Caspase-3

Overview
NameCaspase-3
Smed IDSMED30013706
Length (bp)910
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Caspase-3 (SMED30013706) t-SNE clustered cells

Violin plots show distribution of expression levels for Caspase-3 (SMED30013706) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Caspase-3 (SMED30013706) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Caspase-3 (SMED30013706) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013706

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30013706SMESG000053166.1 dd_Smed_v4_4986_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013706SMESG000053166.1 dd_Smed_v4_4986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013706SMESG000053166.1 dd_Smed_v4_4986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013706SMESG000053166.1 dd_Smed_v4_4986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the whole animalSMED30013706SMESG000053166.1 dd_Smed_v4_4986_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Caspase-3 vs. Ensembl Human
Match: CASP3 (caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504])

HSP 1 Score: 209.149 bits (531), Expect = 8.282e-66
Identity = 103/234 (44.02%), Postives = 144/234 (61.54%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ LC IINN+ F  +  M +R+GT VD   L++ F  L ++V N  +    EI   ++ +S+    K  S  V ++LSHG EG I+GT+GPVDL +I  +F+G +CR L GKPK+F+IQACRG + D G+  D  + + +   KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:   43 EMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSF-VCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. Ensembl Human
Match: CASP3 (caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504])

HSP 1 Score: 209.149 bits (531), Expect = 8.282e-66
Identity = 103/234 (44.02%), Postives = 144/234 (61.54%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ LC IINN+ F  +  M +R+GT VD   L++ F  L ++V N  +    EI   ++ +S+    K  S  V ++LSHG EG I+GT+GPVDL +I  +F+G +CR L GKPK+F+IQACRG + D G+  D  + + +   KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:   43 EMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSF-VCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. Ensembl Human
Match: CASP7 (caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508])

HSP 1 Score: 187.578 bits (475), Expect = 2.285e-57
Identity = 100/238 (42.02%), Postives = 138/238 (57.98%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            K+  C IINN+ F     M  RNGT  D + L + F  LGF V  Y +   +++   LK+ S+ ++  + +    I+LSHG E  IYG DG   +  +  +F+G +C+ LL KPK+F IQACRG + D G+ AD     D  +N   KIP+EADFL  YSTV GY+SWR+   GSW++Q+LC  LE   K  E++QIL  VN+ VA  ++S S       K QIP  V ML K L+ +
Sbjct:   41 KLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASE-EDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 277          
BLAST of Caspase-3 vs. Ensembl Human
Match: CASP7 (caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508])

HSP 1 Score: 187.963 bits (476), Expect = 3.297e-57
Identity = 100/238 (42.02%), Postives = 138/238 (57.98%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            K+  C IINN+ F     M  RNGT  D + L + F  LGF V  Y +   +++   LK+ S+ ++  + +    I+LSHG E  IYG DG   +  +  +F+G +C+ LL KPK+F IQACRG + D G+ AD     D  +N   KIP+EADFL  YSTV GY+SWR+   GSW++Q+LC  LE   K  E++QIL  VN+ VA  ++S S       K QIP  V ML K L+ +
Sbjct:   66 KLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASE-EDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 302          
BLAST of Caspase-3 vs. Ensembl Human
Match: CASP7 (caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508])

HSP 1 Score: 187.963 bits (476), Expect = 3.297e-57
Identity = 100/238 (42.02%), Postives = 138/238 (57.98%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            K+  C IINN+ F     M  RNGT  D + L + F  LGF V  Y +   +++   LK+ S+ ++  + +    I+LSHG E  IYG DG   +  +  +F+G +C+ LL KPK+F IQACRG + D G+ AD     D  +N   KIP+EADFL  YSTV GY+SWR+   GSW++Q+LC  LE   K  E++QIL  VN+ VA  ++S S       K QIP  V ML K L+ +
Sbjct:   66 KLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASE-EDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFS 302          
BLAST of Caspase-3 vs. Ensembl Celegans
Match: ced-3 (Cell death protein 3 Cell death protein 3 subunit p17 Cell death protein 3 subunit p15 Cell death protein 3 subunit p13 [Source:UniProtKB/Swiss-Prot;Acc:P42573])

HSP 1 Score: 120.939 bits (302), Expect = 3.816e-32
Identity = 78/259 (30.12%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADD-------FLSNSIE----------------------KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +C IINNE F+    M  RNGT  D   L  +F  +G+ V    N     +   ++  ++ +   D ++LV  ILSHG E  I G D  P+    I+          L  KPK+  +QACRG++ D+G    D       FL    +                      K P +AD LI Y+T A Y SWRN   GSW+IQ++C+     +K  +++++L  VN  VA  +Q+    + S+   Q+P     L K  + 
Sbjct:   28 MCLIINNEHFE---QMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILV--ILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQT---SQGSNILKQMPEMTSRLLKKFYF 278          
BLAST of Caspase-3 vs. Ensembl Celegans
Match: ced-3 (Cell death protein 3 Cell death protein 3 subunit p17 Cell death protein 3 subunit p15 Cell death protein 3 subunit p13 [Source:UniProtKB/Swiss-Prot;Acc:P42573])

HSP 1 Score: 121.709 bits (304), Expect = 4.315e-31
Identity = 78/259 (30.12%), Postives = 117/259 (45.17%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADD-------FLSNSIE----------------------KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +C IINNE F+    M  RNGT  D   L  +F  +G+ V    N     +   ++  ++ +   D ++LV  ILSHG E  I G D  P+    I+          L  KPK+  +QACRG++ D+G    D       FL    +                      K P +AD LI Y+T A Y SWRN   GSW+IQ++C+     +K  +++++L  VN  VA  +Q+    + S+   Q+P     L K  + 
Sbjct:  244 MCLIINNEHFE---QMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILV--ILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQT---SQGSNILKQMPEMTSRLLKKFYF 494          
BLAST of Caspase-3 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 109.383 bits (272), Expect = 5.480e-28
Identity = 80/244 (32.79%), Postives = 118/244 (48.36%), Query Frame = 1
Query:   97 DMVDGK---ESEIYEISKIKLC--FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGK-PKVFLIQACRGDKYDHGVIADDFLSNSIEKIP-----------------IEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQS 756
            D  DGK   E+  Y  ++   C   IINN  F     M  R G+  D K+L ++F +LG++  +Y N KSSEI   ++Q +Q         L++ I+SHG +G +YG DG PV +  I        C   L K PK  +   CRGD+ D  V  D F+ N  ++ P                  +AD L+ +ST  G+ S+R+   G+WYIQ L   +   +K   L  +L+  N  V EKY++
Sbjct:    5 DASDGKKIDETRKYRNNRSSKCRAIIINNVVF---CGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDS---LIITIMSHGDQGLLYGVDGVPVQMLDIIDLM----CTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYEA 238          
BLAST of Caspase-3 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 110.538 bits (275), Expect = 7.654e-27
Identity = 80/244 (32.79%), Postives = 118/244 (48.36%), Query Frame = 1
Query:   97 DMVDGK---ESEIYEISKIKLC--FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGK-PKVFLIQACRGDKYDHGVIADDFLSNSIEKIP-----------------IEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQS 756
            D  DGK   E+  Y  ++   C   IINN  F     M  R G+  D K+L ++F +LG++  +Y N KSSEI   ++Q +Q         L++ I+SHG +G +YG DG PV +  I        C   L K PK  +   CRGD+ D  V  D F+ N  ++ P                  +AD L+ +ST  G+ S+R+   G+WYIQ L   +   +K   L  +L+  N  V EKY++
Sbjct:  469 DASDGKKIDETRKYRNNRSSKCRAIIINNVVF---CGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDS---LIITIMSHGDQGLLYGVDGVPVQMLDIIDLM----CTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYEA 702          
BLAST of Caspase-3 vs. Ensembl Celegans
Match: csp-2 (Putative inactive caspase B Putative inactive caspase B subunit p31 Putative inactive caspase B subunit p17 Putative inactive caspase subunit p14 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZP5])

HSP 1 Score: 110.538 bits (275), Expect = 8.264e-27
Identity = 80/244 (32.79%), Postives = 118/244 (48.36%), Query Frame = 1
Query:   97 DMVDGK---ESEIYEISKIKLC--FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGK-PKVFLIQACRGDKYDHGVIADDFLSNSIEKIP-----------------IEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQS 756
            D  DGK   E+  Y  ++   C   IINN  F     M  R G+  D K+L ++F +LG++  +Y N KSSEI   ++Q +Q         L++ I+SHG +G +YG DG PV +  I        C   L K PK  +   CRGD+ D  V  D F+ N  ++ P                  +AD L+ +ST  G+ S+R+   G+WYIQ L   +   +K   L  +L+  N  V EKY++
Sbjct:  568 DASDGKKIDETRKYRNNRSSKCRAIIINNVVF---CGMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDS---LIITIMSHGDQGLLYGVDGVPVQMLDIIDLM----CTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFDRFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAKDTHLADLLMETNRRVVEKYEA 801          
BLAST of Caspase-3 vs. Ensembl Fly
Match: Dcp-1 (gene:FBgn0010501 transcript:FBtr0072062)

HSP 1 Score: 166.007 bits (419), Expect = 5.940e-49
Identity = 101/233 (43.35%), Postives = 128/233 (54.94%), Query Frame = 1
Query:  157 IINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKEL--KDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYD------HGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSH-SKKEKSDGKVQIPSFVCMLRKSL 828
            +I N EF    ++ +R GT VD + LK+ F  LGF V  +K+ K  +I   LK + +  EL   D   L V ILSHG  G +Y  D    LD I+ YF    C  L GKPK+F IQAC+GD+ D       GV   D  S++  KIPI ADFL  YST+ GYFSWRN  NGSWY+QSL  EL    K  +LL +L  VN  VA  ++S+       D + QIP    ML + L
Sbjct:   82 LIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDI---LKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTSMLTRIL 311          
BLAST of Caspase-3 vs. Ensembl Fly
Match: Drice (gene:FBgn0019972 transcript:FBtr0085482)

HSP 1 Score: 155.221 bits (391), Expect = 1.325e-44
Identity = 92/242 (38.02%), Postives = 131/242 (54.13%), Query Frame = 1
Query:  148 LCFIINNEEFQ-PNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSK-KEKSDGKVQIPSFVCMLRKSLWLN*SQI 849
            +  I N+E F+ P L   +R GT VD + L +V  +L F+V  YK+ +  +I   ++  + +    D   ++V ILSHG  G IY  D    LD I+ +F    C  L GKPK+F IQAC+GD+ D GV         D  S+   KIP+ ADFLI YSTV G++SWRN   GSW++QSLC EL    K  ++L +L  V   VA  ++S +    +   + QIP    ML + L  +  Q+
Sbjct:   95 MALIFNHEHFEVPTLK--SRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEYAASQNH-SDSDCILVAILSHGEMGYIYAKDTQYKLDNIWSFFTANHCPSLAGKPKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQSLCAELAANGKRLDILTLLTFVCQRVAVDFESCTPDTPEMHQQKQIPCITTMLTRILRFSDKQL 333          
BLAST of Caspase-3 vs. Ensembl Fly
Match: Decay (gene:FBgn0028381 transcript:FBtr0083304)

HSP 1 Score: 132.88 bits (333), Expect = 2.085e-36
Identity = 79/232 (34.05%), Postives = 119/232 (51.29%), Query Frame = 1
Query:  202 RNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIE--------------KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLS-------KSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            R GT  D   ++      GF V  + +   SEI   LK+++ R++       V+ ++SHGTEG +Y  D    ++R++  F G  C+ L  KPK+F IQACRG   +  V    F   + E               IP  AD L+ YST   +FS+RN  +GSW+IQSLC  L+  +       +  ELL++L  VN  VA +YQS++K E  +   ++P+F+  L K+  L
Sbjct:   72 RVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVA-REDHSQNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTFQL 302          
BLAST of Caspase-3 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0340083)

HSP 1 Score: 101.679 bits (252), Expect = 4.486e-24
Identity = 73/242 (30.17%), Postives = 117/242 (48.35%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLN-----------MAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEA--DFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLW 831
            +  IIN ++F  N++           +  R+GT VD +RL +VF+ +G+ VE Y N     I   ++    R  ++D   LVV ILSHG E  +Y ++   + +  I      Y    L  KPK+ +IQAC+ +K  H    ++     +  +  +   D L   STV GY + R+ + GSW+I SLCD ++  S S  +  IL  V N V       SKK  S+ +  +P+     R+ ++
Sbjct:  206 IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS--LVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDT--LYYKPKLLIIQACQ-EKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEV-------SKKRGSNDESMVPNVKSTFRQHVY 435          
BLAST of Caspase-3 vs. Ensembl Fly
Match: Dredd (gene:FBgn0020381 transcript:FBtr0114559)

HSP 1 Score: 102.064 bits (253), Expect = 4.569e-24
Identity = 73/236 (30.93%), Postives = 116/236 (49.15%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAA-----RNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEA--DFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLW 831
            +  IIN ++F  N  ++      R+GT VD +RL +VF+ +G+ VE Y N     I   ++    R  ++D   LVV ILSHG E  +Y ++   + +  I      Y    L  KPK+ +IQAC+ +K  H    ++     +  +  +   D L   STV GY + R+ + GSW+I SLCD ++  S S  +  IL  V N V       SKK  S+ +  +P+     R+ ++
Sbjct:  260 IALIINQQKFHRNKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDS--LVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDT--LYYKPKLLIIQACQ-EKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEV-------SKKRGSNDESMVPNVKSTFRQHVY 483          
BLAST of Caspase-3 vs. Ensembl Zebrafish
Match: casp3b (caspase 3, apoptosis-related cysteine peptidase b [Source:ZFIN;Acc:ZDB-GENE-070607-1])

HSP 1 Score: 214.157 bits (544), Expect = 5.677e-68
Identity = 101/228 (44.30%), Postives = 142/228 (62.28%), Query Frame = 1
Query:  151 CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            C IINN+ F     M  RNGT  D K++ + F++LGFKV +Y +   S++ + L + SQ    K  ++   ++LSHG +G IYGTD  ++L R+F +F+G +C  L+GKPK+F IQACRG   D G+  D       ++IP+EADFL  YST  GY++WRN  NGSW+I SLCD L    K  E++Q++  VN+ VA +++S S     DGK QIP  V ML K L+ 
Sbjct:   57 CLIINNKNFHKRTGMGVRNGTDEDAKKVFETFSQLGFKVGHYNDLTVSQMMALLNKASQEDHSKS-AMFACVLLSHGDDGLIYGTDNSIELKRLFAHFRGDRCTSLVGKPKLFFIQACRGTDLDSGIECDGVGDEETQRIPVEADFLYAYSTAPGYYAWRNVANGSWFISSLCDMLLKYGKQLEIMQVMTRVNHKVALEFESSSNLPGFDGKKQIPCIVSMLTKELYF 283          
BLAST of Caspase-3 vs. Ensembl Zebrafish
Match: casp7 (caspase 7, apoptosis-related cysteine peptidase [Source:ZFIN;Acc:ZDB-GENE-050522-506])

HSP 1 Score: 196.823 bits (499), Expect = 2.484e-60
Identity = 104/244 (42.62%), Postives = 140/244 (57.38%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQ---RKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  C IINN+ F     M  RNGT  D   L + F  LGF V  Y +    + C N+++L +    ++  D S    I+LSHG EG IYGTDG + +  +   FKG  C+ L+GKPK+F IQACRG ++D GV  D        +  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA  ++S S+  +   K QIP  V ML K L+ N
Sbjct:  111 RVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYND----QTCRNMERLLKAVSEEDHSDSSCFACILLSHGEEGMIYGTDGAMPIKTMTSLFKGDVCKSLVGKPKLFFIQACRGSEFDDGVQTDSGPPNDTIETDANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLSEFGKQLEIMQILTRVNYMVATSFESWSEDPRFSEKKQIPCVVSMLTKELYFN 350          
BLAST of Caspase-3 vs. Ensembl Zebrafish
Match: casp3a (caspase 3, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-011210-1])

HSP 1 Score: 193.356 bits (490), Expect = 7.605e-60
Identity = 103/236 (43.64%), Postives = 134/236 (56.78%), Query Frame = 1
Query:  142 IKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIE----KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            I  C IINN+ F     M  RNGT VD   +  VF KLG+ V+ Y +   ++I   L  ++     +  SL V ++LSHG EG  +GTD  VDL  +   F+G +C  L+GKPK+F IQACRG + D GV  D      I     +IP+EADFL  YSTV GY+SWRN   GSW+IQSLC+ +       ELLQI+  VN+ VA  ++S S     D K QIP  V ML K ++  
Sbjct:   47 IGHCIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCASL-VCVLLSHGDEGVFFGTDTSVDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETDHPDHPDIPDGRVRIPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTRVNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYFT 281          
BLAST of Caspase-3 vs. Ensembl Zebrafish
Match: casp3a (caspase 3, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-011210-1])

HSP 1 Score: 193.356 bits (490), Expect = 7.605e-60
Identity = 103/236 (43.64%), Postives = 134/236 (56.78%), Query Frame = 1
Query:  142 IKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIE----KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            I  C IINN+ F     M  RNGT VD   +  VF KLG+ V+ Y +   ++I   L  ++     +  SL V ++LSHG EG  +GTD  VDL  +   F+G +C  L+GKPK+F IQACRG + D GV  D      I     +IP+EADFL  YSTV GY+SWRN   GSW+IQSLC+ +       ELLQI+  VN+ VA  ++S S     D K QIP  V ML K ++  
Sbjct:   47 IGHCIIINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCASL-VCVLLSHGDEGVFFGTDTSVDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETDHPDHPDIPDGRVRIPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTRVNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYFT 281          
BLAST of Caspase-3 vs. Ensembl Zebrafish
Match: casp6a (caspase 6, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-030825-4])

HSP 1 Score: 163.31 bits (412), Expect = 4.673e-48
Identity = 92/273 (33.70%), Postives = 142/273 (52.01%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEK-----------IPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +++ +TE D  N+  F M   +E ++    +  +  I N+E F   L +  R+GT  D + L + F +L F+V+ + ++K  E+ S + + +    +      V + LSHG  G +Y  DG +++  I   FKG KCR L+GKPK+F+ QACRGDK+D  V   D + + +             +P  ADF++ YS   GY+S R   NGSWYIQ LC+ L       E  +IL  VN  V+ +   + K   + GK Q+P F  ML K L+ 
Sbjct:   24 VEENLTETDSFNQSIFSMDPNQEYDMNH-KRRGMALIFNHENFFWKLGLGYRSGTNADKENLIRRFRELNFEVKAFDDYKRHEVLSKITEAAAADHVD-ADCFVCVFLSHGENGHVYANDGQIEIPEITDLFKGDKCRSLVGKPKIFIWQACRGDKHDDPVTPMDVVDSQVTNDMVVDAGVLYTLPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEILRRYGSELEFAEILTLVNRKVSLRSVLNCKDRSAVGKKQVPCFASMLTKKLFF 294          
BLAST of Caspase-3 vs. Ensembl Xenopus
Match: casp3.2 (caspase 3, gene 2 [Source:NCBI gene;Acc:100151728])

HSP 1 Score: 211.846 bits (538), Expect = 7.464e-67
Identity = 106/234 (45.30%), Postives = 151/234 (64.53%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDF--LSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ +C IINN+ FQ + NM  RNGT VD ++L + FT LG+KV+   + KS++I + LK++S+    K  S  V  ILSHG +G +YG DGP+ +  +   F+G +C+ L+GKPK+F IQACRG   D G+  D        I++IP+EADFL  YSTV GY+SWRN  NGSW+IQSLC+ ++      EL+QIL  VN+ VA +++S S ++    K QIP  V ML K+ + 
Sbjct:   54 EMGICLIINNKNFQSSTNMGVRNGTDVDARKLHETFTGLGYKVKVCNDQKSNDIFTLLKKMSEEDHSKRSSF-VCAILSHGEDGLVYGVDGPIQIKNLTDLFRGDRCKTLVGKPKLFFIQACRGTDLDSGIETDSGSEPGEEIQRIPVEADFLYAYSTVPGYYSWRNTMNGSWFIQSLCEMIKLYGPHLELIQILTCVNHMVALEFESCSTQQAFHAKKQIPCVVSMLTKAFYF 286          
BLAST of Caspase-3 vs. Ensembl Xenopus
Match: lrrc38 (leucine rich repeat containing 38 [Source:Xenbase;Acc:XB-GENE-955337])

HSP 1 Score: 176.022 bits (445), Expect = 8.615e-53
Identity = 99/240 (41.25%), Postives = 138/240 (57.50%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSN-SIE-------KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            K+  C IINN+ F     M+ RNGT +D + L + F  LGF V  + N   +E+ + L+ +++ ++ KD +    I LSHG EG IYGTDG + +                GKPK+F IQACRG ++D G+  D   SN S+E       KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA +++S+    + + K QIP  V ML K L+ 
Sbjct:   68 KVGRCIIINNKNFDDITGMSPRNGTDIDARDLLRCFKGLGFDVTVFNNKSCTEMETLLRSVAE-QDHKDSACFACIFLSHGEEGLIYGTDGAMPIK---------------GKPKLFFIQACRGCEFDDGLETDAGPSNDSLETDANPRHKIPVEADFLYAYSTVPGYYSWRNPGRGSWFVQALCNVLNEHGKELEVMQILTRVNYLVATQFESYCDDPQFNKKKQIPCVVSMLTKELYF 291          
BLAST of Caspase-3 vs. Ensembl Xenopus
Match: calb2 (calbindin 2 [Source:Xenbase;Acc:XB-GENE-960001])

HSP 1 Score: 168.703 bits (426), Expect = 8.117e-50
Identity = 91/241 (37.76%), Postives = 135/241 (56.02%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADD-----FLSN-------SIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            L  I N+E+F   L + +R GT  D   L ++ T LGF V+NY N ++ +I   +++ S   +  +    + + LSHG +  IY  D  +D+  +   FKG KC  L+GKPK+F+ QACRG+K+D+ V+  D      L+N       S+  +P  ADF++ YS   GY+S R   NGSWYIQ LC+ L+  + S E  +IL  VN  V+++  +     K+ GK QIP F  ML K L+L
Sbjct:   60 LALIFNHEDFYWQLRLGSRRGTNTDSMNLNRILTDLGFDVQNYYNLRTLDILEKIQEAST-ADHSNADCFLCVFLSHGEDRHIYSYDSLIDIQELTNSFKGDKCESLVGKPKIFIFQACRGEKHDNPVLPTDETDSVTLTNITEVDAASLYTLPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEVLKAHAASLEFTEILTLVNRKVSQRSVAFCNDPKAIGKKQIPCFSSMLTKKLFL 299          
BLAST of Caspase-3 vs. Ensembl Xenopus
Match: ENSXETT00000003846.1 (caspase 3, gene 1 [Source:NCBI gene;Acc:100486222])

HSP 1 Score: 156.762 bits (395), Expect = 1.314e-45
Identity = 87/230 (37.83%), Postives = 130/230 (56.52%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEK-IPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +C I+  E+F  +        +  D   L  +F K+GF+V   +N  + EI S LK ++ R++  +    V +++SHG +   Y  D    +D +   F+G  C+ L+GKPK+F IQACRGDK D GV+ D  ++ +    IP E DFL  Y+T  GYF+WR G  GSW+IQSLC+ L    +  +LLQIL  VN+ VA +Y S+S     + K ++  F+ ML K L+ 
Sbjct:   42 ICLILCMEKFDNDPKGKRSRNSNDDKIFLNNIFVKMGFEVRLEENKTADEIESLLKDIA-RQDHSERGCFVCVVISHGDKDFFYARDQEFKIDALAEPFRGENCKSLIGKPKLFFIQACRGDKTDSGVVKDAGIATTTASVIPTECDFLFAYATPPGYFAWRRGA-GSWFIQSLCEMLGEYWQKRDLLQILTRVNHKVAYEYISNSTDTDKNEKKEMTCFLSMLTKELYF 269          
BLAST of Caspase-3 vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:Xenbase;Acc:XB-GENE-980812])

HSP 1 Score: 122.865 bits (307), Expect = 1.427e-31
Identity = 70/214 (32.71%), Postives = 105/214 (49.07%), Query Frame = 1
Query:  154 FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGP-VDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIE---------------KIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEK 747
             II+N  F+   ++  R G  VD   L+++F+ LGF+VE  +N  +  + S L   S       +   VV +LSHG +G +YGTDG  V L  +F       C  L  KPK+F IQACRG++ D GV   D    S                 ++P ++D +  Y+ + G  S RN K GSW++Q L       SK+  +  +L+ VN  + E+
Sbjct:  164 LIISNVAFETQ-DLDHRYGGEVDVTSLEKLFSSLGFQVEVRRNLNAQNMMSQLGAFSALPAHSALDSCVVAVLSHGLDGAVYGTDGKLVQLQDVFTAMDNAHCPQLQNKPKMFFIQACRGEEADRGVDQRDGREQSASPGCEQSDAGREDIKVRLPTQSDMICAYACLKGTVSLRNTKRGSWFVQDLVSVFSQYSKNTHVADMLVKVNALIKER 376          
BLAST of Caspase-3 vs. Ensembl Mouse
Match: Casp3 (caspase 3 [Source:MGI Symbol;Acc:MGI:107739])

HSP 1 Score: 204.527 bits (519), Expect = 3.319e-64
Identity = 112/276 (40.58%), Postives = 160/276 (57.97%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDM--VDGK---ESEIYEISKIKL-------CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            M++  T +D  + +NF++  + G    +S IY  S  K+       C IINN+ F  +  M++R+GT VD   L++ F  L ++V N  +    +I   +  +S+    K  S  V +ILSHG EG IYGT+GPV+L ++  +F+G  CR L GKPK+F+IQACRG + D G+  D      +  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:    1 MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSF-VCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. Ensembl Mouse
Match: Casp3 (caspase 3 [Source:MGI Symbol;Acc:MGI:107739])

HSP 1 Score: 204.527 bits (519), Expect = 3.319e-64
Identity = 112/276 (40.58%), Postives = 160/276 (57.97%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDM--VDGK---ESEIYEISKIKL-------CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            M++  T +D  + +NF++  + G    +S IY  S  K+       C IINN+ F  +  M++R+GT VD   L++ F  L ++V N  +    +I   +  +S+    K  S  V +ILSHG EG IYGT+GPV+L ++  +F+G  CR L GKPK+F+IQACRG + D G+  D      +  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:    1 MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSF-VCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. Ensembl Mouse
Match: Casp7 (caspase 7 [Source:MGI Symbol;Acc:MGI:109383])

HSP 1 Score: 187.963 bits (476), Expect = 1.990e-57
Identity = 97/241 (40.25%), Postives = 140/241 (58.09%), Query Frame = 1
Query:  130 EISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            +  K+  C IINN+ F     M  RNGT  D   L + F  LGF+V  + +   +++   L++ S+ ++  + +    ++LSHG E  IYG DG   +  +  +F+G +C+ LL KPK+F IQACRG + D G+ AD     D  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC  L    K  E++QIL  VN+ VA  ++S S   + + K QIP  V ML K L+ +
Sbjct:   63 DFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASE-EDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFS 302          
BLAST of Caspase-3 vs. Ensembl Mouse
Match: Casp6 (caspase 6 [Source:MGI Symbol;Acc:MGI:1312921])

HSP 1 Score: 160.614 bits (405), Expect = 3.358e-47
Identity = 88/270 (32.59%), Postives = 139/270 (51.48%), Query Frame = 1
Query:   61 VTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKI--------------PIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSL 828
            +TE D   +   ++ D  E    +  +  +  I N+E F  +L +  R GT  D   L + F+ LGF+V+ + + ++ E+   + ++S    + D    + + LSHG    +Y  D  +++  + G FKG KC+ L+GKPK+F+IQACRG ++D  V+  D + +  +K+              P  ADFL+ YS   GY+S R   NGSWYIQ LC+ L     S E  ++L  VN  V+++     K   + GK Q+P F  ML K L
Sbjct:    1 MTETDGFYKSR-EVFDPAEQYKMDHKRRGVALIFNHERFFWHLTLPERRGTNADRDNLTRRFSDLGFEVKCFNDLRAEELLLKIHEVSTSSHI-DADCFICVFLSHGEGNHVYAYDAKIEIQTLTGLFKGDKCQSLVGKPKIFIIQACRGSQHDVPVVPLDMVDHQTDKLDNVTQVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLARYGSSLEFTELLTLVNRKVSQRRVDFCKDPDAIGKKQVPCFASMLTKKL 268          
BLAST of Caspase-3 vs. Ensembl Mouse
Match: Casp7 (caspase 7 [Source:MGI Symbol;Acc:MGI:109383])

HSP 1 Score: 136.346 bits (342), Expect = 2.866e-38
Identity = 72/178 (40.45%), Postives = 103/178 (57.87%), Query Frame = 1
Query:  130 EISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGS 648
            +  K+  C IINN+ F     M  RNGT  D   L + F  LGF+V  + +   +++   L++ S+ ++  + +    ++LSHG E  IYG DG   +  +  +F+G +C+ LL KPK+F IQACRG + D G+ AD     D  +N   KIP+EADFL  YSTV GY+SWRN   GS
Sbjct:   61 DFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASE-EDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGS 237          
BLAST of Caspase-3 vs. UniProt/SwissProt
Match: sp|Q8MKI5|CASP3_CANLF (Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 3.289e-67
Identity = 107/234 (45.73%), Postives = 147/234 (62.82%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ LC IINN+ F  +  MA R+GT VD   L++ FT L ++V N  +    EI   +  +S+    K  S  V ++LSHG EG I+GT+GPVDL ++ G+F+G  CR L GKPK+F+IQACRG + D G+  D  + + +  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S      GK QIP  V ML K L+L
Sbjct:   43 EMGLCIIINNKNFHKSTGMAPRSGTDVDAANLRETFTNLKYEVRNKNDLTCEEILELMNSVSKEDHSKRSSF-VCVLLSHGDEGIIFGTNGPVDLRKVTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGIEDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYL 275          
BLAST of Caspase-3 vs. UniProt/SwissProt
Match: sp|Q8MJU1|CASP3_FELCA (Caspase-3 OS=Felis catus OX=9685 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.714e-67
Identity = 106/234 (45.30%), Postives = 146/234 (62.39%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ LC IINN+ F  +  M +R+GT VD   L++ FT L ++V N  +    +I + L  +S R++    S  + ++LSHG EG IYGT+GPVDL ++ G+F+G  CR L GKPK+F+IQACRG + D G+  D    + I  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L   +   E + IL  VN  VA +++S S      GK QIP  V ML K L+ 
Sbjct:   43 EMGLCIIINNKNFHESTGMPSRSGTDVDAANLRETFTNLKYEVRNKNDLTREQIVALLDSVS-REDHSKRSSFICVLLSHGEEGIIYGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTEDDIACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLRLYAHELEFMHILTRVNRKVATEFESFSLDSAFHGKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. UniProt/SwissProt
Match: sp|P55213|CASP3_RAT (Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 PE=2 SV=2)

HSP 1 Score: 211.075 bits (536), Expect = 6.117e-66
Identity = 116/276 (42.03%), Postives = 160/276 (57.97%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDM--VDGK---ESEIYEISKIK-------LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            MD+  T +D  + +NF+   + G    +S IY  S  K       LC IINN+ F  +  M+ARNGT VD   L++ F  L ++V N  +    EI   +  +S+    K  S  V +ILSHG EG I+GT+GPVDL ++  +F+G  CR L GKPK+F+IQACRG + D G+  D    + +  +KIP+EADFL  YST  GY+SWRN ++GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:    1 MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSF-VCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. UniProt/SwissProt
Match: sp|Q60431|CASP3_MESAU (Caspase-3 OS=Mesocricetus auratus OX=10036 GN=CASP3 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.514e-66
Identity = 115/276 (41.67%), Postives = 160/276 (57.97%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDM--VDGK---ESEIYEISKIKL-------CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            M++  T +D  +  NF++  + G    +S IY  S  K+       C IINN+ F  +  M  R+GT VD  +L++ F  L ++V N  +    EI   +K  S+    K  S  V +ILSHG EG I+GTDGP+DL ++  YF+G  CR L+GKPK+F+IQACRG + D G+  D    + +  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+  +   E + IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:    1 MENNETSVDSKSIKNFEVKTIHGSKSMDSGIYLDSSYKMDYPEMGVCIIINNKNFHKSTGMTPRSGTDVDAAKLRETFMALKYEVRNKNDLTREEIVELMKNASKEDHSKRSSF-VCVILSHGDEGVIFGTDGPIDLKKLTSYFRGDYCRSLIGKPKLFIIQACRGTELDCGIETDSGTEDDMTCQKIPVEADFLYAYSTAPGYYSWRNPKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. UniProt/SwissProt
Match: sp|Q95ND5|CASP3_PIG (Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.333e-65
Identity = 106/234 (45.30%), Postives = 143/234 (61.11%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSI--EKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ LC IINN+ F  N  MA R+GT VD   L++ FT L ++V N  +    EI   +  +S+    K  S + V+ LSHG EG I+GT+GPVDL ++  +F+G  CR L GKPK+F+IQACRG + D G+  D    + +  +KIP+EADFL  YST  GY+SWRN K+GSW+IQSLC  L+      EL+ IL  VN  VA +++S S       K QIP  V ML K L+ 
Sbjct:   43 EMGLCIIINNKNFDKNTGMACRSGTDVDAANLRETFTNLKYEVRNKNDLTREEILELMHSVSKEDHSKRSSFICVL-LSHGEEGKIFGTNGPVDLKKLTSFFRGDCCRTLTGKPKLFIIQACRGTELDCGIETDSGTEDDMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAALKQYVHKLELMHILTRVNRKVAVEFESFSTDSTFHAKKQIPCIVSMLTKELYF 275          
BLAST of Caspase-3 vs. TrEMBL
Match: A0A4Y6I1I1 (Caspase-3A OS=Dugesia japonica OX=6161 GN=cas-3A PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 6.370e-132
Identity = 180/255 (70.59%), Postives = 213/255 (83.53%), Query Frame = 1
Query:   70 IDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            ++ I + NFD VDG   E Y++SKIKLC+IINNEEF P LN+  R+GT  DFK LKQVFTKLGFKVENYKNFK  EICSNL++LS+RKELKD+S+LV IIL+HG +G IYG DGP++LDRIFGYFKG KCR L+GKPKVFL QACRG+K+D GV+AD F   S+EKIP+EADFLIGYSTVAGYFSWRNG+NGSWYIQ+LC ELE  ++S EL+Q+L+NVNN VA  Y S +K +K+D  VQIPSFVCMLRK LWL
Sbjct:    1 MEDIEKTNFDDVDGTIRECYDVSKIKLCYIINNEEFYPKLNLPTRSGTDEDFKSLKQVFTKLGFKVENYKNFKKDEICSNLRELSERKELKDVSILVCIILTHGADGIIYGIDGPIELDRIFGYFKGDKCRKLIGKPKVFLFQACRGEKFDKGVVADGFFQTSLEKIPVEADFLIGYSTVAGYFSWRNGRNGSWYIQALCRELERSAQSMELIQLLVNVNNYVATNYFSMTKNDKTDAMVQIPSFVCMLRKPLWL 255          
BLAST of Caspase-3 vs. TrEMBL
Match: A0A4Y6I1H4 (Caspase-3B OS=Dugesia japonica OX=6161 GN=cas-3B PE=2 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.231e-117
Identity = 166/263 (63.12%), Postives = 210/263 (79.85%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            MD+E   I+ I+ D+ D VDG+E+  Y++S+ KLC+II+NEEFQP+LN++ R+GT  DFK+L+QVF  L F+VE +KN    +I  NLKQLSQRK+L  +S++V IILSHG EG IYGTDG V+LDR+FGYFKG KC+GL+GKPK+F IQACRG KYD GV AD  +SN IEKIPIEADFLIGYSTV GYFSWRNG +GSWYIQ+LC EL   SK+ EL+Q+L+ VNN VA  ++S + ++++DG VQI SFVCMLRKSLW +
Sbjct:    1 MDNENDTIEFIDTDDLDTVDGQENNAYDMSQKKLCYIISNEEFQPHLNLSTRSGTDKDFKQLRQVFKTLKFEVEPFKNCTCRQINENLKQLSQRKDLDGVSMMVCIILSHGDEGIIYGTDGIVELDRLFGYFKGDKCKGLIGKPKIFFIQACRGQKYDKGVSADSIISNYIEKIPIEADFLIGYSTVPGYFSWRNGASGSWYIQALCKELIKCSKTHELVQLLVKVNNNVATNFKSKTNQKETDGMVQISSFVCMLRKSLWFS 263          
BLAST of Caspase-3 vs. TrEMBL
Match: A0A493QY72 (Caspase-7 OS=Dugesia japonica OX=6161 GN=CASP-7 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.153e-98
Identity = 142/247 (57.49%), Postives = 183/247 (74.09%), Query Frame = 1
Query:   94 FDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
             D VD KES+ Y   K KLC+IINNEEF   LN++ R+GT  DF++LK +F KL F VEN+KN  + E+  NL+++S+RK+LKD S+ V  ILSHG EG IYG D  V +D +  YFKG KC+GL+GKPK+F IQACRGDK+D GV+AD   SN+++KIPIEAD LIGYSTV GYFSWRN  NGSWYIQ+LC E+E  +K+ +++ IL+ VN +VA  + S++   KS G +QIPSF CMLRK + L
Sbjct:    1 MDTVDAKESDFYSTDKKKLCYIINNEEFDRGLNLSPRSGTQRDFEKLKTLFKKLNFVVENHKNCTAYEMRKNLEEISKRKDLKDYSMFVCFILSHGDEGIIYGRDAHVSIDTMLNYFKGDKCKGLVGKPKLFFIQACRGDKFDKGVLADSVGSNNLDKIPIEADVLIGYSTVPGYFSWRNSSNGSWYIQALCSEIEKNAKTEDVVHILVRVNASVAGNFSSNTGDTKSHGMIQIPSFTCMLRKKVLL 247          
BLAST of Caspase-3 vs. TrEMBL
Match: A0A4Y6I1G1 (Caspase-7 OS=Dugesia japonica OX=6161 GN=cas-7 PE=2 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 9.507e-97
Identity = 139/247 (56.28%), Postives = 183/247 (74.09%), Query Frame = 1
Query:   94 FDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
             D VD KES+ Y   K KLC+IINNEEF   LN+++R+GT  DF++LK +F KL F VEN+KN  + E+  NL+++S+RK+LKD S+ V  ILSHG EG IYG D  V +D +   FKG KC+GL+GKPK+F IQACRGD++D GV+AD   SN+++KIPIEAD LIGYSTV GYFSWRN  NGSWYIQ+LC E+E  +++ +++ IL+ VN +VA  + S++   KS G +QIPSF CMLRK + L
Sbjct:    1 MDTVDAKESDFYSTDKKKLCYIINNEEFDRTLNLSSRSGTQRDFEKLKTLFKKLNFVVENHKNCTAGEMRKNLEEISKRKDLKDYSMFVCFILSHGDEGIIYGRDAFVPIDSMLNLFKGDKCKGLVGKPKLFFIQACRGDRFDKGVVADSVGSNNLDKIPIEADVLIGYSTVPGYFSWRNSSNGSWYIQALCSEIEKNAETEDVVHILVRVNASVAANFSSNTGDIKSHGMIQIPSFTCMLRKKVLL 247          
BLAST of Caspase-3 vs. TrEMBL
Match: A0A4Y6I0S1 (Caspase-3C OS=Dugesia japonica OX=6161 GN=cas-3C PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 6.914e-70
Identity = 113/243 (46.50%), Postives = 159/243 (65.43%), Query Frame = 1
Query:  106 DGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +    E+Y ++  KLC+IINNE F     +  RNGT +DFK +K  F KL F+++   N +S E+  NL+++S + +LKD S+ V +ILSHG EG IYG +  V+++++   F    C  L  KPK+FLIQAC+GDK D G  AD   SN+I K+ IE +F IGYSTV GYFSWRN   GSW+I SLCD + +     +L+Q+L+ VNN V+ KY+S+  +   + K+QI SFVCML K ++L
Sbjct:    5 NSNSRELYPMNGKKLCYIINNELFHKKSGLTRRNGTNIDFKNIKITFEKLNFEIQWNDNCRSLEMIQNLQKISLKSDLKDYSIFVCVILSHGDEGIIYGFEDSVEINKLLAIFTEENCEALRDKPKIFLIQACKGDKCDSGAYADSIQSNNINKMFIEPNFFIGYSTVPGYFSWRNQVVGSWFISSLCDVINSNENREDLVQLLVRVNNRVS-KYRSNVNRNDMNNKLQISSFVCMLLKDVYL 246          
BLAST of Caspase-3 vs. Ensembl Cavefish
Match: ENSAMXT00000034295.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001829.1:2219:15770:-1 gene:ENSAMXG00000030411.1 transcript:ENSAMXT00000034295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 2.165e-60
Identity = 98/232 (42.24%), Postives = 135/232 (58.19%), Query Frame = 1
Query:  142 IKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            I  C IINN+ F  +  M  RNGT VD     + F KLG+KV+ + +    +I   L  ++ R++    + LV ++LSHG EG  +GTDG ++L  +   F+G +C  L+GKPK+F IQACRG   D G+  D     S  KIP+EADFL  YST  GY+SWRN   GSW++QSLC+ +    +  EL+QI+  VN  VA  ++S S     D K QIP  V ML K ++  
Sbjct:   58 IGHCIIINNKNFHRSTGMNQRNGTDVDAGNAMKAFGKLGYKVKVFNDQTVDQIKQVLTAVA-REDHSRCASLVCVLLSHGDEGVFFGTDGALELKSLTSLFRGDRCTSLVGKPKLFFIQACRGTDLDAGIEMDSPPDGSPVKIPVEADFLYAYSTAPGYYSWRNTMTGSWFMQSLCEMVSKYGRELELMQIMTRVNYKVAMDFESASNAPGFDAKKQIPCIVSMLTKEMYFT 288          
BLAST of Caspase-3 vs. Ensembl Cavefish
Match: ENSAMXT00000039856.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001829.1:7264:16104:-1 gene:ENSAMXG00000030411.1 transcript:ENSAMXT00000039856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 4.744e-60
Identity = 98/232 (42.24%), Postives = 135/232 (58.19%), Query Frame = 1
Query:  142 IKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            I  C IINN+ F  +  M  RNGT VD     + F KLG+KV+ + +    +I   L  ++ R++    + LV ++LSHG EG  +GTDG ++L  +   F+G +C  L+GKPK+F IQACRG   D G+  D     S  KIP+EADFL  YST  GY+SWRN   GSW++QSLC+ +    +  EL+QI+  VN  VA  ++S S     D K QIP  V ML K ++  
Sbjct:   49 IGHCIIINNKNFHRSTGMNQRNGTDVDAGNAMKAFGKLGYKVKVFNDQTVDQIKQVLTAVA-REDHSRCASLVCVLLSHGDEGVFFGTDGALELKSLTSLFRGDRCTSLVGKPKLFFIQACRGTDLDAGIEMDSPPDGSPVKIPVEADFLYAYSTAPGYYSWRNTMTGSWFMQSLCEMVSKYGRELELMQIMTRVNYKVAMDFESASNAPGFDAKKQIPCIVSMLTKEMYFT 279          
BLAST of Caspase-3 vs. Ensembl Cavefish
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:103041716])

HSP 1 Score: 194.512 bits (493), Expect = 1.204e-59
Identity = 102/241 (42.32%), Postives = 141/241 (58.51%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  C IINN+ F     M  RNGT  D   L + F  LGF V  Y +   +++   LK++S+ ++  D S    I+LSHG EG IYGTDG + +  +   F+G  C+ L+GKPK+F IQACRG ++D G+  D        +  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA  ++S S+  +   K QIP  V ML K L+ N
Sbjct:  104 RVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKNLGFDVFVYNDQTCAKMERLLKEVSE-EDHSDSSCFACILLSHGEEGMIYGTDGAMPIKSMTSLFRGDMCKSLVGKPKLFFIQACRGSEFDDGIQTDSGPPNDTIETDANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNEFGKQLEIMQILTRVNYMVATNFESWSEDPRFSEKKQIPCVVSMLTKELYFN 343          
BLAST of Caspase-3 vs. Ensembl Cavefish
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:103041716])

HSP 1 Score: 194.512 bits (493), Expect = 1.204e-59
Identity = 102/241 (42.32%), Postives = 141/241 (58.51%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  C IINN+ F     M  RNGT  D   L + F  LGF V  Y +   +++   LK++S+ ++  D S    I+LSHG EG IYGTDG + +  +   F+G  C+ L+GKPK+F IQACRG ++D G+  D        +  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA  ++S S+  +   K QIP  V ML K L+ N
Sbjct:  104 RVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKNLGFDVFVYNDQTCAKMERLLKEVSE-EDHSDSSCFACILLSHGEEGMIYGTDGAMPIKSMTSLFRGDMCKSLVGKPKLFFIQACRGSEFDDGIQTDSGPPNDTIETDANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNEFGKQLEIMQILTRVNYMVATNFESWSEDPRFSEKKQIPCVVSMLTKELYFN 343          
BLAST of Caspase-3 vs. Ensembl Cavefish
Match: casp3b (caspase-3 [Source:NCBI gene;Acc:103025383])

HSP 1 Score: 191.815 bits (486), Expect = 2.747e-59
Identity = 98/229 (42.79%), Postives = 136/229 (59.39%), Query Frame = 1
Query:  151 CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFL-SNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            C IINN  F  +  M+ R GT VD  ++ +VF++LGFK     N   S++   L   S+    K  ++ V ++LSHG EGTI+GTDG ++L  +   F+G +C  L GKPK+F IQACRG + D G+  D    S    KIP+EADFL  YST  GY+SWRN  NGSW+I SLC+ L    +  E++QI+  VN+ VA +++S S     +   QIP  + ML K L+ 
Sbjct:   58 CIIINNRNFDRSTGMSDRAGTDVDAGKMLKVFSELGFKASVQNNRTVSQMRQILTSASKEDHSKS-AMFVCVMLSHGDEGTIFGTDGCMELKELTRLFRGNQCPSLAGKPKLFFIQACRGSELDPGIETDSVDDSEGTHKIPVEADFLYVYSTAPGYYSWRNTANGSWFISSLCEMLAKYGRELEIMQIMTRVNHKVALEFESSSNTPGFNAMKQIPCIMSMLTKELYF 285          
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005841.1 (pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-1 gene:ENSPMAG00000005266.1 transcript:ENSPMAT00000005841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 3.498e-60
Identity = 102/235 (43.40%), Postives = 135/235 (57.45%), Query Frame = 1
Query:  151 CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGV-------IADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            C IINNE F P   M  R GT  D  +L+  F  LGF+VE+YK+    ++  NLK+ S  ++    +  V  ILSHG EG +YGTDG + +  +   F    C  L GKPK+F IQACRG  +D GV        +DD  S    K P+E DFL  +STV GY+SWRN + GSW+IQSLC+EL   S   EL++IL+ VN  VA +Y S S+    + K QIP  + ML +  + 
Sbjct:   16 CIIINNENFSPQTGMNRRKGTDRDAMQLQVCFLSLGFQVESYKDLTCKQMVENLKKASS-EDHGTRACFVCAILSHGEEGVLYGTDGTLPVSILADIFSEKHCPSLAGKPKLFFIQACRGSMFDEGVDQVDGLRRSDDTDSRGYSKPPVEPDFLYAFSTVPGYYSWRNEEKGSWFIQSLCEELLRNSSQLELVKILVCVNRRVATQYVSCSRDITYNDKKQIPCIMSMLTREFYF 249          
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005440.1 (pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 gene:ENSPMAG00000004940.1 transcript:ENSPMAT00000005440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 1.826e-58
Identity = 100/238 (42.02%), Postives = 139/238 (58.40%), Query Frame = 1
Query:  151 CFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGV----------IADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            C IINNE F P   MA RNGT +D  RL + F  LGF V+  K+    E+ + LK++SQ + LK+ + LV ++LSHG +G +YGTDGP+ L  I   F    C  L+GKP++  IQACRG   D GV          + +  L  +++ +  + DFL  ++TV+GYFSWRN  NGS +IQ LC EL+   +  EL +IL  VN  VA ++ S++     +   QIP  V ML K L+L
Sbjct:   13 CIIINNENFFPRAGMAKRNGTQMDVSRLSECFDSLGFDVKYRKDLTCEEMRTFLKEVSQ-ENLKNCACLVCVVLSHGEDGVVYGTDGPLPLSDIVKPFADSSCPSLVGKPRLVFIQACRGTLLDKGVDKVECDGDPDVKEASLLPTVDLM--QPDFLFAFATVSGYFSWRNPANGSCFIQLLCSELQEHGQRMELTKILTRVNRRVATEFTSNTTDADLNNSKQIPCTVSMLTKELYL 247          
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005498.1 (pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 gene:ENSPMAG00000004980.1 transcript:ENSPMAT00000005498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 1.480e-37
Identity = 91/247 (36.84%), Postives = 137/247 (55.47%), Query Frame = 1
Query:  148 LCFIINNEEFQPNLNMAA----RNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDG-PVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDK--------YDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELEN-LSKSCELLQILINVNNTVAEKY----QSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +C IINNEEF  +   +     R GT +D ++L++VF  LGFK+  + N    ++   L   S+    K+  + V  IL+HG    ++G+DG  + +  +  YF G  C+ LLGKPK+F IQAC+G +         D  + AD  +S     IP EAD L+G +TV+GY S+R+ + GSWYIQ+LC+ LE   +   ++L IL +VN  VAEK       ++ K +S  ++  P F   LR  L+L
Sbjct:  277 ICLIINNEEFSSDFKTSPKLKKREGTHIDAEKLEKVFKYLGFKILLHNNLTVGQMIETLMSCSKMNH-KNHDVFVCCILTHGEINCVFGSDGKSLLITEVTSYFNGSACKSLLGKPKLFFIQACQGHEKQSECHLAADADIDADGPVSPISYSIPDEADILLGMATVSGYLSFRHRREGSWYIQTLCNLLEQKCNGQNDILAILTDVNRVVAEKTARMKNPYTHKRESTKQMPQPKFS--LRMKLFL 520          
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Match: casp3a (caspase 3, apoptosis-related cysteine peptidase a [Source:ZFIN;Acc:ZDB-GENE-011210-1])

HSP 1 Score: 101.679 bits (252), Expect = 4.054e-27
Identity = 56/118 (47.46%), Postives = 72/118 (61.02%), Query Frame = 1
Query:  493 IQACRGDKYDHG--VIAD-----DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDEL-ENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRK 822
            +QACRG ++D G  + AD     D  S S + IP+EADFL  YSTV GY+SWRN   GSW++Q+ C  L E+ + + EL+Q+L  VN  VA  Y S S   +  GK QIP  V ML K
Sbjct:    1 LQACRGTEFDEGSTMCADNDVETDSESISRQTIPVEADFLYCYSTVPGYYSWRNVATGSWFVQAFCKVLKESANSNLELMQLLTRVNRKVAYDYVSFSSDTRFSGKKQIPCIVSMLTK 118          
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008527.1 (pep scaffold:Pmarinus_7.0:GL477443:35181:37755:1 gene:ENSPMAG00000007721.1 transcript:ENSPMAT00000008527.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.609e-26
Identity = 51/123 (41.46%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  136 SKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQAC 504
            S +  C IINN+ F  +  M  R GT VD   L+++F  +GFKVE   N K  E+ S + ++++ K+ +  +  V I+LSHG EG IYGTD  + +  +   F+G  CR L+GKPK+F IQ C
Sbjct:   19 SNVGYCVIINNKTFDQSTGMGERTGTDVDRDMLEKLFKDIGFKVEVKNNMKRKEMVSYITEVAE-KDHRQCACFVCILLSHGDEGVIYGTDNYLPIRDLTTPFRGDLCRSLVGKPKLFFIQVC 140          
BLAST of Caspase-3 vs. Ensembl Nematostella
Match: EDO41832 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364])

HSP 1 Score: 174.866 bits (442), Expect = 6.567e-52
Identity = 98/244 (40.16%), Postives = 142/244 (58.20%), Query Frame = 1
Query:  121 EIYEISKIK--LCFIINNEEFQPNLNMA--ARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKI--PIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
             IY++ K    +  IINN++F P   M    RNGT VD   L++ F  L F VE + N  + E    +K+L QR    + + ++  IL+HG EG +Y TDG +++  +   FKG     L+GKPK+F+ QAC+G +Y  G  A D       ++  P+EADFL  YSTV GY+SWRN  NGSW+IQS+C+       + ++L+++  VN+ V+  YQS +    SD K Q+PS V MLRK L+ 
Sbjct:  146 HIYKMDKTPRGVAVIINNKDFLPASGMHRYPRNGTNVDRDSLEKTFKALQFDVEVHNNKTTYETNRIIKELGQRS-YSNYNAMIFAILTHGEEGILYTTDGTIEIRSMMKAFKG---DNLVGKPKIFIFQACQGHEYMDGKDATDAGPEDANRVQVPVEADFLYAYSTVPGYYSWRNSVNGSWFIQSICEVFNKHMHNMDVLRMMTRVNSLVS-TYQSRTGDYYSDRKKQVPSIVSMLRKDLFF 384          
BLAST of Caspase-3 vs. Ensembl Nematostella
Match: EDO41263 (Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9])

HSP 1 Score: 164.851 bits (416), Expect = 1.596e-48
Identity = 88/249 (35.34%), Postives = 148/249 (59.44%), Query Frame = 1
Query:  103 VDGKESEIYEISKIK--LCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPV-DLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEK-IPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  + +IY++++     C IINN  F  +  + +R G+ +D   L+ +F  L ++V+   +    ++ + L   ++    K+   +VV ILSHG EG IYG DG + ++  +   F GY+ + L+GKPK+F +QACRG  +DHG   +   S + +  +P EADFLI Y+TV GY SWR+ + GSW+IQ+L +  +  + + ++L +LI VN  VA +++S ++K+      Q+PS V ML K L+ N
Sbjct:  111 INQSDDDIYKMNRDPHGWCLIINNVRFDADSGLKSRAGSDIDASNLQSLFMSLRYRVKRLNDLTMRQMKNTLFDFAKNNH-KNSDSVVVCILSHGLEGRIYGVDGGLLNISDVISMFNGYQAKDLIGKPKLFFLQACRGGDFDHGARMEQIDSPTDKSSLPSEADFLIAYATVPGYVSWRHQEKGSWFIQALVEVFKTDATTEDVLSMLIKVNRKVALEFESFNRKK------QMPSPVVMLTKKLFFN 352          
BLAST of Caspase-3 vs. Ensembl Nematostella
Match: EDO34460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA7])

HSP 1 Score: 144.05 bits (362), Expect = 1.039e-41
Identity = 88/240 (36.67%), Postives = 132/240 (55.00%), Query Frame = 1
Query:  148 LCFIINNEEF-QPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGP-VDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            +C II+N+ F +P L    R+G   D + LK+ F  L F VE  ++  +SE+ +  ++ S   +     L V  ILSHG  G+IYG+D   ++++ I   FKG  C  L  KPK+F IQACRG  +D G+ AD        D +  + E  P E+ FL+GY+T  GY SWR+  +GSWYI  LC+ L    +  +L+ +++ VN+ V+E +          G  Q P+ V  LRK ++LN
Sbjct:   13 ICLIISNQHFDKPELR--KRDGNEQDVENLKRTFENLHFVVEIRQDKTASEMYTIAREFSS-IDHSAYDLFVCCILSHGMLGSIYGSDSNLIEINEISSQFKGNACPTLAHKPKLFFIQACRGQDFDRGIQADATRDMDASDAVRQNAE--PNESHFLLGYATPPGYVSWRSQVHGSWYISFLCEVLSTYCERYDLVTMMVKVNDKVSEAF-------TRKGYKQCPAPVVTLRKRIYLN 240          
BLAST of Caspase-3 vs. Ensembl Nematostella
Match: EDO31855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 138.658 bits (348), Expect = 8.869e-40
Identity = 82/231 (35.50%), Postives = 125/231 (54.11%), Query Frame = 1
Query:  154 FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTD-GPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEK--IPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
             IINN+EF P+ +   R G+  D K+L Q+F   G  V+  +N K+S     L + +  K+       + IILSHG+   IYG D   V ++ +   F+G  C  L GKPKVF +QACRG K +   +  D     I    +P ++DFLI Y++  GY S+RN + GSW+I+S+ D   N  ++  L+ +++ VN+ VA           + G  Q+PS VCML + ++ N
Sbjct:    6 LIINNQEF-PSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQN-KTSLEMLELLEETSEKDFTKFDCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSLQGKPKVFFLQACRGAKKELVAVESDSEPVPIRHSGLPSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEHLMDLMLRVNHRVAS-------LNSNLGHKQMPSEVCMLTRKVYFN 227          
BLAST of Caspase-3 vs. Ensembl Nematostella
Match: EDO42564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S119])

HSP 1 Score: 138.658 bits (348), Expect = 8.869e-40
Identity = 82/231 (35.50%), Postives = 125/231 (54.11%), Query Frame = 1
Query:  154 FIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTD-GPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEK--IPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
             IINN+EF P+ +   R G+  D K+L Q+F   G  V+  +N K+S     L + +  K+       + IILSHG+   IYG D   V ++ +   F+G  C  L GKPKVF +QACRG K +   +  D     I    +P ++DFLI Y++  GY S+RN + GSW+I+S+ D   N  ++  L+ +++ VN+ VA           + G  Q+PS VCML + ++ N
Sbjct:    6 LIINNQEF-PSRSDVERKGSAEDVKQLYQLFDDFGMTVKTIQN-KTSLEMLELLEETSEKDFTKFDCFICIILSHGSHSGIYGVDEKAVQVESLTNKFRGSTCPSLQGKPKVFFLQACRGAKKELVAVESDSEPVPIRHSGLPSDSDFLICYASSPGYESYRNPELGSWFIRSIVDVFRNFGETEHLMDLMLRVNHRVAS-------LNSNLGHKQMPSEVCMLTRKVYFN 227          
BLAST of Caspase-3 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 209.534 bits (532), Expect = 3.596e-66
Identity = 104/235 (44.26%), Postives = 144/235 (61.28%), Query Frame = 1
Query:  130 EISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +  K+ +C IINN+ F  +  M  RNGT  D     + F KLG++++ Y +    ++    +Q+S +   K  +    +ILSHG EG IYGTDGPV  +++    KG  C  L+GKPK+F IQACRG  +D G I  D   ++ EKIP+EADFL  YSTV+GY+SWR+  NGSW+IQSLC+ LE  SK+ +L+QI+  VN+ VA  ++S S      GK QIP  V ML K  + 
Sbjct:   51 DYPKMGICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSK-FASFACVILSHGEEGVIYGTDGPVSFNKLIECLKGRSCLSLVGKPKLFFIQACRGTLFDEG-IEHDAKDDTSEKIPLEADFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKTLDLMQIMTRVNHKVATHFESSSNAPGFSGKKQIPCIVSMLTKDFYF 283          
BLAST of Caspase-3 vs. Ensembl Medaka
Match: casp3 (caspase 3 [Source:NCBI gene;Acc:100049215])

HSP 1 Score: 209.534 bits (532), Expect = 4.490e-66
Identity = 104/235 (44.26%), Postives = 144/235 (61.28%), Query Frame = 1
Query:  130 EISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            +  K+ +C IINN+ F  +  M  RNGT  D     + F KLG++++ Y +    ++    +Q+S +   K  +    +ILSHG EG IYGTDGPV  +++    KG  C  L+GKPK+F IQACRG  +D G I  D   ++ EKIP+EADFL  YSTV+GY+SWR+  NGSW+IQSLC+ LE  SK+ +L+QI+  VN+ VA  ++S S      GK QIP  V ML K  + 
Sbjct:   53 DYPKMGICLIINNKNFHKDSGMGPRNGTDNDAAAAWKSFMKLGYEIQMYNDQTVDQMKKLFRQMSNQDHSK-FASFACVILSHGEEGVIYGTDGPVSFNKLIECLKGRSCLSLVGKPKLFFIQACRGTLFDEG-IEHDAKDDTSEKIPLEADFLFAYSTVSGYYSWRSTANGSWFIQSLCEMLEKFSKTLDLMQIMTRVNHKVATHFESSSNAPGFSGKKQIPCIVSMLTKDFYF 285          
BLAST of Caspase-3 vs. Ensembl Medaka
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:101161677])

HSP 1 Score: 202.986 bits (515), Expect = 1.242e-63
Identity = 106/241 (43.98%), Postives = 141/241 (58.51%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  C IINN+ F  N  M  RNGT  D   L + F  LGF V  Y +    ++   LK+ SQ ++  D S    I+LSHG EG IYGTDG + +  +   F+G KC+ L+GKPK+F IQACRG ++D GV  D        +  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA  ++S S+  +   K QIP  V ML K L+ N
Sbjct:   46 RVGKCIIINNKNFDDNTGMNVRNGTDRDAGELYKCFKSLGFDVSIYNDQTCDKMEHLLKEASQ-EDHSDSSCFACILLSHGEEGMIYGTDGAIPIKTMTSLFRGDKCKSLVGKPKLFFIQACRGSEFDEGVQTDSGPPNDTIETDANPSHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNEFGKQLEIMQILTRVNYMVANNFESWSEDPRYSEKKQIPCVVSMLTKELYFN 285          
BLAST of Caspase-3 vs. Ensembl Medaka
Match: casp7 (caspase 7 [Source:NCBI gene;Acc:101161677])

HSP 1 Score: 203.371 bits (516), Expect = 2.184e-63
Identity = 106/241 (43.98%), Postives = 141/241 (58.51%), Query Frame = 1
Query:  139 KIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIAD--------DFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            ++  C IINN+ F  N  M  RNGT  D   L + F  LGF V  Y +    ++   LK+ SQ ++  D S    I+LSHG EG IYGTDG + +  +   F+G KC+ L+GKPK+F IQACRG ++D GV  D        +  +N   KIP+EADFL  YSTV GY+SWRN   GSW++Q+LC+ L    K  E++QIL  VN  VA  ++S S+  +   K QIP  V ML K L+ N
Sbjct:   75 RVGKCIIINNKNFDDNTGMNVRNGTDRDAGELYKCFKSLGFDVSIYNDQTCDKMEHLLKEASQ-EDHSDSSCFACILLSHGEEGMIYGTDGAIPIKTMTSLFRGDKCKSLVGKPKLFFIQACRGSEFDEGVQTDSGPPNDTIETDANPSHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQALCNVLNEFGKQLEIMQILTRVNYMVANNFESWSEDPRYSEKKQIPCVVSMLTKELYFN 314          
BLAST of Caspase-3 vs. Ensembl Medaka
Match: casp3a (caspase 3B [Source:NCBI gene;Acc:100049265])

HSP 1 Score: 196.823 bits (499), Expect = 1.787e-61
Identity = 106/249 (42.57%), Postives = 141/249 (56.63%), Query Frame = 1
Query:  103 VDGKESE-----IYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            VDGK S            I LC IINN+ F     M  RNGT +D     +VF+KLG++V+ Y +    +I   L  +S R +  D +  V I+LSHG EG  +GTDG ++L  +   F+G  C+ L+GKPK+F IQACRG + D G+ AD        KIP+EADFL  +ST  GY+SWRN   GSW+I SLC+ L    K  ELL I+  VN+ VA +++S S       K QIP  V ML K ++ 
Sbjct:   18 VDGKPSSHSFRYSLNFPTIGLCIIINNKNFDRGTGMNQRNGTDIDAASAMKVFSKLGYRVKIYNDQTVKQIKQLLTDVS-RMDHSDSASFVCILLSHGDEGVFFGTDGSIELKTLTSLFRGDHCKSLVGKPKLFFIQACRGTELDDGIEADS--KEDTTKIPVEADFLYAFSTAPGYYSWRNTMTGSWFINSLCEMLSKYGKELELLHIMTRVNHMVAVEFESISTLPGFHAKKQIPCIVSMLTKEMYF 263          
BLAST of Caspase-3 vs. Planmine SMEST
Match: SMESG000053166.1 (SMESG000053166.1)

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 262/263 (99.62%), Postives = 262/263 (99.62%), Query Frame = 1
Query:   49 MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 837
            MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKG KCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN
Sbjct:    1 MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGDKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWLN 263          
BLAST of Caspase-3 vs. Planmine SMEST
Match: SMESG000053168.1 (SMESG000053168.1)

HSP 1 Score: 307.375 bits (786), Expect = 4.166e-105
Identity = 143/246 (58.13%), Postives = 189/246 (76.83%), Query Frame = 1
Query:   97 DMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            D VD KE+  Y I++ KLC+IINNEEF P LN++ R+GT  DF++LK +F KLGF VEN+KN  +  +  NL+++SQRK LKD S+ V  ILSHG EG IYG D  + +DR+ GYFKG KC+GL+GKPK+F IQACRGD++D G+ AD   SN+IEKIPIEAD L+GYSTV GYFSWRN  NGSWY+Q+LC+E E  +KS +++ +L+ VN  VA  ++S++ +++S GK+QIPSF CMLRK +WL
Sbjct:    2 DSVDSKENNDYFINENKLCYIINNEEFDPKLNLSVRSGTQRDFEKLKALFRKLGFTVENHKNCTADMMLKNLEEISQRKNLKDYSMFVCFILSHGDEGIIYGRDHFIQIDRLLGYFKGDKCKGLVGKPKLFFIQACRGDRFDKGIFADAGDSNNIEKIPIEADVLVGYSTVPGYFSWRNSSNGSWYVQALCNEFEKNAKSDDVVSLLVRVNANVASNFKSNTGEKQSHGKLQIPSFTCMLRKRVWL 247          
BLAST of Caspase-3 vs. Planmine SMEST
Match: SMESG000053164.1 (SMESG000053164.1)

HSP 1 Score: 226.483 bits (576), Expect = 3.372e-74
Identity = 110/182 (60.44%), Postives = 137/182 (75.27%), Query Frame = 1
Query:   79 INEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFS 624
            ++ D  D VDG  S+ Y++SK KLC IINNEEF P LN+  R GT  DF  LK VF KL +  ++Y N  S  + + L++LSQR++L ++S +VVIILSHG++G IYG DGPV LDR+FGYFKG KCRGL+GKPKVF IQACRG KYD GV+ D   S++IEKIPIEADFLIGYSTV G ++
Sbjct:   14 LDGDFMDNVDGGSSKAYDMSKQKLCVIINNEEFHPQLNLPPRKGTENDFNYLKSVFNKLNYTTDSYTNVISHNMNNILQRLSQRQDLVNVSAIVVIILSHGSDGIIYGVDGPVQLDRLFGYFKGDKCRGLIGKPKVFFIQACRGQKYDKGVLTDGVHSSNIEKIPIEADFLIGYSTVPGMYN 195          
BLAST of Caspase-3 vs. Planmine SMEST
Match: SMESG000016936.1 (SMESG000016936.1)

HSP 1 Score: 220.32 bits (560), Expect = 5.147e-71
Identity = 111/237 (46.84%), Postives = 155/237 (65.40%), Query Frame = 1
Query:  124 IYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIPSFVCMLRKSLWL 834
            IYE S  K C+IINNE F   L ++ R GT  DF+ L    TK  F++    N +S E+  NLK++S R +L + S+ + IILSHG++  IYG +  +++ R+   FK  +C+ L GKPKVF+IQAC+G+K D GV+ADD  SN+I  +P+E +FLIGYSTV+ Y SWRN   GSWYI S C+ +       +LL +L+ VNN V+ K++S S    ++ KVQI SFVCML K ++L
Sbjct:   12 IYERSGKKFCYIINNEVFDAKLRLSKRKGTNKDFQNLFDTLTKFEFEIYWANNCRSLEMLQNLKKISLRPDLGEYSIFLCIILSHGSDEIIYGFEDFIEIRRLLHPFKENECKALQGKPKVFIIQACKGNKCDPGVLADDLYSNNIAAVPMELNFLIGYSTVSDYLSWRNEVVGSWYIHSFCEIVRKYGDKEDLLHLLVRVNNNVSSKFKSKSMYTATNDKVQISSFVCMLVKDVYL 248          
BLAST of Caspase-3 vs. Planmine SMEST
Match: SMESG000016936.1 (SMESG000016936.1)

HSP 1 Score: 185.267 bits (469), Expect = 1.204e-57
Identity = 93/209 (44.50%), Postives = 132/209 (63.16%), Query Frame = 1
Query:  118 SEIYEISKIKLCFIINNEEFQPNLNMAARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDISLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGSWYIQSLCDELENLSKSCELLQILINVNNTVAE 744
            + IYE S  K C+IINNE F   L ++ R GT  DF+ L    TK  F++    N +S E+  NLK++S R +L + S+ + IILSHG++  IYG +  +++ R+   FK  +C+ L GKPKVF+IQAC+G+K D GV+ADD  SN+I  +P+E +FLIGYSTV+ Y SWRN   GSWYI S C+ +       +LL +L+     + E
Sbjct:   10 NPIYERSGKKFCYIINNEVFDAKLRLSKRKGTNKDFQNLFDTLTKFEFEIYWANNCRSLEMLQNLKKISLRPDLGEYSIFLCIILSHGSDEIIYGFEDFIEIRRLLHPFKENECKALQGKPKVFIIQACKGNKCDPGVLADDLYSNNIAAVPMELNFLIGYSTVSDYLSWRNEVVGSWYIHSFCEIVRKYGDKEDLLHLLVRPIQRITE 218          
The following BLAST results are available for this feature:
BLAST of Caspase-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CASP38.282e-6644.02caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504][more]
CASP38.282e-6644.02caspase 3 [Source:HGNC Symbol;Acc:HGNC:1504][more]
CASP72.285e-5742.02caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508][more]
CASP73.297e-5742.02caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508][more]
CASP73.297e-5742.02caspase 7 [Source:HGNC Symbol;Acc:HGNC:1508][more]
back to top
BLAST of Caspase-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ced-33.816e-3230.12Cell death protein 3 Cell death protein 3 subunit ... [more]
ced-34.315e-3130.12Cell death protein 3 Cell death protein 3 subunit ... [more]
csp-25.480e-2832.79Putative inactive caspase B Putative inactive casp... [more]
csp-27.654e-2732.79Putative inactive caspase B Putative inactive casp... [more]
csp-28.264e-2732.79Putative inactive caspase B Putative inactive casp... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcp-15.940e-4943.35gene:FBgn0010501 transcript:FBtr0072062[more]
Drice1.325e-4438.02gene:FBgn0019972 transcript:FBtr0085482[more]
Decay2.085e-3634.05gene:FBgn0028381 transcript:FBtr0083304[more]
Dredd4.486e-2430.17gene:FBgn0020381 transcript:FBtr0340083[more]
Dredd4.569e-2430.93gene:FBgn0020381 transcript:FBtr0114559[more]
back to top
BLAST of Caspase-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp3b5.677e-6844.30caspase 3, apoptosis-related cysteine peptidase b ... [more]
casp72.484e-6042.62caspase 7, apoptosis-related cysteine peptidase [S... [more]
casp3a7.605e-6043.64caspase 3, apoptosis-related cysteine peptidase a ... [more]
casp3a7.605e-6043.64caspase 3, apoptosis-related cysteine peptidase a ... [more]
casp6a4.673e-4833.70caspase 6, apoptosis-related cysteine peptidase a ... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp3.27.464e-6745.30caspase 3, gene 2 [Source:NCBI gene;Acc:100151728][more]
lrrc388.615e-5341.25leucine rich repeat containing 38 [Source:Xenbase;... [more]
calb28.117e-5037.76calbindin 2 [Source:Xenbase;Acc:XB-GENE-960001][more]
ENSXETT00000003846.11.314e-4537.83caspase 3, gene 1 [Source:NCBI gene;Acc:100486222][more]
bcr1.427e-3132.71BCR, RhoGEF and GTPase activating protein [Source:... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Casp33.319e-6440.58caspase 3 [Source:MGI Symbol;Acc:MGI:107739][more]
Casp33.319e-6440.58caspase 3 [Source:MGI Symbol;Acc:MGI:107739][more]
Casp71.990e-5740.25caspase 7 [Source:MGI Symbol;Acc:MGI:109383][more]
Casp63.358e-4732.59caspase 6 [Source:MGI Symbol;Acc:MGI:1312921][more]
Casp72.866e-3840.45caspase 7 [Source:MGI Symbol;Acc:MGI:109383][more]
back to top
BLAST of Caspase-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MKI5|CASP3_CANLF3.289e-6745.73Caspase-3 OS=Canis lupus familiaris OX=9615 GN=CAS... [more]
sp|Q8MJU1|CASP3_FELCA5.714e-6745.30Caspase-3 OS=Felis catus OX=9685 GN=CASP3 PE=2 SV=... [more]
sp|P55213|CASP3_RAT6.117e-6642.03Caspase-3 OS=Rattus norvegicus OX=10116 GN=Casp3 P... [more]
sp|Q60431|CASP3_MESAU7.514e-6641.67Caspase-3 OS=Mesocricetus auratus OX=10036 GN=CASP... [more]
sp|Q95ND5|CASP3_PIG1.333e-6545.30Caspase-3 OS=Sus scrofa OX=9823 GN=CASP3 PE=1 SV=1[more]
back to top
BLAST of Caspase-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y6I1I16.370e-13270.59Caspase-3A OS=Dugesia japonica OX=6161 GN=cas-3A P... [more]
A0A4Y6I1H41.231e-11763.12Caspase-3B OS=Dugesia japonica OX=6161 GN=cas-3B P... [more]
A0A493QY722.153e-9857.49Caspase-7 OS=Dugesia japonica OX=6161 GN=CASP-7 PE... [more]
A0A4Y6I1G19.507e-9756.28Caspase-7 OS=Dugesia japonica OX=6161 GN=cas-7 PE=... [more]
A0A4Y6I0S16.914e-7046.50Caspase-3C OS=Dugesia japonica OX=6161 GN=cas-3C P... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034295.12.165e-6042.24pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000039856.14.744e-6042.24pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
casp71.204e-5942.32caspase 7 [Source:NCBI gene;Acc:103041716][more]
casp71.204e-5942.32caspase 7 [Source:NCBI gene;Acc:103041716][more]
casp3b2.747e-5942.79caspase-3 [Source:NCBI gene;Acc:103025383][more]
back to top
BLAST of Caspase-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005841.13.498e-6043.40pep scaffold:Pmarinus_7.0:GL476535:290070:293064:-... [more]
ENSPMAT00000005440.11.826e-5842.02pep scaffold:Pmarinus_7.0:GL480504:970:21443:-1 ge... [more]
ENSPMAT00000005498.11.480e-3736.84pep scaffold:Pmarinus_7.0:GL481204:7525:20312:1 ge... [more]
casp3a4.054e-2747.46caspase 3, apoptosis-related cysteine peptidase a ... [more]
ENSPMAT00000008527.12.609e-2641.46pep scaffold:Pmarinus_7.0:GL477443:35181:37755:1 g... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caspase-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418326.567e-5240.16Caspase [Source:UniProtKB/TrEMBL;Acc:A7S364][more]
EDO412631.596e-4835.34Caspase [Source:UniProtKB/TrEMBL;Acc:A7S4V9][more]
EDO344601.039e-4136.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318558.869e-4035.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425648.869e-4035.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Caspase-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
casp33.596e-6644.26caspase 3 [Source:NCBI gene;Acc:100049215][more]
casp34.490e-6644.26caspase 3 [Source:NCBI gene;Acc:100049215][more]
casp71.242e-6343.98caspase 7 [Source:NCBI gene;Acc:101161677][more]
casp72.184e-6343.98caspase 7 [Source:NCBI gene;Acc:101161677][more]
casp3a1.787e-6142.57caspase 3B [Source:NCBI gene;Acc:100049265][more]
back to top
BLAST of Caspase-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053166.10.000e+099.62SMESG000053166.1[more]
SMESG000053168.14.166e-10558.13SMESG000053168.1[more]
SMESG000053164.13.372e-7460.44SMESG000053164.1[more]
SMESG000016936.15.147e-7146.84SMESG000016936.1[more]
SMESG000016936.11.204e-5744.50SMESG000016936.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013706 ID=SMED30013706|Name=Caspase-3|organism=Schmidtea mediterranea sexual|type=transcript|length=910bp
TAAATTTGTGGTCATCAACTAAATATTAAATATTTTAAAAATAACTAAAT
GGATGATGAAGTAACGGAAATTGATCAAATAAATGAAGATAATTTTGATA
TGGTTGACGGTAAAGAAAGTGAAATATATGAAATCAGCAAGATAAAATTG
TGCTTTATTATAAACAATGAGGAATTTCAACCAAATTTAAACATGGCAGC
CAGAAATGGCACCGGAGTCGATTTCAAACGGCTCAAGCAAGTTTTTACAA
AGTTGGGATTTAAAGTTGAAAATTACAAAAATTTCAAAAGTTCTGAAATA
TGTTCAAATTTGAAACAATTATCCCAGCGTAAAGAACTGAAAGACATCAG
TTTGCTTGTTGTCATAATTTTAAGTCATGGAACAGAAGGAACAATTTATG
GAACTGATGGTCCCGTTGATCTTGATCGAATATTTGGATATTTTAAAGGT
TACAAATGTCGTGGCCTCCTGGGAAAACCAAAAGTTTTTTTGATACAAGC
CTGTCGAGGTGACAAATATGACCATGGGGTAATTGCGGATGACTTTCTTT
CTAATAGTATTGAAAAAATACCAATAGAAGCTGACTTTCTAATTGGATAT
TCCACAGTTGCAGGATATTTTTCATGGAGAAATGGTAAAAATGGCAGTTG
GTATATTCAATCTCTTTGTGATGAACTGGAAAACCTTTCTAAATCATGCG
AATTATTGCAAATATTAATAAATGTGAACAATACTGTCGCGGAAAAATAC
CAGTCTCATTCAAAAAAAGAGAAGAGTGATGGAAAGGTACAAATACCTTC
GTTCGTATGCATGCTGAGAAAATCGCTTTGGCTAAATTGAAGTCAAATTT
TGGGAACTAGAAATCTTTTTAAATAAAAAACTTTTAATAACGCTTTTGAC
AAAAATTTTT
back to top

protein sequence of SMED30013706-orf-1

>SMED30013706-orf-1 ID=SMED30013706-orf-1|Name=SMED30013706-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MDDEVTEIDQINEDNFDMVDGKESEIYEISKIKLCFIINNEEFQPNLNMA
ARNGTGVDFKRLKQVFTKLGFKVENYKNFKSSEICSNLKQLSQRKELKDI
SLLVVIILSHGTEGTIYGTDGPVDLDRIFGYFKGYKCRGLLGKPKVFLIQ
ACRGDKYDHGVIADDFLSNSIEKIPIEADFLIGYSTVAGYFSWRNGKNGS
WYIQSLCDELENLSKSCELLQILINVNNTVAEKYQSHSKKEKSDGKVQIP
SFVCMLRKSLWLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0031647regulation of protein stability
GO:0097190apoptotic signaling pathway
GO:1902004positive regulation of beta-amyloid formation
GO:0006915apoptotic process
GO:0006508proteolysis
GO:0030182neuron differentiation
GO:0030216keratinocyte differentiation
GO:0030218erythrocyte differentiation
GO:0097194execution phase of apoptosis
Vocabulary: molecular function
TermDefinition
GO:0097199cysteine-type endopeptidase activity involved in apoptotic signaling pathway
GO:0008234cysteine-type peptidase activity
GO:0004197cysteine-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0097200cysteine-type endopeptidase activity involved in execution phase of apoptosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000141dorsal region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002398Pept_C14
IPR015917Pept_C14A
IPR029030Caspase-like_dom_sf
IPR033139Caspase_cys_AS
IPR001309Pept_C14_p20
IPR002138Pept_C14_p10
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015917Peptidase C14A, caspase catalytic domainPRINTSPR00376IL1BCENZYMEcoord: 103..111
score: 49.16
coord: 31..44
score: 39.39
coord: 137..155
score: 66.19
coord: 52..70
score: 40.67
coord: 70..88
score: 23.76
coord: 192..203
score: 60.61
IPR015917Peptidase C14A, caspase catalytic domainSMARTSM00115caspase_2coord: 26..263
e-value: 5.0E-89
score: 311.8
IPR015917Peptidase C14A, caspase catalytic domainCDDcd00032CASccoord: 34..262
e-value: 1.07172E-90
score: 266.389
NoneNo IPR availablePFAMPF00656Peptidase_C14coord: 33..259
e-value: 8.2E-48
score: 163.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.1460coord: 17..263
e-value: 1.5E-86
score: 291.4
NoneNo IPR availablePANTHERPTHR10454:SF198CASPASE-3coord: 30..259
IPR002398Peptidase C14 familyPANTHERPTHR10454CASPASEcoord: 30..259
IPR033139Peptidase family C14A, cysteine active sitePROSITEPS01122CASPASE_CYScoord: 143..154
IPR001309Peptidase C14, p20 domainPROSITEPS50208CASPASE_P20coord: 31..156
score: 43.976
IPR002138Peptidase C14, caspase non-catalytic subunit p10PROSITEPS50207CASPASE_P10coord: 170..263
score: 31.365
IPR029030Caspase-like domain superfamilySUPERFAMILYSSF52129Caspase-likecoord: 23..262