSSRKNLTKLRELVTGLQENFEDQFLDGPARLKQLLTVENTSQVLGKLRELEALLNKEANAFGGDVMLDLQESMASMRRLMLTWNDTCVTLFARHRAE-DGAEFPEKKTMSAVSSLVEKLMRQLNIRLIGENGVARGVINLQNILETWTTRLQSVLNTGKL--LPEQEWTRFYALIEDWLSLIDETIAAVGST-----AKEDQPANQREPSLDPNMVVTEVGKWANKVASGIDSEDTRMTESAKQLHIGMLRWMIQSLLRLAPDYPGNSQEAHQAALMASATPEELLASFKELGEWLTKFTVYLADSCSVIVSGIVAQRMAVKDEDFDNEQAELIRLKTEARDWCHAATCILEDL 835          

HSP 2 Score: 140.584 bits (353), Expect = 4.003e-111
Identity = 78/232 (33.62%), Postives = 133/232 (57.33%), Query Frame = 1
Query:  241 KVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEI--------IEHFSDPLI-------NXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            K SNVW+   RREK KH++D+ IC+CGAG D++FLYD  P+ +             DP +         ++ ++   +  +    RLP+ L P EF +  ++ +  ++      +T+   H+ H +  P + P +     ++ ++F  +L   G++E FE   PT +H LL  VK+EQD+YNVVFHE+I++ T++C+ERG+LL+ +R RY  L  K+P ++K  HD+ + ++
Sbjct:   97 KPSNVWNYPKRREKLKHLTDSTICVCGAGKDISFLYDA-PSAVKSLEAKATATATEDPSLVREQARKQKQQRRRLQAQGGEPKEARLPDTLIPEEFHVVKNKAVVGLEYNPSDHSTQLEDHEKHLVMFPSLKPTSRWEVLQLSKTFDQMLASVGVDEEFEVTGPTQMHRLLDLVKREQDVYNVVFHELIRQVTVECVERGQLLSTLRGRYNLLLSKVPAQVKSLHDEVMAQR 327          
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18315927 (tr|A0A1I8GAA9|A0A1I8GAA9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 4.853e-110
Identity = 174/503 (34.59%), Postives = 285/503 (56.66%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKR---LEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQL 2375
            V+A++ LDRRLTEELLRF+ T+ +L+ EL  VKDH+  I+   +  + +L++A+EE K +ADLL EYH LYE QR RLE  V QL  ER+ W + AY +   V+E  ++     L   E     L+ +F  L+S  D + L+ ++     W  +   F   L +R+++ +  L K  E +  L+E+FED +L    +L Q +  E T ++L  +   E  +++   +FGG  ML  +E +  M++L   + D  V +F RHR E DG+ + E   +  ++ L++++M Q   +L G+NGVA G+I LQ   E W TRL + +     + LP+ EW RF  L++DW+ L+ E+ +A+G+T       E    N+R   L+ + ++  V  W+ K +SGI+SE+ ++ E+   L   M+RW  Q +LRLAPD+P NS EA +AA +AS    EL  + K L E ++  + ++ +    IV+ ++  ++  + E  D +  +L +L
Sbjct:  318 VMAQRALDRRLTEELLRFKTTIGVLTAELVDVKDHDRQISGEARATQEELRKALEEAKRSADLLGEYHGLYELQRARLEDQVSQLTEERELWSHTAYCLALKVMEETQLVSCKRLHAAEKAWQHLAGHFSVLLSERDTEDLARVQALVDTWREKVDVFVGHLRVRDDSSRKNLTKLRELVTGLQENFEDQFLDGPARLKQLLTAENTSQVLGKLRELEALLNKEANAFGGDVMLDLQESMASMRRLMLTWNDTCVTLFARHRAE-DGAEFPEKKTMSAVSSLVEKLMRQLNIRLIGENGVARGVINLQNILETWTTRLQSVLN--TGKLLPEQEWTRFYALIEDWLGLIDETISAVGST-----AKEDQPANQREPSLDPNMVVTEVGKWANKVASGIDSEDTRMTESAKQLHIGMLRWMIQSLLRLAPDYPGNSQEAHQAALMASATPEELLASFKELGEWLTKFTVYLADSCSVIVSGIVAQRMAVKDEDFDNEQAELIRL 812          

HSP 2 Score: 140.198 bits (352), Expect = 4.853e-110
Identity = 78/232 (33.62%), Postives = 133/232 (57.33%), Query Frame = 1
Query:  241 KVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEI--------IEHFSDPLI-------NXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            K SNVW+   RREK KH++D+ IC+CGAG D++FLYD  P+ +             DP +         ++ ++   +  +    RLP+ L P EF +  ++ +  ++      +T+   H+ H +  P + P +     ++ ++F  +L   G++E FE   PT +H LL  VK+EQD+YNVVFHE+I++ T++C+ERG+LL+ +R RY  L  K+P ++K  HD+ + ++
Sbjct:   92 KPSNVWNYPKRREKLKHLTDSTICVCGAGKDISFLYDA-PSAVKSLEAKATATATEDPSLVREQARKQKQQRRRLQAQGGEPKEARLPDTLIPEEFHVVKNKAVVGLEYNPSDHSTQLEDHEKHLVMFPSLKPTSRWEVLQLSKTFDQMLASVGVDEEFEVTGPTQMHRLLDLVKREQDVYNVVFHELIRQVTVECVERGQLLSTLRGRYNLLLSKVPAQVKSLHDEVMAQR 322          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Cavefish
Match: axdnd1 (axonemal dynein light chain domain containing 1 [Source:NCBI gene;Acc:103025755])

HSP 1 Score: 162.155 bits (409), Expect = 1.410e-67
Identity = 129/546 (23.63%), Postives = 268/546 (49.08%), Query Frame = 3
Query:  879 VARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREEN----LKTLLNKEIEKINRLKED--FEDDYLSE---QGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNS----PEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKI---DTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIMELEYETQNKMRS 2468
            +A++ LDRRL EE++ F+++++ L++ELS +++H+++++   ++A+ +L +A+E+++  +D++ EYH LYE QR+RLE  V  L  ERD W    Y I   V++   ++    L   E      + +F   ++  D++ L+ I   T QW      F   L   E N    ++T +   I K ++  ED     D  +E   +G+L + + Q            W   ++ +CE +GG+ +L  +E L  + +L   + ++ +++  RH    D    Q  + + +++  + E+  Q   ++ G++G+   +I+L    E W  +L + +       LP ++W+  ++ L  W+ L  ++   + +T+  S  ++  + + ++E+ E+  ++ ++    ++  + ENL L E + ++   + RW   ++L++ PD  D+     P     +    + +++L+E AK L + +   S +I    + IV + +Q  I   D + E        L ++      W+E  + LL +I     E Q   RS
Sbjct:  320 LAQRALDRRLMEEIICFKHSITQLNEELSKLREHDDHVSSQAEKAQEELAKALEQSRHKSDMVEEYHKLYEMQRKRLEGQVATLTEERDLWSKITYSIALKVVKLKNLQLVSRLHVSEQTWSRTADHFTRFLTTKDSEDLNHIMQLTDQWREHLTSFMKKLKEIERNQCEVIRT-IQSGIAKWHKFCEDNIRNPDMKNEKEPEGELCEDLKQ------------WSTELTRVCERYGGEDLLSFQEILNTLTELQAAWVEVFLKLVRRHLG-PDREPPQGQATMRELSGAVTELHKQLGTRVNGESGIHKQLISLGGAMELWTNKLQSLIGRNEV--LPATDWLELEMALGSWVRLSEKALLNVDSTQPESEKIK-QTPHTKIEVDEVFSTLRDFLSSQNNFFDYENLTLCEEVSSMHVLLTRWMVDLLLQMVPDRRDDQEPPLPTDTELSIFKDVSLQKLEEDAKNLSQKLYYFSKYITGSCQAIVEEEIQKNITHDDKENEL-----FHLSKIQRECAEWVEVCQILLSDITGHPVELQRTDRS 843          

HSP 2 Score: 115.931 bits (289), Expect = 1.410e-67
Identity = 68/223 (30.49%), Postives = 119/223 (53.36%), Query Frame = 1
Query:  253 VWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTT---------KPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFE-FNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            VW   + R+K++++ D P  + GAG D++FL D L  +       P+ +    +      +   +      L P E+ L  H+G+R +Q YDE FT          K FP          M P+    + ++ +   D+L+K+G+++ FE     + +H LL  V+ EQ+++N+VFHE+I++ +++C ERG+LLA +RQRY  L  +IP ++K  H + L ++
Sbjct:  114 VWHYSVARKKYQYLLDQPTSVTGAGRDISFLCDALAGQKQRIHLPPMTDRGSIQSHDVLKDSNSIG----TLIPEEYHLVKHKGLRGLQCYDEKFTVLLKDDENKFKIFP---------SMKPSGRLEAVQLMRVMDDMLEKAGVSQEFEELTGLSQMHGLLELVRVEQNIFNIVFHELIRQVSVECAERGQLLAKLRQRYVALLDRIPRQLKGLHTENLAQR 323          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003307.1 (pep scaffold:Pmarinus_7.0:GL477417:7150:25215:1 gene:ENSPMAG00000003022.1 transcript:ENSPMAT00000003307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 2.422e-39
Identity = 68/212 (32.08%), Postives = 112/212 (52.83%), Query Frame = 1
Query:  253 VWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLP-----EKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIR-QRYRNLFFKIPEKIKEFH 870
            VW    +R KF H++D P+C+ GAG +L FL D     + ++  D  I    + + +    D M++  P     E   P EF +  + G+  +QL D  +TT     + +  + P M P   +   ++ +     L+K G   P E   PT +H+LL  V++EQ +YN VFHEVI++ ++ C+ERG+LLA +R +RY +L  ++P  +   H
Sbjct:    6 VWHYPQQRSKFTHLTDQPVCLTGAGRNLAFLEDS-SYVLFKNLLDAYIMLMVASRLAST--DNMIVAQPKEVLSETFIPEEFHIIQNHGVVGLQLKDSKYTTYLEDDEKNMRTFPSMRPMARNEVVELTRVLDTWLEKLG---PMEIEGPTSIHSLLQLVQQEQCIYNAVFHEVIRQVSVQCMERGQLLAKLRWERYSSLLSRVPVLVAGLH 211          

HSP 2 Score: 77.411 bits (189), Expect = 2.422e-39
Identity = 47/158 (29.75%), Postives = 85/158 (53.80%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKF 1349
            V+A +   RRL E+L  FQ +V+ ++ ELS V++ +  +N   ++ +  LK  + E++ NA+LL EYH +Y   R RLE ++  L+RERD W +AA  +   + E   I     L        +++Q  + L+S  D   ++ +++  + W  +A + 
Sbjct:  214 VLATRAQHRRLMEQLTAFQTSVNRMASELSSVRERDGRVNAQAQREREDLKRVLNESRRNANLLEEYHSVYGLHRHRLESSMGVLQRERDGWASAALALASQLTEERSIVTVRRLRGHSQAWANVAQQHLLLLSNRDGSVVAEVRSLVSSWAEKAARL 371          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Nematostella
Match: EDO47152 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT0])

HSP 1 Score: 135.961 bits (341), Expect = 5.280e-65
Identity = 75/209 (35.89%), Postives = 123/209 (58.85%), Query Frame = 1
Query:  247 SNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPF-EFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFH 870
            +NVW+    REK KH+ + P C+CGAG D++FLYD +  +     +  L     S +R  +  D    ++P+ L P+E+ +  + G+  ++ +DE +TT    H+ H    P M P+      K+  +   +L ++G ++   E   PT +HNLL  VKKEQ++YNV F+E+I++ T++C ERGELLA++R+RY  L  +IP ++K  H
Sbjct:   47 ANVWNYPKGREKLKHLVEQPPCLCGAGKDISFLYDAVQEKQSPEVTKTLEKIPASVEREIQALDGS-SQIPDTLLPSEYHIVKNPGVMGLEFHDEKYTTYVHDHEDHLTVFPSMKPSGRQEVLKLKHAMASLLARAGADDDGKELTGPTQIHNLLELVKKEQNIYNVCFNEIIRQVTVECTERGELLADLRRRYSGLLDRIPRQVKSLH 254          

HSP 2 Score: 132.109 bits (331), Expect = 5.280e-65
Identity = 88/284 (30.99%), Postives = 152/284 (53.52%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEK----INRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDIN 1715
            V+A++ LDRRLTEEL+RF+ ++S L+ EL+ VK H+  + Q   +A+  L+EA+ E++ NA LL EYH LYE QR RL+  +  L  ERD W +AAY +   V + + +  A  L  CE     L+++F   +S  D+  ++T+         +   F  + AI   NL+    K I+     +    +  E D      + I  ++++        +  WE+  ++  E F G+ +L  E++L HM +   ++TD+A++VF RH+   +G  + +H  + ++N
Sbjct:  257 VIAQRALDRRLTEELVRFKASISALTGELASVKAHDREVTQQAIEAQRNLEEALHESEKNASLLSEYHGLYELQRNRLQAQIGSLTEERDLWGSAAYTLALKVTDKHSLNTAKKLHLCEKAWAKLARHFAIFLSEKDSIQVNTLLLPGILLLAQ-DNFMRIPAIISLNLEPNNAKRIKPFMICLVFANDSLETDVTIPSQKFISDLSED--------MKAWEEVFNQEAERFTGEVLLAREDELYHMNKQVDKWTDVALKVFGRHQT-PEGERWPQHIEMKELN 530          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Nematostella
Match: EDO32969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STJ9])

HSP 1 Score: 48.521 bits (114), Expect = 2.326e-6
Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 3
Query: 1059 DLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVEL 1271
             LL EYH LYE QR RL+  +  L  ERD W +AAY +   V + + +  A  L  CE ++      F  L
Sbjct:   23 SLLSEYHGLYELQRNRLQAQIGSLTEERDLWGSAAYTLALKVTDKHSLNTAKKLHLCEKSLGKARAPFRHL 93          
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Medaka
Match: ENSORLT00000010925.2 (pep primary_assembly:ASM223467v1:4:14252955:14257409:-1 gene:ENSORLG00000008702.2 transcript:ENSORLT00000010925.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.501e-17
Identity = 35/100 (35.00%), Postives = 61/100 (61.00%), Query Frame = 1
Query:  616 KIYQSFGDVLDKSGLNEPFE--------FNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK*LHEK 891
            ++ ++  D+L+K+G++   E           P  L  L   VK EQ++YN VFHE+I++ T+ C E+G++LA +RQRY+ L  +IP ++K  H + + +K
Sbjct:  148 ELMKNMDDMLEKAGVDRQNEELSQLSQVGPAPLWLTGL---VKVEQNIYNTVFHELIRQVTVGCAEKGQVLAKLRQRYQALLDRIPRRLKALHTETVAQK 244          

HSP 2 Score: 41.5874 bits (96), Expect = 2.501e-17
Identity = 30/100 (30.00%), Postives = 50/100 (50.00%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKIT 1175
             VA+K L RRLTEE+ R ++++   S E+            + K +  +L   + +      +L+ YH+LYE  R RLE  +LQ+  ER+ W    + + 
Sbjct:  240 TVAQKSLGRRLTEEIHRIKSSLHRRSAEI------------LYKNSNCEL---LNDWDPFLSVLQRYHELYELLRTRLEAQLLQMTEERNNWSKLTFSLA 324          
BLAST of Sterol O-acyltransferase 1 vs. Planmine SMEST
Match: SMESG000039900.1 (SMESG000039900.1)

HSP 1 Score: 1551.57 bits (4016), Expect = 0.000e+0
Identity = 760/762 (99.74%), Postives = 761/762 (99.87%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIMELEYETQNKMRSEKDTEEMPFVKENSTIDKEKRIEENEIEDYDAGALIGNLLDNVINATSDLFLPEDDNDEDDKIMEVPIPPPTVEGIGVDYNVHSKMLIQDPNEPYSRNKFRNTEPINMPNDLPKTEEAYLLIKIFENLQKRLRSLTVEAMTVEDQCAKKELENEKSKRYLKSLEEIYEKRIIELEQLQTEKKQTLPTPALFNGTSAMERHLSESTNRSTTPKSVTSSKRRAPPHSKRNLKK 3161
            VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMM QFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKV+HENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIMELEYETQNKMRSEKDTEEMPFVKENSTIDKEKRIEENEIEDYDAGALIGNLLDNVINATSDLFLPEDDNDEDDKIMEVPIPPPTVEGIGVDYNVHSKMLIQDPNEPYSRNKFRNTEPINMPNDLPKTEEAYLLIKIFENLQKRLRSLTVEAMTVEDQCAKKELENEKSKRYLKSLEEIYEKRIIELEQLQTEKKQTLPTPALFNGTSAMERHLSESTNRSTTPKSVTSSKRRAPPHSKRNLKK
Sbjct:  273 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLLNKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSEICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEHSALLDINKLIDEMMRQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVAELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINKRLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILRLAPDFPDNSPEARRAARLASLGIRELQETAKVIHENISAVSNHIFNCSKDIVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIMELEYETQNKMRSEKDTEEMPFVKENSTIDKEKRIEENEIEDYDAGALIGNLLDNVINATSDLFLPEDDNDEDDKIMEVPIPPPTVEGIGVDYNVHSKMLIQDPNEPYSRNKFRNTEPINMPNDLPKTEEAYLLIKIFENLQKRLRSLTVEAMTVEDQCAKKELENEKSKRYLKSLEEIYEKRIIELEQLQTEKKQTLPTPALFNGTSAMERHLSESTNRSTTPKSVTSSKRRAPPHSKRNLKK 1034          

HSP 2 Score: 503.827 bits (1296), Expect = 1.692e-160
Identity = 270/272 (99.26%), Postives = 270/272 (99.26%), Query Frame = 1
Query:   61 MEELSIDNVLIKNRLPLLKFKENYSTHSKPAVKPIPAFLSDEILTNLQQCTNALVCPHEGKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINXXXXXXXXXXIEDKMLMRLPEKLDPAEFTLSTHQGMREIQLYDESFTTKPFPHKYHKXXXXXXXXXXXXXXXKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK 876
            MEELSIDNVLIKNRLPLLKFKENYSTHSKPAVKPIPAFLSDEILTNLQQCTNALVCPHEGKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINSEKSKKRSKKIEDKMLMRLPEKL PAEFTLSTHQGMR IQLYDESFTTKPFPHKYHKISLPIMNPNNISNSNKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK
Sbjct:    1 MEELSIDNVLIKNRLPLLKFKENYSTHSKPAVKPIPAFLSDEILTNLQQCTNALVCPHEGKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLPNEIIEHFSDPLINSEKSKKRSKKIEDKMLMRLPEKLVPAEFTLSTHQGMRAIQLYDESFTTKPFPHKYHKISLPIMNPNNISNSNKIYQSFGDVLDKSGLNEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEFHDK 272          
BLAST of Sterol O-acyltransferase 1 vs. Planmine SMEST
Match: SMESG000011832.1 (SMESG000011832.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.797e-12
Identity = 36/145 (24.83%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  876 VVARKILDRRLTEELLRFQNTVSMLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQQRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMISLSQYFVELISVTDNQTLSTIK 1310
            V  + + D+ LT ++  FQ  +  L+++L  VK+ +  + +  +    +L+ A++++  + +LL EYH LY+ Q+QRL++++  +  E++ W + A+ ++  + +   +  +  L      +  LSQ+F   IS  D    S I+
Sbjct:  222 VKDQTVKDKNLTTQIAEFQMAIRYLTEQLKEVKERDIKVTENAENIHKELESALQDSSRSKELLNEYHVLYDLQKQRLDKHLTVVNNEKEDWSSLAFALSLKISDESLLNTSKRLRLITKKLFQLSQHFAIYISDCDTVLTSKIQ 366          

HSP 2 Score: 35.039 bits (79), Expect = 3.797e-12
Identity = 11/45 (24.44%), Postives = 29/45 (64.44%), Query Frame = 1
Query:  733 LYNVVFHEVIKETTIDCIERGELLANIRQRYRNLFFKIPEKIKEF 867
            +YN++FHE+ ++      +RG ++  +R +Y +L  ++P+++ + 
Sbjct:  174 IYNIIFHELARQIMSSSEQRGNVVLELRNKYMDLVCQLPKELSKL 218          
The following BLAST results are available for this feature:
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AXDND13.316e-6125.48axonemal dynein light chain domain containing 1 [S... [more]
AXDND13.251e-5925.93axonemal dynein light chain domain containing 1 [S... [more]
AXDND12.508e-4330.29axonemal dynein light chain domain containing 1 [S... [more]
AXDND12.508e-4330.29axonemal dynein light chain domain containing 1 [S... [more]
AXDND18.754e-836.00axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
axdnd12.094e-6523.07axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
wsb15.489e-5626.09WD repeat and SOCS box containing 1 [Source:Xenbas... [more]
wsb16.437e-3645.24WD repeat and SOCS box containing 1 [Source:Xenbas... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Axdnd14.319e-6524.64axonemal dynein light chain domain containing 1 [S... [more]
Axdnd12.446e-6424.82axonemal dynein light chain domain containing 1 [S... [more]
Axdnd12.094e-6025.00axonemal dynein light chain domain containing 1 [S... [more]
Axdnd15.114e-2326.41axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q95LP5|AXDN1_MACFA2.916e-6125.29Axonemal dynein light chain domain-containing prot... [more]
sp|Q5T1B0|AXDN1_HUMAN1.467e-6025.48Axonemal dynein light chain domain-containing prot... [more]
sp|Q3UZ57|AXDN1_MOUSE4.307e-3626.41Axonemal dynein light chain domain-containing prot... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|172222195.396e-11332.56tr|A0A3S1BDY7|A0A3S1BDY7_ELYCH Uncharacterized pro... [more]
gnl|BL_ORD_ID|182077964.648e-11233.78tr|A0A267FB17|A0A267FB17_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182353581.832e-11133.78tr|A0A267FME5|A0A267FME5_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182004484.003e-11133.78tr|A0A267GIS2|A0A267GIS2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183159274.853e-11034.59tr|A0A1I8GAA9|A0A1I8GAA9_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
axdnd11.410e-6723.63axonemal dynein light chain domain containing 1 [S... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003307.12.422e-3932.08pep scaffold:Pmarinus_7.0:GL477417:7150:25215:1 ge... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO471525.280e-6535.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329692.326e-638.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000010925.22.501e-1735.00pep primary_assembly:ASM223467v1:4:14252955:142574... [more]
back to top
BLAST of Sterol O-acyltransferase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000039900.11.692e-16099.74SMESG000039900.1[more]
SMESG000011832.13.797e-1224.83SMESG000011832.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013721 ID=SMED30013721|Name=Sterol O-acyltransferase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3386bp
ATTTAACATAAAACCAAAAAAATTTTAAATATTTTTAATTGTTGGTTTCT
TCATAGTATAATGGAAGAGTTGTCAATAGATAATGTTCTAATAAAGAATC
GATTGCCGTTATTAAAATTCAAAGAGAATTATTCCACACATTCGAAACCA
GCTGTTAAACCTATACCAGCCTTTCTATCAGATGAAATACTTACTAATCT
CCAGCAATGTACGAATGCATTAGTTTGTCCCCATGAAGGAAAAGTATCAA
ATGTTTGGTCCAGCGTAATACGAAGAGAGAAATTTAAGCATATATCTGAT
AATCCGATTTGCATATGCGGAGCTGGAAACGATTTGACATTTCTCTACGA
CAAATTACCGAATGAAATTATTGAACATTTTTCTGACCCATTGATAAATT
CTGAGAAATCTAAAAAGCGATCGAAAAAAATCGAAGATAAAATGCTTATG
AGACTTCCGGAAAAGTTAGATCCAGCTGAGTTCACTCTGTCAACTCATCA
AGGAATGAGGGAGATTCAACTTTATGACGAAAGTTTTACCACAAAGCCAT
TTCCACACAAATATCATAAAATTTCTTTACCAATAATGAATCCAAATAAT
ATCTCTAACTCCAATAAGATATATCAAAGTTTTGGTGATGTTCTTGATAA
AAGTGGTCTCAATGAGCCGTTTGAATTCAATATGCCGACTGTGCTTCATA
ATTTGTTGATGACTGTGAAAAAAGAACAGGATCTATATAATGTCGTTTTT
CATGAAGTTATCAAAGAAACGACCATTGACTGTATTGAGCGTGGAGAATT
GCTAGCAAATATTAGACAGAGATACAGGAATTTATTTTTTAAGATTCCCG
AGAAAATTAAAGAATTTCATGATAAGTAGTTGCACGAAAAATTTTGGATC
GTCGTTTAACCGAAGAACTGCTACGGTTTCAGAATACCGTATCTATGCTA
TCCAAAGAGCTTTCGGGTGTGAAAGACCACGAGGAGAATATTAATCAAAT
ATGCAAGCAAGCTAAATTGCAATTGAAAGAAGCAGTTGAAGAAACGAAAA
CGAATGCCGATTTATTAAGAGAATATCATGATCTGTATGAGCAGCAGCGA
CAGAGATTGGAGAGGAACGTTTTGCAGCTGGAAAGAGAAAGAGATTGTTG
GAGGAATGCAGCGTATAAAATTACTCAATTAGTTCTTGAACATTACGAAA
TTAAACCCGCCATTGTTCTTGTTGAATGTGAATCCAATATGATTTCCTTG
AGCCAATATTTTGTCGAACTAATTTCGGTTACCGACAACCAAACTCTGTC
TACCATTAAAACAAAAACTACTCAATGGTGCAATGAAGCTCAAAAGTTCG
CATTAATGTTGGCAATTCGAGAAGAAAATCTAAAGACCCTTTTAAACAAA
GAAATTGAAAAAATTAATCGTTTGAAAGAAGATTTTGAAGATGATTATTT
AAGTGAACAAGGACAACTGATACAGCCTATAAATCAAGAAGAAACTCGTA
AAATATTAAATAGTGTTATAAATTGGGAAAAATCAATGTCTGAAATTTGT
GAAAGTTTTGGTGGTCAAAGCATGCTGATGGAAGAAGAAAAACTTAAGCA
TATGAAACAGTTATGCTACGAATATACCGATATTGCTGTCGAAGTTTTTA
ATAGACATCGGAATGAAACTGACGGATCTTTATATCAGGAGCATTCTGCG
TTATTGGATATAAATAAATTGATTGATGAGATGATGACACAATTTATGGA
CCAGTTGACTGGAGATAACGGAGTTGCTGACGGAATAATCGCTCTTCAAA
CTTTCGAAGAAAATTGGATAACTCGATTATCTAATTCTGTAGCTGAATTG
TATTTTCGCCCTCTTCCAGATTCGGAATGGATCCGATTCAAATTGTTGCT
TGATGATTGGATAGCTCTTCTCTGTGAATCTAAAAATGCAATTGGCACTA
CTAAATTGAATTCAATTACAGTGGAGGGAGCTTCAATTAATAAAAGATTA
GAAATTCATGAAATCATTCAGTCGGTTGATAACTGGAGTCAGAAATCTTC
TTCGGGAATTGAGAGTGAAAATTTGAAACTGCGAGAAGCAATAATTAATT
TGAAGAAAAGCATGATACGCTGGACATCTCAAGTGATATTGCGATTGGCG
CCAGATTTTCCTGACAATTCTCCTGAAGCTAGACGAGCAGCTCGATTGGC
TTCATTGGGTATCAGGGAACTGCAAGAAACTGCAAAGGTTCTTCATGAGA
ACATTTCAGCAGTGTCGAATCACATTTTTAATTGCTCCAAGGACATTGTC
ACCAAACTGATGCAGATCAAAATTGATACCCAGACGGAATTTCCTGACGG
GGACAGCTTGAAACTTCATCAACTAATAGAGTTTTCAAAGTCTTGGATTG
AAAAATCCGAGCAGTTGTTGAAAGAGATAATGGAATTAGAATACGAAACG
CAAAATAAGATGAGGAGTGAAAAGGATACCGAAGAAATGCCGTTTGTTAA
AGAAAATTCGACCATTGATAAAGAAAAACGAATTGAAGAGAATGAAATCG
AAGACTATGATGCTGGTGCTCTTATTGGAAATCTTCTCGATAATGTCATT
AATGCCACAAGTGATTTATTTCTTCCTGAGGATGACAATGACGAAGACGA
TAAAATTATGGAAGTACCCATTCCTCCGCCGACAGTTGAAGGAATAGGAG
TAGACTATAATGTCCATTCGAAAATGCTAATTCAAGATCCCAATGAGCCA
TACTCTAGGAATAAATTCCGAAATACCGAGCCAATAAATATGCCAAATGA
TTTACCAAAAACCGAAGAGGCATATCTATTGATCAAAATATTTGAAAATT
TACAAAAACGGCTCAGATCTCTTACAGTAGAAGCAATGACAGTTGAAGAT
CAATGTGCAAAGAAAGAATTGGAAAATGAGAAATCCAAAAGATATCTCAA
ATCATTGGAAGAGATTTATGAGAAGCGTATTATAGAATTGGAACAATTGC
AAACCGAAAAAAAACAAACACTGCCGACTCCTGCTTTATTTAATGGAACA
AGCGCCATGGAGCGGCATTTGTCTGAATCCACCAATCGCAGCACAACTCC
AAAATCTGTAACAAGCAGCAAGCGTCGAGCCCCGCCACACTCAAAACGAA
ACCTTAAAAAATAAAATGATTAAATTTATTTTATTGTTTCGTTTCAATGT
TTTTGACAGATTCATTACAATTTAATTAATTTGATTTTCGGTTTAAATAA
TTTCACTTTGATCGCTCTGTAAATTTTTGGACTTTATGAGTCACAGAAAA
TTTTAATTTAGCATGATAATAAATAATTTCCCCGAGGTTCGAGCGGACAG
TTTTATTTGGGTTATTAATTAAATTTTATTAATGAA
back to top

protein sequence of SMED30013721-orf-1

>SMED30013721-orf-1 ID=SMED30013721-orf-1|Name=SMED30013721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=273bp
MEELSIDNVLIKNRLPLLKFKENYSTHSKPAVKPIPAFLSDEILTNLQQC
TNALVCPHEGKVSNVWSSVIRREKFKHISDNPICICGAGNDLTFLYDKLP
NEIIEHFSDPLINSEKSKKRSKKIEDKMLMRLPEKLDPAEFTLSTHQGMR
EIQLYDESFTTKPFPHKYHKISLPIMNPNNISNSNKIYQSFGDVLDKSGL
NEPFEFNMPTVLHNLLMTVKKEQDLYNVVFHEVIKETTIDCIERGELLAN
IRQRYRNLFFKIPEKIKEFHDK*
back to top

protein sequence of SMED30013721-orf-2

>SMED30013721-orf-2 ID=SMED30013721-orf-2|Name=SMED30013721-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=740bp
MLSKELSGVKDHEENINQICKQAKLQLKEAVEETKTNADLLREYHDLYEQ
QRQRLERNVLQLERERDCWRNAAYKITQLVLEHYEIKPAIVLVECESNMI
SLSQYFVELISVTDNQTLSTIKTKTTQWCNEAQKFALMLAIREENLKTLL
NKEIEKINRLKEDFEDDYLSEQGQLIQPINQEETRKILNSVINWEKSMSE
ICESFGGQSMLMEEEKLKHMKQLCYEYTDIAVEVFNRHRNETDGSLYQEH
SALLDINKLIDEMMTQFMDQLTGDNGVADGIIALQTFEENWITRLSNSVA
ELYFRPLPDSEWIRFKLLLDDWIALLCESKNAIGTTKLNSITVEGASINK
RLEIHEIIQSVDNWSQKSSSGIESENLKLREAIINLKKSMIRWTSQVILR
LAPDFPDNSPEARRAARLASLGIRELQETAKVLHENISAVSNHIFNCSKD
IVTKLMQIKIDTQTEFPDGDSLKLHQLIEFSKSWIEKSEQLLKEIMELEY
ETQNKMRSEKDTEEMPFVKENSTIDKEKRIEENEIEDYDAGALIGNLLDN
VINATSDLFLPEDDNDEDDKIMEVPIPPPTVEGIGVDYNVHSKMLIQDPN
EPYSRNKFRNTEPINMPNDLPKTEEAYLLIKIFENLQKRLRSLTVEAMTV
EDQCAKKELENEKSKRYLKSLEEIYEKRIIELEQLQTEKKQTLPTPALFN
GTSAMERHLSESTNRSTTPKSVTSSKRRAPPHSKRNLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR019347Axonemal_dynein_light_chain
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane