RNA 3'-terminal phosphate cyclase

Overview
NameRNA 3'-terminal phosphate cyclase
Smed IDSMED30013694
Length (bp)1275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA 3'-terminal phosphate cyclase (SMED30013694) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA 3'-terminal phosphate cyclase (SMED30013694) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA 3'-terminal phosphate cyclase (SMED30013694) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA 3'-terminal phosphate cyclase (SMED30013694) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013694

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30013694SMESG000041894.1 dd_Smed_v4_4105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013694SMESG000041894.1 dd_Smed_v4_4105_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Human
Match: RTCA (RNA 3'-terminal phosphate cyclase [Source:HGNC Symbol;Acc:HGNC:17981])

HSP 1 Score: 258.84 bits (660), Expect = 2.526e-82
Identity = 143/366 (39.07%), Postives = 218/366 (59.56%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C+ +L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      + PIN+T+RG + K+    FVAG LP  VAK M     + I+  K  R L +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ+++FMALA G S IK   ++LH+QT I+  E +   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMS-PVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIR--KEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMT 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Human
Match: RTCA (RNA 3'-terminal phosphate cyclase [Source:HGNC Symbol;Acc:HGNC:17981])

HSP 1 Score: 249.98 bits (637), Expect = 9.658e-79
Identity = 143/379 (37.73%), Postives = 218/379 (57.52%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQN-------------QHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL +             QHL+ +++++D+C+ +L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      + PIN+T+RG + K+    FVAG LP  VAK M     + I+  K  R L +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ+++FMALA G S IK   ++LH+QT I+  E +   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLSSGGWKSKIKVLTRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMS-PVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIR--KEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMT 375          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Human
Match: RTCA (RNA 3'-terminal phosphate cyclase [Source:HGNC Symbol;Acc:HGNC:17981])

HSP 1 Score: 51.6026 bits (122), Expect = 2.246e-8
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQ 225
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLR 49          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Human
Match: RCL1 (RNA terminal phosphate cyclase like 1 [Source:HGNC Symbol;Acc:HGNC:17687])

HSP 1 Score: 52.373 bits (124), Expect = 9.899e-7
Identity = 83/370 (22.43%), Postives = 150/370 (40.54%), Query Frame = 1
Query:  109 SILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGGLV--SVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDIQT------VEKSKDVIVECEGLGIT 1161
            S+   G   +R  L  S++   P+ I  IR +   PGL++   + ++LL  + N      +    +L + P  +  G  E D      +   ++S+     F K    + L G T+ +  P +D  +      L + GI+     + +++RG  P GGG V  S  + ++   I   +    G+I ++    +      + V+ QM   I    +S  NK    + I ++  K   N     G G  L  ET+ G      +       G     ED+G+N A   ++      GCVD   Q   L+ M L +   S +    LS ++   +  L++   + F I+T      ++    V++ C G+G +
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRKIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLESLLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKIVRRGMPPGGGGEVVFSCPVRKVLKPIQLTDP---GKIKRIRGMAY-----SVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGV-NSGKSPGFGLSLVAETTSGTFLSAELASNPQGQGAAVLPEDLGRNCARLLLEEIYR-GGCVDSTNQSLALLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQIMFKIETKPCGEELKGGDKVLMTCVGIGFS 366          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Celegans
Match: ZK1127.5 (Probable RNA 3'-terminal phosphate cyclase-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q23400])

HSP 1 Score: 52.7582 bits (125), Expect = 2.191e-7
Identity = 80/345 (23.19%), Postives = 137/345 (39.71%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPID-----YYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGK-RDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMAL-AKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKS 1122
            G    RI L  S +   PI I NIR    +PG+++     + LL+ V N      S     + F P  +  G   +D  T   +   ++ +     F K    + L G T+A     +D     + +    F L    ++I I    RG  P GGG+V V    I  T+ P+     G++ K+  + +V    P S+A +M    +K +    +  ++T+     ++        G G  LT ET+ G  +    + + +  SG     ED+G       +Q      G +D   Q     FM L  K  S      L ++S   +  L+    ++F ++  +K+
Sbjct:   10 GCNFFRIRLAYSILSGRPIRIINIRKNDDRPGIRDFESKLIGLLEKVTNGTKVEISRTGTQVIFRPGMITGGVVNLDCGTERCISYFLEPLLLLSPFCKVPMVIKLKGVTNAPGEISVDGMKASWLKVYNKFVLNDEKLDIKIQ--ARGLKPEGGGVV-VFTAPIVKTLRPVKRQQVGKVCKIRGQAYVTKVTP-SLAYRMIDAAKKAMHGYISDVYITVDQ---RKGDAGGASPGYGLFLTAETTEGVIYQAEAISRPKGESGVPILPEDIGIEAGHALLQQI-YMGGALDSSAQILASTFMTLCPKDVSHFLYGPLPMYSVHALRHLKQFFEIEFKMEDFKKT 346          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Fly
Match: Rtca (gene:FBgn0025630 transcript:FBtr0070330)

HSP 1 Score: 234.572 bits (597), Expect = 2.359e-73
Identity = 128/358 (35.75%), Postives = 204/358 (56.98%), Query Frame = 1
Query:   82 ANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLG 1155
            A     IDGS LEGGGQ +R +L+ S I   P+ +  IR  RP PGL +QHL  + LL+D+ NA++ G  L S ++ F P+T+    Y V++ TA S+ LI Q   P LLFA   S L + GGT+ +FAPP++Y + ++   L   G+   + + + GFYPRG G   +D++ +    +   +   G+I  V+   + AG LP+++A  M  T ++ I      +  +I     K +  KA  NG+G ++TV T+     G + +GK+ + G  +G   + Q   +      CVD +MQDQ++I+MALA G+S+++  +L+ H++T I V E + GVKFD+  +E    ++V C+GLG
Sbjct:    3 AEKMLEIDGSYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVLLPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAF-GRIKSVSGVAYCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSI--EPIKHSRQKAFHNGAGILMTVNTTSDVVLGASALGKKRIDGHVLGSEASCQLGDYMRKQV-CVDDYMQDQLIIYMALAVGRSTMRTGKLTNHTRTAINVAEQMTGVKFDV-AMEPGGQMLVSCKGLG 355          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Fly
Match: Rtca (gene:FBgn0025630 transcript:FBtr0344156)

HSP 1 Score: 234.572 bits (597), Expect = 2.359e-73
Identity = 128/358 (35.75%), Postives = 204/358 (56.98%), Query Frame = 1
Query:   82 ANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLG 1155
            A     IDGS LEGGGQ +R +L+ S I   P+ +  IR  RP PGL +QHL  + LL+D+ NA++ G  L S ++ F P+T+    Y V++ TA S+ LI Q   P LLFA   S L + GGT+ +FAPP++Y + ++   L   G+   + + + GFYPRG G   +D++ +    +   +   G+I  V+   + AG LP+++A  M  T ++ I      +  +I     K +  KA  NG+G ++TV T+     G + +GK+ + G  +G   + Q   +      CVD +MQDQ++I+MALA G+S+++  +L+ H++T I V E + GVKFD+  +E    ++V C+GLG
Sbjct:    3 AEKMLEIDGSYLEGGGQALRNALSLSCILGKPVRVVKIRASRPSPGLSHQHLHGLNLLRDITNADVVGNYLLSSTVEFTPRTILDNTYRVETHTAASITLIYQMALPVLLFAGRPSRLIVSGGTNVDFAPPVEYMQEVLLPNLKHFGVSFDLKVQRYGFYPRGQGRCQLDVQPVTKLNSGKLVAF-GRIKSVSGVAYCAGRLPVNIAIDMQQTAQREIHRLWPSQQCSI--EPIKHSRQKAFHNGAGILMTVNTTSDVVLGASALGKKRIDGHVLGSEASCQLGDYMRKQV-CVDDYMQDQLIIYMALAVGRSTMRTGKLTNHTRTAINVAEQMTGVKFDV-AMEPGGQMLVSCKGLG 355          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Fly
Match: Rtc1 (gene:FBgn0020909 transcript:FBtr0073820)

HSP 1 Score: 53.9138 bits (128), Expect = 1.501e-7
Identity = 78/376 (20.74%), Postives = 147/376 (39.10%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGK-RPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRN-----IVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVY---KETPNKAIGN--GSGCMLTVETSLGCRFGFNIVGKRDLSGED-------MGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALA-KGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQ-----------TVEKSKDVIVECEGLGIT 1161
            G   ++  L  + +   P+ I  IR +    PGL+   ++ ++LL  + N      +    S+ F+P  ++ G    D      +   + ++     F K     TL G T+++ +P +D+ +      +  F L   G+E+ +  ++RG  P GGG +      +  ++  I    +G + ++    +     P            + +++ K    L  L +VY    +   K  GN  G G  L  ET+ G  F  +         ED       +GK VA + +       GCVD   Q    +++AL  K  S      LS ++   +  L +   + F ++            V  ++ V++ C G+G T
Sbjct:   15 GSNFLKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSVDHIKGAALSLLKRFLLVDEGLELKV--VRRGVAPLGGGEIIFRCP-VRKSLRAIQFQSQGMVKRIRGTVYACKVSP--------AMANRTVEAAKGC-MLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADCCSNTREESEDTPSIPENLGKEVALRLLDEIYR-GGCVDSSYQWLAALYIALGQKHVSKFLTGALSNYTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYT 377          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Zebrafish
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 253.447 bits (646), Expect = 1.693e-80
Identity = 145/364 (39.84%), Postives = 215/364 (59.07%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEK---SKDVIVECEGLGIT 1161
            MA + F +DGS++EGGGQI+R+S   S I    I I  IR  R  PGL+ QHL+ ++LL+D+CN  L GA++ S  +   P  +  G++  D+ TAGSV L++Q   P  LFA+  S L L GGT+AE AP IDY   +    + + G++   +L  RG+YP+GGG V + +      ++PIN+T+RG I K+    FVAG LP  +AK M T   + I+      ++ I S   K+   KA GNG+G ++  E+S GC F  + +GK+ +  + +G   AE  ++   + NGCVD  +QDQ++IFMALA G S ++   ++LH+QT I+V E L   KF I   E    +   I+EC+G+G T
Sbjct:    1 MAATTFEMDGSVMEGGGQILRVSAALSCIQGASIKINKIRAGRSTPGLRPQHLSGLELLRDMCNGNLEGATVGSSEITLTPGKIKGGNHIADTHTAGSVTLLMQVSLPCALFAQGPSELCLKGGTNAEMAPQIDYTVKVFKPIVERFGVQFDCDLRMRGYYPKGGGEVVLKVN-PAKELSPINMTERGNITKIYGRAFVAGVLPFKLAKDMSTAAIRTIRKEIKDLYINIQSLQEKD---KACGNGNGIIIIAESSTGCIFAGSSLGKKGVYADKVGIEAAEMLLRNIRH-NGCVDEFLQDQLIIFMALANGTSRMRTGPITLHTQTAIHVAEQLTNAKFAISKAEDENANDTYIIECQGVGAT 359          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Zebrafish
Match: rcl1 (RNA terminal phosphate cyclase-like 1 [Source:NCBI gene;Acc:445388])

HSP 1 Score: 80.8777 bits (198), Expect = 3.078e-16
Identity = 86/351 (24.50%), Postives = 145/351 (41.31%), Query Frame = 1
Query:  136 IRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGGLV--SVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEG 1149
             R  L  S++   P+ I NIR K   PGL++   + +++L  + N      +     L + P  +  G  E +     SV   ++++     F K      L G T+    P +D  +      + + GI    + I ++KRG  P GGG V  S  + R    +        G+I ++    F      + V+ QM   I    +S  NK    + I ++ + + PN     G G +L  ET  G   G  +V      G     ED+G+N A+  ++      GCVD   Q   L++M L +   S      LS ++   +  + +   + F I+T + S+D   EC+G
Sbjct:    9 FRQRLVLSTLSGKPVKIRNIRSKDDNPGLRDFEASFIRMLDKLTNGTRIEINQTGTVLFYQPGLLYGGSVEHECNVQRSVGYYLEALLMLAPFMKTPIKAVLKGITNHPTDPSVDLLKVTAVPLMKRFGINGDGLEIKVVKRGMAPGGGGEVHFSCPVSRSMKPVQLTEA---GKIKRIRGTAFS-----VRVSPQMANRIVDSARSILNKFIPDIYIYTD-HMKGPNSGKSPGFGLVLVAETLNGVFLGAEVVSTPQGQGETQLPEDLGRNCAKLLLEEIYRG-GCVDSTNQSLALLYMTLGQQDVSKTLLGPLSPYTMDFLRHIRDFFQIMFKIETQKPSED---ECKG 346          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:100145308])

HSP 1 Score: 243.432 bits (620), Expect = 1.922e-76
Identity = 139/357 (38.94%), Postives = 209/357 (58.54%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLG 1155
            IDGSI+EGGGQI+RI      +    + +  IR  R  PGL+ QHL+ ++ ++D+C  +L  A + S  + F P  +  G    D+KTAGSVCL++Q   P +LFA+  S L L GGT+AE AP IDY   +      +   ++  ++ +RG+YPRGGG + V +      + PIN+ DRG + K+    FVAG LP  +AK M +   + I+  +  R L I     +E   +A+ NGSG ++  ETS GC F  + +GK+ ++ + +G   AE  ++   +  GCVD ++QDQ++IFMALA G S IK   L+LH+QT I+ +E L   KF   TV+K ++V     I+EC+G+G
Sbjct:   10 IDGSIMEGGGQILRICTALGCLLGKRLHVHQIRAGRSTPGLRPQHLSGLETVRDLCGGKLVKAEIGSTEIEFTPGKIKGGTLTADTKTAGSVCLLLQVSLPCVLFAESPSELILKGGTNAEMAPQIDYTTMVFKPIAERFNFKLDYDIKRRGYYPRGGGEIQVKVS-PVKHLNPINLVDRGSVTKIYGRSFVAGVLPYRMAKDMASAAVRCIR--RELRDLYINIQAVQEHKERAVANGSGIIIVAETSTGCIFAGSALGKKGVTSDQVGVEAAEILLRNLRH-GGCVDEYLQDQLIIFMALADGISQIKTGPLTLHTQTAIHFVEQLSKAKF---TVKKCEEVNTDCNIIECQGIG 359          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:100145308])

HSP 1 Score: 238.81 bits (608), Expect = 1.531e-74
Identity = 139/361 (38.50%), Postives = 209/361 (57.89%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQN----QHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLG 1155
            IDGSI+EGGGQI+RI      +    + +  IR  R  PGL+     QHL+ ++ ++D+C  +L  A + S  + F P  +  G    D+KTAGSVCL++Q   P +LFA+  S L L GGT+AE AP IDY   +      +   ++  ++ +RG+YPRGGG + V +      + PIN+ DRG + K+    FVAG LP  +AK M +   + I+  +  R L I     +E   +A+ NGSG ++  ETS GC F  + +GK+ ++ + +G   AE  ++   +  GCVD ++QDQ++IFMALA G S IK   L+LH+QT I+ +E L   KF   TV+K ++V     I+EC+G+G
Sbjct:   10 IDGSIMEGGGQILRICTALGCLLGKRLHVHQIRAGRSTPGLRKKLKPQHLSGLETVRDLCGGKLVKAEIGSTEIEFTPGKIKGGTLTADTKTAGSVCLLLQVSLPCVLFAESPSELILKGGTNAEMAPQIDYTTMVFKPIAERFNFKLDYDIKRRGYYPRGGGEIQVKVS-PVKHLNPINLVDRGSVTKIYGRSFVAGVLPYRMAKDMASAAVRCIR--RELRDLYINIQAVQEHKERAVANGSGIIIVAETSTGCIFAGSALGKKGVTSDQVGVEAAEILLRNLRH-GGCVDEYLQDQLIIFMALADGISQIKTGPLTLHTQTAIHFVEQLSKAKF---TVKKCEEVNTDCNIIECQGIG 363          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:100145308])

HSP 1 Score: 227.639 bits (579), Expect = 1.322e-70
Identity = 136/352 (38.64%), Postives = 200/352 (56.82%), Query Frame = 1
Query:  115 LEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLG 1155
            +EGGGQI+RI      +    + +  IR  R  PGL+ QHL+ ++ ++D+C  +L  A + S  + F P  +  G    D+KTAGSVCL++Q   P +LFA+  S L L GGT+AE AP IDY   +  F            L  RG+YPRGGG + V +      + PIN+ DRG + K+    FVAG LP  +AK M +   + I+  +  R L I     +E   +A+ NGSG ++  ETS GC F  + +GK+ ++ + +G   AE  ++   +  GCVD ++QDQ++IFMALA G S IK   L+LH+QT I+ +E L   KF   TV+K ++V     I+EC+G+G
Sbjct:    1 MEGGGQILRICTALGCLLGKRLHVHQIRAGRSTPGLRPQHLSGLETVRDLCGGKLVKAEIGSTEIEFTPGKIKGGTLTADTKTAGSVCLLLQVSLPCVLFAESPSELILKGGTNAEMAPQIDYTTMVPTFSF----------LSCRGYYPRGGGEIQVKVS-PVKHLNPINLVDRGSVTKIYGRSFVAGVLPYRMAKDMASAAVRCIR--RELRDLYINIQAVQEHKERAVANGSGIIIVAETSTGCIFAGSALGKKGVTSDQVGVEAAEILLRNLRH-GGCVDEYLQDQLIIFMALADGISQIKTGPLTLHTQTAIHFVEQLSKAKF---TVKKCEEVNTDCNIIECQGIG 335          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:100145308])

HSP 1 Score: 193.741 bits (491), Expect = 5.094e-58
Identity = 115/298 (38.59%), Postives = 172/298 (57.72%), Query Frame = 1
Query:  277 LTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLG 1155
            L  A + S  + F P  +  G    D+KTAGSVCL++Q   P +LFA+  S L L GGT+AE AP IDY   +      +   ++  ++ +RG+YPRGGG + V +      + PIN+ DRG + K+    FVAG LP  +AK M +   + I+  +  R L I     +E   +A+ NGSG ++  ETS GC F  + +GK+ ++ + +G   AE  ++   +  GCVD ++QDQ++IFMALA G S IK   L+LH+QT I+ +E L   KF   TV+K ++V     I+EC+G+G
Sbjct:    4 LVKAEIGSTEIEFTPGKIKGGTLTADTKTAGSVCLLLQVSLPCVLFAESPSELILKGGTNAEMAPQIDYTTMVFKPIAERFNFKLDYDIKRRGYYPRGGGEIQVKVS-PVKHLNPINLVDRGSVTKIYGRSFVAGVLPYRMAKDMASAAVRCIR--RELRDLYINIQAVQEHKERAVANGSGIIIVAETSTGCIFAGSALGKKGVTSDQVGVEAAEILLRNLRH-GGCVDEYLQDQLIIFMALADGISQIKTGPLTLHTQTAIHFVEQLSKAKF---TVKKCEEVNTDCNIIECQGIG 294          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Match: supt6h (SPT6 homolog, histone chaperone [Source:Xenbase;Acc:XB-GENE-990369])

HSP 1 Score: 60.8474 bits (146), Expect = 1.232e-9
Identity = 79/364 (21.70%), Postives = 143/364 (39.29%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGGLV--SVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKET-----PNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSK---DVIVECEGLGIT 1161
            G    R  +  S++   P+ I+ IR K   PG+++   + ++L+  + N      +    SL + P  ++ G  E D     S+   ++S+     F K    +TL G T+ +  P +D  +      + K GI+     + ++KRG  P GGG V  S  + ++   +   +    G+I ++    +      + V+ Q+   I    +S  N      L ++Y  T      N     G G  L  ET+ GC     +       G     ED+G+N A   +   E      D   Q    +F       S +   E   H ++   ++      K + +T E+ K    V++ C G+G +
Sbjct:   12 GCNFFRQRIVLSTLSGRPVKIQGIRVKDESPGIRDFEASFIRLMDKITNGTRIEINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSVDTLKATAIPLMKKFGIDGEHFELKIVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDP---GKIKRIRGVAY-----SVRVSPQIGNRIVDAARSVLN----RFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTELASNPQGQGSTVLPEDLGRNCA---VLLLEEIYRVGDFRFQSTYDLF-------SKVSMIEFLRHLRSFFQIM-----FKMESKTFEERKGAEKVLLTCVGVGYS 348          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 262.692 bits (670), Expect = 5.701e-84
Identity = 144/365 (39.45%), Postives = 214/365 (58.63%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGI 1158
            M      +DG I+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C   L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +      K G   + ++  RG+YP+GGG V V +      + PIN+TDRG + K+    FVAG LP+ VAK M     + I+  K  R L +     +E  ++A GNGSG ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ++IFMALA G S IK   ++LH+QT I+  E L   KF ++  E+ +D      ++ECEG+G+
Sbjct:    1 MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVRDLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQVSMPCVLFAASPSELRLKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPKGGGEVIVRVS-PVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIR--KEIRDLYVSIQPVQEARDQAFGNGSGIIIVAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIIFMALANGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKKSEEEEDATKDTYVIECEGIGM 361          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 90.8929 bits (224), Expect = 9.919e-22
Identity = 39/102 (38.24%), Postives = 62/102 (60.78%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLI 384
            M      +DG I+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C   L GA + S  + F P+ +  G +  D+KTAG  C +
Sbjct:    1 MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVRDLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGFQCPV 102          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 85.1149 bits (209), Expect = 2.066e-19
Identity = 57/144 (39.58%), Postives = 79/144 (54.86%), Query Frame = 1
Query:  400 PTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCML 831
            P +LFA   S L L GGT+AE AP IDY   +      K G   + ++  RG+YP+GGG V V +      + PIN+TDRG + K+    FVAG LP+ VAK M     + I+  K  R L +     +E  ++A GNGSG ++
Sbjct:    2 PCVLFAASPSELRLKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPKGGGEVIVRVS-PVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIR--KEIRDLYVSIQPVQEARDQAFGNGSGIII 142          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Match: Rtca (RNA 3'-terminal phosphate cyclase [Source:MGI Symbol;Acc:MGI:1913618])

HSP 1 Score: 48.1358 bits (113), Expect = 2.810e-7
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGL 222
            M      +DG I+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL
Sbjct:    1 MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGL 48          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Match: Rcl1 (RNA terminal phosphate cyclase-like 1 [Source:MGI Symbol;Acc:MGI:1913275])

HSP 1 Score: 51.2174 bits (121), Expect = 1.394e-6
Identity = 80/370 (21.62%), Postives = 152/370 (41.08%), Query Frame = 1
Query:  109 SILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGG--LVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDIQT------VEKSKDVIVECEGLGIT 1161
            S+   G   +R  L  S++   P+ I  IR +   PGL++   + ++LL  + N      +    +L + P  +  G  E D      +   ++++     F K    + L G T+ +  P +D  +      L + GI+     + +++RG  P GGG  L S  + ++   +   +    G+I ++    +      + V+ QM   I    +S  NK    + I ++  K   +     G G  L  ET+ G      +       G     ED+G+N A+  ++      GCVD   Q  +L+ M L +   S +    LS ++   +  L++   V F ++T      ++    V++ C G+G +
Sbjct:    7 SLSYAGCNFLRQRLVLSTLSGRPVKIRRIRARDDNPGLRDFEASFIRLLDKITNGSRIEINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSVDVLKATALPLLKQFGIDGESFELKILRRGMPPGGGGEVLFSCPVRKVLKPVQLTDP---GKIKRIRGMAY-----SVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGV-SSGKSPGFGLSLVAETTNGTFLSAELASNPQGQGAAVLPEDLGRNCAKLLLEEIYR-GGCVDSTNQSLVLLLMTLGQQDVSKVLLGPLSPYTIEFLRHLKSFFQVMFKVETKPCGEELKGGDKVLMTCVGIGFS 366          
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Match: sp|Q9D7H3|RTCA_MOUSE (RNA 3'-terminal phosphate cyclase OS=Mus musculus OX=10090 GN=RtcA PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 3.988e-83
Identity = 144/365 (39.45%), Postives = 214/365 (58.63%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGI 1158
            M      +DG I+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C   L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +      K G   + ++  RG+YP+GGG V V +      + PIN+TDRG + K+    FVAG LP+ VAK M     + I+  K  R L +     +E  ++A GNGSG ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ++IFMALA G S IK   ++LH+QT I+  E L   KF ++  E+ +D      ++ECEG+G+
Sbjct:    1 MEGQRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMVRDLCGGHLEGAEIGSTEITFTPEKIRGGVHTADTKTAGSVCLLMQVSMPCVLFAASPSELRLKGGTNAEMAPQIDYTMMVFKPIAEKFGFTFNCDIKTRGYYPKGGGEVIVRVS-PVKRLDPINLTDRGSVTKIYGRAFVAGVLPLKVAKDMAAAAVRCIR--KEIRDLYVSIQPVQEARDQAFGNGSGIIIVAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIIFMALANGISRIKTGSVTLHTQTAIHFAEQLAKAKFTVKKSEEEEDATKDTYVIECEGIGM 361          
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Match: sp|Q2HJ88|RTCA_BOVIN (RNA 3'-terminal phosphate cyclase OS=Bos taurus OX=9913 GN=RTCA PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 3.023e-82
Identity = 145/366 (39.62%), Postives = 218/366 (59.56%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DG I+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C+ +L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      ++PIN+TDRG + K+    FVAG LP  VAK M     + I+  K  R L +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ++IFMALA G S IK   ++LH+QT I+  E L   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGGIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGVHTADTKTAGSVCLLMQVSMPCVLFAACPSELRLKGGTNAEMAPQIDYTAMVFKPIVEKFGFTFNCDIKMRGYYPKGGGEVIVRMS-PVKQLSPINLTDRGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIR--KEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGAVDEYLQDQLIIFMALASGISRIKTGPVTLHTQTAIHFAEQLAKAKFTVKKSEDEEDASKDTYIIECQGIGMT 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Match: sp|Q4R3J0|RTCA_MACFA (RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis OX=9541 GN=RTCA PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 4.803e-82
Identity = 144/366 (39.34%), Postives = 217/366 (59.29%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C+  L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      + PIN+TDRG + K+    FVAG LP  VAK M     + I+  K  R L +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ+++FMALA G S IK   ++LH+QT I+  E +   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGRLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFRFNCDIKTRGYYPKGGGEVIVRMS-PVKQLNPINLTDRGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIR--KEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDASKDTYIIECQGIGMT 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Match: sp|O00442|RTCA_HUMAN (RNA 3'-terminal phosphate cyclase OS=Homo sapiens OX=9606 GN=RTCA PE=1 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.213e-81
Identity = 143/366 (39.07%), Postives = 218/366 (59.56%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C+ +L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      + PIN+T+RG + K+    FVAG LP  VAK M     + I+  K  R L +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ+++FMALA G S IK   ++LH+QT I+  E +   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMS-PVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIR--KEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRH-GGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMT 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Match: sp|Q5R7P3|RTCA_PONAB (RNA 3'-terminal phosphate cyclase OS=Pongo abelii OX=9601 GN=RTCA PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.976e-80
Identity = 141/366 (38.52%), Postives = 216/366 (59.02%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDV-----IVECEGLGIT 1161
            MA     +DGSI+EGGGQI+R+S   S +  LP+ ++ IR  R  PGL+ QHL+ +++++D+C+ +L GA + S  + F P+ +  G +  D+KTAGSVCL++Q   P +LFA   S L L GGT+AE AP IDY   +    + K G   + ++  RG+YP+GGG V V +      + P+N+TDRG + K+    FV G LP  VAK M     + I+  K  R   +     +E  ++A GNG+G ++  ETS GC F  + +GKR ++ + +G   AE  +    +  G VD ++QDQ+++FMALA G S IK   ++LH+QT I+  E +   KF ++  E  +D      I+EC+G+G+T
Sbjct:    1 MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSKLHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFVFNCDIKTRGYYPKGGGEVIVRMS-PVKQLDPVNLTDRGCVTKIYGRAFVTGVLPFKVAKDMAAAAARCIR--KEIRDSYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIGAAEMLLANLRH-GGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKGTYIIECQGIGMT 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Match: A0A5N5ST04 (RNA 3'-terminal phosphate cyclase OS=Armadillidium nasatum OX=96803 GN=RtcA PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 2.502e-91
Identity = 162/355 (45.63%), Postives = 222/355 (62.54%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLGI 1158
            IDGS LEGGGQI+R+S   S I  +PIS+ NIRG R KPGL+ QHL  ++LLK + NAEL G  + S+ + F P  V  G    D+KTAGSV L+IQS+ P  LF K+ S  TL GGT+AE AP IDY   +     AK G+   +++ KRGF+P G G V++ +  + + + PI + D+GQ++ +     V+G LP  +A QM  + E+ +K     N R   I    +KE P KA+GNGS  +L  ETS GC  G + +GKR +S E +G   A   IQ    S  CVD H QDQ+++FMALAKGKSSI+ +EL+LH+QT IYV E +   KF+    ++S  +I+ECEG+G+
Sbjct:    5 IDGSKLEGGGQILRMSSALSCILNIPISVTNIRGNRSKPGLKAQHLTGLQLLKSLSNAELVGGKMNSMEIDFTPDDVVGGPLSADTKTAGSVSLLIQSVLPCSLFGKKESIFTLKGGTNAEMAPQIDYTLMVFKEICAKFGVSFELSVNKRGFFPVGKGEVTLRVSPLKECLKPIEMLDQGQVVSIKGRSLVSGVLPTKMAHQMADSAERELKKALGSNTR---INIERFKENPAKAVGNGSCIILWAETSTGCFLGSSSLGKRGVSPEQVGGQAAGDLIQCLL-SKSCVDSHCQDQVVLFMALAKGKSSIRTTELTLHTQTAIYVAELMTKAKFNTIEDKESGTIILECEGIGL 355          
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Match: A0A444SLU5 (RNA 3'-terminal phosphate cyclase OS=Armadillidium vulgare OX=13347 GN=Avbf_04146 PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 6.160e-87
Identity = 158/345 (45.80%), Postives = 218/345 (63.19%), Query Frame = 1
Query:   97 TIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSK 1125
            +IDGS LEGGGQI+R+S   S I  +PIS+ NIRG R KPGL+ QHL  ++LLK + NAEL G  + S+ + F P  V  G    D+KTAGSV L+IQS+ P  LF K+ S  TL GGT+AE AP IDY   +     AK G+   +++ KRGF+P G G V++ +  + + + PI + D+GQ++ +  + FVAG LP  +A QM  + E+ +K     N R   I    +KE+P KA+GNGS  +L  ETS GC  G + +GKR +S E +G   A   IQ    S  CVD H QDQ+++FMALAKGKSSI+ +EL+LH+QT I+V E +   KF+  T+E+ +
Sbjct:   44 SIDGSKLEGGGQILRMSSALSCILNIPISVTNIRGNRSKPGLKAQHLTGLQLLKSLSNAELVGGEMNSMEIDFTPDDVVGGPLTADTKTAGSVSLLIQSVLPCSLFGKKESIFTLKGGTNAEMAPQIDYTLMVFKEICAKFGVSFELSVNKRGFFPVGKGEVTLRVSPLKECLKPIEMLDQGQVVNIKGQSFVAGVLPTKMAHQMADSAERELKKALGSNTR---IDIERFKESPAKAVGNGSCIILWAETSTGCFLGSSSLGKRGVSPEQVGGQAAGDLIQCLL-SKSCVDSHCQDQVVLFMALAKGKSSIRTTELTLHTQTAIHVAELMTKAKFN--TIEEKE 382          
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Match: A0A443ST73 (RNA 3'-terminal phosphate cyclase-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_05872 PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 9.548e-86
Identity = 155/363 (42.70%), Postives = 224/363 (61.71%), Query Frame = 1
Query:   88 SNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKD--VIVECEGLGITCKE 1170
            +   IDG I+EGGGQI+RIS+  SS+ K PISI NIRG R KPGL+ QHL  +KL+ D+  A++ G  L S +L FAP+ +  G Y  D+ TAGSV L++Q   P LLFA++ S L L GGT+A+ AP ID   ++    + KMG+    N+I+RG++P+GGG V   +  I+  I PI + D G +  +    +VAG LPI +A ++  +  K +KS  N   + I  +  KE+  KA GNGSG +L  ETS GC  G + +G R +  + +G N A++ I   + S GCVD H+QDQ++IFMALAKGKS IK   L+LH++T I+  E L    F++   ++      I+EC+G+G+   +
Sbjct:    7 NEMAIDGRIMEGGGQILRISVALSSLTKKPISIANIRGNREKPGLRAQHLNGIKLVSDITAAKMNGCELGSCNLSFAPRIIKGGKYYADTGTAGSVVLLLQVSLPVLLFAEKASELILKGGTNADLAPQIDTTISVFKPIIQKMGVSFECNVIRRGYFPKGGGHVVFKVNPIDGFIKPIVLLDAGHVTAIKGYSYVAGVLPIKLAHEIADSAVKHLKSAFN---VPIKIDRVKESSEKAEGNGSGIVLVAETSTGCIIGSSAIGSRAVKPDKVGLNAADELISELK-SGGCVDSHIQDQLIIFMALAKGKSKIKSGPLTLHTKTAIHFCELLTNATFNVSEFDEGLKNFCIIECDGIGMNVND 365          
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Match: D6WSP1 (RNA 3'-terminal phosphate cyclase-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC010126 PE=3 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 1.839e-84
Identity = 151/348 (43.39%), Postives = 217/348 (62.36%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVEC 1143
            IDGS+LEGGGQI+RI+LT S I K+PI +  IR  R KPGL  QHL  ++LL+D+CNA++ GASL S  + F P  +  G++E   KTAGS+ L++Q+  P  LFAK  +TL L GGT+AE AP IDY   +    L K G   + +L++RG++P+GGG V ++I+     +  +N+T+RGQ++ +    FVAGTLP++++  M  +    +K   N     I    YKE  N A  N SG +L  ET  GC  G + +GKR  S E+ GK  A + ++  E    CVD H QDQI++FMALA+G SS+K  E+++H++T I+V E L   +F+I  V+K    I+ C
Sbjct:    8 IDGSMLEGGGQILRIALTLSVIRKIPIRLIKIRAGRSKPGLMEQHLKGIELLRDLCNAKVKGASLGSTEVEFWPGELTGGNHEARVKTAGSISLLLQAALPCCLFAKTHTTLRLHGGTNAEMAPQIDYTTEVFRPILEKFGATFNFDLLRRGYFPKGGGEVIINID-PVIKLDSVNLTERGQLVSIYGWSFVAGTLPVNMSHLMADSATHCLKRFCN----NIKIERYKELRNVAPDNCSGIILVAETDTGCVLGGSALGKRGESAEETGKRAAVELVKSIEE-GACVDGHSQDQIIVFMALAQGASSVKVGEITMHTKTAIFVAEELTDTRFEI--VQKGPANIINC 347          
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Match: A0A1S3JBT2 (RNA 3'-terminal phosphate cyclase OS=Lingula unguis OX=7574 GN=LOC106171736 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 2.415e-83
Identity = 145/356 (40.73%), Postives = 216/356 (60.67%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLGITCK 1167
            IDG ILEGGGQI+R +   S +   PI + NIR  R +PGL+ QHL  ++L++++C  +L G  + S  + F P  V  G +  D+KTAGS+CL+IQ   P  LFA   + + L GGT+A FAP +DY   +      + G+  S ++IKRG+YP+GGG V V  E     +  + +TDRG +IKV    FVAG LPI VAK M +   K+I+       + I   V KE  + A+G G+G +L  ETS GCR   + +G++ L  +D+G++ A   +   E+  GCVD ++QDQ++IFMALAKGKS I C  +SLH++T I+V + +   KF+++ ++  +   + CEG+G+  K
Sbjct:   41 IDGGILEGGGQILRNAAALSCLLGKPIHVNNIRAGRDRPGLRPQHLTGLELVQELCEGKLQGGQVSSTDITFFPGKVKSGTHVADTKTAGSICLLIQVSLPCQLFASGPTEMILKGGTNASFAPQLDYTIMVFKPIAERFGVNFSCDIIKRGYYPKGGGEVHVRTE-PVRCLHAVEMTDRGHVIKVTGIAFVAGVLPIKVAKTMASVARKMIEGRLG--QIPIQIEVVKEPQDHAVGTGTGVILVAETSTGCRLAGSALGQKGLPAQDVGESAATMLLTSLEH-GGCVDEYLQDQLIIFMALAKGKSVIMCGPISLHTETAIHVAQQMTQAKFEVKQIQ-GETWQITCEGMGLENK 391          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Cavefish
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:103035915])

HSP 1 Score: 246.128 bits (627), Expect = 9.790e-78
Identity = 143/365 (39.18%), Postives = 211/365 (57.81%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVE----KSKDVIVECEGLGIT 1161
            MA +   +DGS++EGGGQI+R+S   S I    + I  IR  R  PGL+ QHL+ ++LL+D+C+  L GA + S  +   P  +  G+Y  D++TAGSV L++Q   P  LF    S L L GGT+AE AP IDY   +      + G++   +L  RG+YP+GGG V V +      ++PIN+T+RG I K+    FVAG LP  +AK M T   + I+      ++ I S   K+   KA GNG+G ++  E+S GC F  + +GK+ +  + +G   AE  ++   + NGCVD  +QDQ++IFMALAKG S ++   ++LH+QT I+V E L   KF I   +     +   I+EC+G G T
Sbjct:    1 MAATTHEMDGSVMEGGGQILRVSAALSCIQGASLKINKIRAGRSTPGLRPQHLSGLELLRDMCDGNLEGAMVGSTEITLTPGKMKCGNYIADTQTAGSVGLLLQISLPCALFTGGPSELCLKGGTNAEMAPQIDYTLKVFKPIAERFGVQFDCDLRMRGYYPKGGGEVVVKVN-PVKELSPINMTERGNITKIYGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKDLYINIQSLQEKD---KACGNGNGIIIIAESSTGCIFAGSALGKKGVYADKVGIEAAEMLLKNIRH-NGCVDEFLQDQLIIFMALAKGTSRMRTGPITLHTQTAIHVAEQLTKAKFAIHKADDEHANNDTYIIECQGTGAT 360          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Cavefish
Match: rcl1 (RNA terminal phosphate cyclase like 1 [Source:NCBI gene;Acc:103037504])

HSP 1 Score: 62.003 bits (149), Expect = 3.328e-10
Identity = 84/366 (22.95%), Postives = 145/366 (39.62%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGGLV--SVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVE----TSLGCRFGFNIVGKRD-LSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKD-------VIVECEGLGIT 1161
            G    R  L  S++    + I  IR +  +PGL++   + ++LL  V N      +     L + P  +  G  E +     S+   ++ +     F K      L G T+    P +D  +      + K GI+   + I ++KRG  P GGG V  S  + R    +   +    G+I ++    +      + V+ QM   I    +S  NK    + I ++  K   +     G G +L  E    T L         G+ D +  E++GKN A+  ++      GCVD   Q   L++M L +   S      LS ++   +  + +   + F I+T    +D       V++ C G G T
Sbjct:    8 GCNFFRQRLILSTLSGKRVKIREIRSREDEPGLRDFEASFIRLLDKVTNGTRIEINQTGTVLFYQPGLLYGGSVEHECNLQRSIGYYLEGLLMLAPFMKNSLKAVLKGVTNDPTDPSVDLLKATAIPLMKKFGIDGEGLEIKVVKRGIAPHGGGEVHFSCPVRRTLKPVLLTDP---GKIKRIRGTAY-----SVRVSPQMANRIVDSARSILNKLIPDIYIYTDHMKGA-SSGKSPGFGLVLVAETLNGTCLSAELSSTPQGRGDQMLPEELGKNCAKLLLEEIYR-GGCVDSTNQSLALLYMTLGQQDVSKTLLGPLSPYTIEFLRHIRDFFQIMFKIETQTADEDQQKGGDKVLMTCVGAGYT 363          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Sea Lamprey
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 224.942 bits (572), Expect = 4.077e-70
Identity = 127/359 (35.38%), Postives = 200/359 (55.71%), Query Frame = 1
Query:  100 IDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMAL-AKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVE----KSKDVIVECEGLGIT 1161
            +DG  LEGGGQI+R+S   S I   PI +  IR  RPKPGL+ QHL  +  L+D+C   L GA + S  +   P  +  G +  D++TAGSVCL++QS  P +LFA   S LTL GGT+   AP IDY   +   +  K GI+   ++  RG+ P+GGG + +        + PI +T+RG I K+    +VAG LPI +AK    T  + +K  + +R + +  +  +E    A GNG+G ++  ETS GC F  + +G+R ++ E +G N AE  +    +  GCVD H+QDQ+L F+ + +  K + +   +S ++ T + ++ +    +F +   E     +   I+EC+G+G +
Sbjct:    9 VDGDTLEGGGQILRVSSALSCILGKPIHLTKIRAGRPKPGLRPQHLMGLSTLRDLCGGRLVGAEINSCEVTLYPGQIQGGSHRADTQTAGSVCLMVQSTLPCILFAARPSALTLRGGTNVSHAPQIDYTTTVFKPFAEKFGIKFDCDVRIRGYEPKGGGELVLSTA-PVRNLEPITVTERGDITKIYGRAYVAGVLPIKMAKDAAATALRKLK--QEFRDINVNISAVQEPRQGAFGNGNGIIVFAETSTGCIFAGDALGRRGVTPEQLGTNAAEMLLSNIRH-GGCVDEHLQDQLLGFVLIKSSSKKAGQFGRVSQNTLTALLLIFHFAEARFTVSKTESQLPNADAYIIECQGMGAS 363          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Sea Lamprey
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc:ZDB-GENE-030131-9687])

HSP 1 Score: 218.779 bits (556), Expect = 9.232e-68
Identity = 124/355 (34.93%), Postives = 198/355 (55.77%), Query Frame = 1
Query:  112 ILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMAL-AKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVE----KSKDVIVECEGLGIT 1161
            ++EGGGQI+R+S   S I   PI +  IR  RPKPGL+ QHL  +  L+D+C   L GA + S  +   P  +  G +  D++TAGSVCL++QS  P +LFA   S LTL GGT+   AP IDY   +   +  K GI+   ++  RG+ P+GGG + +        + PI +T+RG I K+    +VAG LPI +AK    T  + +K  + +R + +  +  +E    A GNG+G ++  ETS GC F  + +G+R ++ E +G N AE  +    +  GCVD H+QDQ+L F+ + +  K + +   +S ++ T + ++ +    +F +   E     +   I+EC+G+G +
Sbjct:   12 LVEGGGQILRVSSALSCILGKPIHLTKIRAGRPKPGLRPQHLMGLSTLRDLCGGRLVGAEINSCEVTLYPGQIQGGSHRADTQTAGSVCLMVQSTLPCILFAARPSALTLRGGTNVSHAPQIDYTTTVFKPFAEKFGIKFDCDVRIRGYEPKGGGELVLSTA-PVRNLEPITVTERGDITKIYGRAYVAGVLPIKMAKDAAATALRKLK--QEFRDINVNISAVQEPRQGAFGNGNGIIVFAETSTGCIFAGDALGRRGVTPEQLGTNAAEMLLSNIRH-GGCVDEHLQDQLLGFVLIKSSSKKAGQFGRVSQNTLTALLLIFHFAEARFTVSKTESQLPNADAYIIECQGMGAS 362          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Yeast
Match: RCL1 (Endonuclease that cleaves pre-rRNA at site A2 for 18S rRNA biogenesis; subunit of U3-containing 90S preribosome processome complex involved in small ribosomal subunit assembly; stimulates Bms1p GTPase and U3 binding activity; similar to RNA cyclase-like proteins but no cyclase activity detected [Source:SGD;Acc:S000005370])

HSP 1 Score: 53.9138 bits (128), Expect = 1.667e-8
Identity = 74/356 (20.79%), Postives = 158/356 (44.38%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHG---HYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGI-EISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSL-GCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAK---GKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKS--KDVIVECEGLGIT 1161
            G Q  R+ +  +++   PI IE IR     PGL++  ++ ++L++ V N  +   S    ++ + P  +  G   H    SK  G     +  +AP   F+K+  ++   G T +     I+  +  +   + K G+ E +++ +KRG  P GGG V + ++ +      ++  DR  I  +    +     P S+  +M    +KV+K+ +    + I ++V++   N     G G  L  ++   G  +    +G      E++G+ VA Q ++    S   V  +     +++M + K   G+  I   ++       +  ++ +   +  ++ V+++  +D+I   +G+G T
Sbjct:   13 GSQNFRLRIVLATLSGKPIKIEKIRSGDLNPGLKDYEVSFLRLIESVTNGSVIEISYTGTTVIYRPGIIVGGASTHICPSSKPVGYFVEPMLYLAP---FSKKKFSILFKGITASHNDAGIEAIKWGLMPVMEKFGVRECALHTLKRGSPPLGGGEVHLVVDSLIAQPITMHEIDRPIISSITGVAYSTRVSP-SLVNRMIDGAKKVLKNLQC--EVNITADVWRGE-NSGKSPGWGITLVAQSKQKGWSYFAEDIGDAGSIPEELGEKVACQLLEEISKS-AAVGRNQLPLAIVYMVIGKEDIGRLRINKEQIDERFIILLRDIKKIFNTEVFLKPVDEADNEDMIATIKGIGFT 360          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Nematostella
Match: EDO40575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6R8])

HSP 1 Score: 240.736 bits (613), Expect = 3.056e-76
Identity = 125/349 (35.82%), Postives = 204/349 (58.45%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGG--LVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTV--EKSKDVIVECEGLGI 1158
            GGQI+R S+T + +    I++ NIR  R  PGL+ QH+  ++L++D+C  +L G  + S S+   P  +  G +  ++KTAGS+CL++Q   P LL+A   S L L GGTDAE APPIDY   +      K+G++    +I+RG++P+GGG  LV+VD+ +    +  +     G +++   + +VAG +P  VA+ M     K+IK  + Y    I  +  +E+ +KA GNG+G  +  ET+ GCR   + +G++ +  E +  +      +  + S GCVD H+QDQ++I MALA GKS +K   L++H++T IYV E +   +F + +   E     I+EC+G+G+
Sbjct:    1 GGQIMRNSVTFACLLNRVINVYNIRAGRTNPGLRPQHMTGLQLVRDICCGKLEGDCVGSCSITLNPSKLQSGTFSANTKTAGSICLLMQVALPCLLYAPSASQLILKGGTDAEMAPPIDYMTQVFKPAAEKLGVKFHCTIIRRGYFPKGGGEVLVNVDVVKSLKPVQLVEF---GSLLRFTGKAWVAGVIPYKVAQTMAREATKLIK--RRYPDTPINIDAVQESRHKAHGNGTGIQVMAETTTGCRIAASALGRKGVPSEQVASDAVSDLTRNLD-SGGCVDEHLQDQLIILMALANGKSRVKTGPLTMHTKTAIYVAERITKARFKVTSCSDEGHDASIIECDGIGL 343          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Nematostella
Match: EDO36080 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP5])

HSP 1 Score: 133.65 bits (335), Expect = 1.858e-34
Identity = 98/342 (28.65%), Postives = 169/342 (49.42%), Query Frame = 1
Query:  157 SSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEM-----STLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQT--VEKSKDVIVECEGLGIT 1161
            ++I  LP+ + NI G +   GLQ   +  + LL+ +C+  L  AS  S ++ F P  +  G +  +   +GSV L+ +S  P L  A E      + L L G T       +D++  +    + K G   SI + +R ++P+  G V +        +  +++T  G+++K+     VAG  PI +A+ M       +K    +  + I     +E  ++  G G   M+  ETS G       + +R +S E++ +     F Q   +S  CVD  +QD++L +MALAKG+SSI+ S ++ H++  I  LE +  VKF + +  +  SK +++ C GLGIT
Sbjct:  174 NTILGLPVRLNNIHGPKASYGLQPHDVRMLHLLRQMCSGTLV-ASKGSSTVTFLPGDLQAGIFSSEGGHSGSVSLLAESALPCLALAPEPVYSRNNILNLKGITHLANGLHMDFFDKVYRPIVEKFGFHFSIEIKRRSYFPQSSGKVVIR-SFPVTNLKAVDLTTPGRLVKITGWTSVAGAKPIRIAQVMSKLTRSALKDR--FPGVDIYVESLRERDSRVDGTGQAVMILGETSSGMMLSGTALWRRGMSNEEVVQKAVNMFTQNSSHSI-CVDSLVQDKLLPYMALAKGQSSIRTSLITPHTKAAIAGLEAMSKVKFQVTSDVIGGSKTMVISCNGLGIT 510          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Nematostella
Match: EDO31302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA4])

HSP 1 Score: 62.7734 bits (151), Expect = 8.322e-11
Identity = 78/370 (21.08%), Postives = 150/370 (40.54%), Query Frame = 1
Query:  124 GGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGI---EISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPN-----KAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDI----------QTVEKSKDVIVECEGLGIT 1161
            G    R  L  +++    + I NIR +   PGL++     ++LL  V N      +    SL + P  ++ G  + D     S+   ++++     F K+   +T+ G T+    P +D  + +    + +  I   +  + + KRG  P GGG ++     +   + PI + D G+I ++    +     P          + +V+ + +   +   +S++Y  T +         +G G  L  ET+ G   G          G     ED+GK  A++ +Q      GCVD   Q   L++MA+ +   S +    L+ ++   +  +++ +G+ F I                  V++ C GLG T
Sbjct:    9 GCNFFRQRLVLATLSGKSVRIRNIRIQEDDPGLKDFEANFIRLLDKVTNGSRIEVNETGTSLLYKPGLLSGGVVDHDCGLQRSIGFYLEALVYLAPFCKKPLRVTMRGITNDSDDPSVDIIKTVTIPLMKRFIIDDEDFYLKITKRGSPPEGGGQITFSCP-VRKVLRPIQLIDPGKIKRIRGLAYATRVSP--------AMVNRVVDATRGVLN-QFISDIYIYTDHCQGIQAGKSSGFGLSLVAETTNGTLLGVQRASTPSGKGSPTVAEDLGKETAKKLLQEVYK-GGCVDSRHQSLALLYMAMGQQDVSRVLTGPLTPYTIQFLRHMKDFLGIMFKIQAQQKQDDDDSKSGGDTKVLLSCVGLGFT 367          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Medaka
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:101167358])

HSP 1 Score: 253.832 bits (647), Expect = 1.198e-80
Identity = 143/364 (39.29%), Postives = 209/364 (57.42%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVE----KSKDVIVECEGLGI 1158
            M ++   IDGS++EGGGQI+R+S   S I    I I  IR  R  PGL+ QHL+ ++L+ D+C+  L GAS+ S  +   P  +  G +  D +TAGSVCL++Q   P  +FA   S L L GGT+AE AP IDY   +    + + GI    ++  RG+YP+GGG V+V +      + P+ +T+RG I K+    FVAG LP  +AK M T   + I+      ++ I +   KE   KA GNG+G ++  E+S GC F  + +GK+ +  + +G   AE  ++   + NGCVD  +QDQ++IFMALAKG S I+   ++LH+QT I++ E L   KF I   E     S   I+EC G G+
Sbjct:    1 MDSTAVEIDGSVMEGGGQILRVSAALSCITGTAIKITKIRAGRSTPGLRPQHLSGLQLVSDLCSGSLQGASIGSTDVSLTPGKIRSGSHVADPQTAGSVCLLLQVALPCAVFADAASQLCLKGGTNAEMAPQIDYTLKVFKPIVERFGINFDCDVKMRGYYPKGGGEVNVTVN-PVKELRPVTLTERGNITKIHGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKELYINIQALQEKE---KACGNGNGIIIIAESSTGCLFAGSALGKKGVYADKVGIEAAEMLLRNIRH-NGCVDEFLQDQLIIFMALAKGTSRIRTGAVTLHTQTAIHIAEQLTQAKFTISKCEDEMSSSVTYIIECHGSGV 359          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Medaka
Match: rtca (RNA 3'-terminal phosphate cyclase [Source:NCBI gene;Acc:101167358])

HSP 1 Score: 243.432 bits (620), Expect = 6.465e-77
Identity = 134/341 (39.30%), Postives = 200/341 (58.65%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFD 1101
            M ++   IDGS++EGGGQI+R+S   S I    I I  IR  R  PGL+ QHL+ ++L+ D+C+  L GAS+ S  +   P  +  G +  D +TAGSVCL++Q   P  +FA   S L L GGT+AE AP IDY   +    + + GI    ++  RG+YP+GGG V+V +      + P+ +T+RG I K+    FVAG LP  +AK M T   + I+      ++ I +   KE   KA GNG+G ++  E+S GC F  + +GK+ +  + +G   AE  ++   + NGCVD  +QDQ++IFMALAKG S I+   ++LH+QT I++ E L  V+ +
Sbjct:    1 MDSTAVEIDGSVMEGGGQILRVSAALSCITGTAIKITKIRAGRSTPGLRPQHLSGLQLVSDLCSGSLQGASIGSTDVSLTPGKIRSGSHVADPQTAGSVCLLLQVALPCAVFADAASQLCLKGGTNAEMAPQIDYTLKVFKPIVERFGINFDCDVKMRGYYPKGGGEVNVTVN-PVKELRPVTLTERGNITKIHGRAFVAGVLPFKLAKDMSTAAVRTIRKEIKELYINIQALQEKE---KACGNGNGIIIIAESSTGCLFAGSALGKKGVYADKVGIEAAEMLLRNIRH-NGCVDEFLQDQLIIFMALAKGTSRIRTGAVTLHTQTAIHIAEQLTQVRAN 336          
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Medaka
Match: rcl1 (RNA terminal phosphate cyclase like 1 [Source:NCBI gene;Acc:101160824])

HSP 1 Score: 76.6406 bits (187), Expect = 5.409e-15
Identity = 90/381 (23.62%), Postives = 152/381 (39.90%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE---ISINLIKRGFYPRGGG--LVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKS--NKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSG-----EDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGK-SSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKD-------VIVECEGLGIT 1161
            MAN   + +G         +R  L  S++    + I+NIR K   PGL++   + ++LL  V N      +     L + P  +  G  E D     S+   ++++     F K     TL G T+    P ID  +      + + GI+     + ++KRG  P GGG  ++S  I R    +         +I  VA          + V+ QM   I +  ++  N+    + I ++  K   N     G G  L  ET  GC  G  +       G     ED+G+N A+  ++      GCVD   Q   L+ M L +   S +    LS ++   +  + +   V F I+  +  +D       V++ C G+G +
Sbjct:    1 MANQGLSYEGC------NFLRQRLVLSTLSGKRVRIKNIRSKEDDPGLRDFEASFIRLLDKVTNGSRIEINQTGTVLSYQPGLLYGGSIEHDCNPQRSIGYYLEALLMLAPFMKMALKATLRGVTNDPNDPTIDLLKTTAVPLMKRFGIDGEGFDLRVVKRGMAPGGGGEVVLSCPIRRTLKPVQLTEQAKIKRIRGVAYS--------VRVSPQMANRIVESTRAVLNQFIPDIYIYTDHMKGA-NSGKSPGFGLTLVAETQNGCFLGAEMSSTPQGQGDPILPEDLGRNCAKLLLEEIYRG-GCVDSSNQSLALLLMTLGQQDVSKVLLGPLSAYTIEFLRHVRDFFQVMFKIEVQKPLEDERKSGDKVLMTCVGVGYS 365          
BLAST of RNA 3'-terminal phosphate cyclase vs. Planmine SMEST
Match: SMESG000041894.1 (SMESG000041894.1)

HSP 1 Score: 711.835 bits (1836), Expect = 0.000e+0
Identity = 363/365 (99.45%), Postives = 364/365 (99.73%), Query Frame = 1
Query:   79 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERXXXXXXXXXXXXRGQIIKVASECFVAGTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLGITCKEY 1173
            MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERINDTITPINITDRGQIIKVASECFVAGTLPISVAKQMCT IEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMG+NVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLGITCKEY
Sbjct:    1 MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQNQHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVCLIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIEISINLIKRGFYPRGGGLVSVDIERINDTITPINITDRGQIIKVASECFVAGTLPISVAKQMCTAIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCMLTVETSLGCRFGFNIVGKRDLSGEDMGENVAEQFIQFFENSNGCVDIHMQDQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKDVIVECEGLGITCKEY 365          
The following BLAST results are available for this feature:
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RTCA2.526e-8239.07RNA 3'-terminal phosphate cyclase [Source:HGNC Sym... [more]
RTCA9.658e-7937.73RNA 3'-terminal phosphate cyclase [Source:HGNC Sym... [more]
RTCA2.246e-846.94RNA 3'-terminal phosphate cyclase [Source:HGNC Sym... [more]
RCL19.899e-722.43RNA terminal phosphate cyclase like 1 [Source:HGNC... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZK1127.52.191e-723.19Probable RNA 3'-terminal phosphate cyclase-like pr... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Rtca2.359e-7335.75gene:FBgn0025630 transcript:FBtr0070330[more]
Rtca2.359e-7335.75gene:FBgn0025630 transcript:FBtr0344156[more]
Rtc11.501e-720.74gene:FBgn0020909 transcript:FBtr0073820[more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rtca1.693e-8039.84RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
rcl13.078e-1624.50RNA terminal phosphate cyclase-like 1 [Source:NCBI... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rtca1.922e-7638.94RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rtca1.531e-7438.50RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rtca1.322e-7038.64RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rtca5.094e-5838.59RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
supt6h1.232e-921.70SPT6 homolog, histone chaperone [Source:Xenbase;Ac... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rtca5.701e-8439.45RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
Rtca9.919e-2238.24RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
Rtca2.066e-1939.58RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
Rtca2.810e-743.75RNA 3'-terminal phosphate cyclase [Source:MGI Symb... [more]
Rcl11.394e-621.62RNA terminal phosphate cyclase-like 1 [Source:MGI ... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D7H3|RTCA_MOUSE3.988e-8339.45RNA 3'-terminal phosphate cyclase OS=Mus musculus ... [more]
sp|Q2HJ88|RTCA_BOVIN3.023e-8239.62RNA 3'-terminal phosphate cyclase OS=Bos taurus OX... [more]
sp|Q4R3J0|RTCA_MACFA4.803e-8239.34RNA 3'-terminal phosphate cyclase OS=Macaca fascic... [more]
sp|O00442|RTCA_HUMAN1.213e-8139.07RNA 3'-terminal phosphate cyclase OS=Homo sapiens ... [more]
sp|Q5R7P3|RTCA_PONAB4.976e-8038.52RNA 3'-terminal phosphate cyclase OS=Pongo abelii ... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5N5ST042.502e-9145.63RNA 3'-terminal phosphate cyclase OS=Armadillidium... [more]
A0A444SLU56.160e-8745.80RNA 3'-terminal phosphate cyclase OS=Armadillidium... [more]
A0A443ST739.548e-8642.70RNA 3'-terminal phosphate cyclase-like protein OS=... [more]
D6WSP11.839e-8443.39RNA 3'-terminal phosphate cyclase-like Protein OS=... [more]
A0A1S3JBT22.415e-8340.73RNA 3'-terminal phosphate cyclase OS=Lingula ungui... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rtca9.790e-7839.18RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rcl13.328e-1022.95RNA terminal phosphate cyclase like 1 [Source:NCBI... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rtca4.077e-7035.38RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
rtca9.232e-6834.93RNA 3'-terminal phosphate cyclase [Source:ZFIN;Acc... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RCL11.667e-820.79Endonuclease that cleaves pre-rRNA at site A2 for ... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO405753.056e-7635.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360801.858e-3428.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313028.322e-1121.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rtca1.198e-8039.29RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rtca6.465e-7739.30RNA 3'-terminal phosphate cyclase [Source:NCBI gen... [more]
rcl15.409e-1523.62RNA terminal phosphate cyclase like 1 [Source:NCBI... [more]
back to top
BLAST of RNA 3'-terminal phosphate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000041894.10.000e+099.45SMESG000041894.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013694 ID=SMED30013694|Name=RNA 3'-terminal phosphate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=1275bp
AGTTGACCTACATTTTAGAGTAGATATTTTGTTTCTAAAGTTATTTATGA
AATTCAGATATTTTTCTGAAGTATAATTATGGCAAATAGCAATTTTACTA
TTGATGGTAGCATTTTAGAAGGAGGAGGACAAATAATCCGAATATCTCTA
ACATGTAGTTCAATTTGTAAGCTACCTATTTCCATAGAAAATATTCGTGG
AAAAAGACCCAAACCTGGTTTACAAAATCAACATTTAGCAAGTGTAAAAT
TGCTCAAAGATGTGTGCAATGCTGAATTAACTGGAGCTAGTTTGCAATCA
ATTTCTCTCCGGTTTGCTCCAAAAACTGTAAATCACGGACATTACGAAGT
GGATTCCAAAACAGCAGGTTCCGTTTGTTTGATTATTCAATCTATCGCTC
CTACATTATTGTTCGCTAAAGAAATGTCAACTTTGACATTGATCGGTGGA
ACTGATGCTGAATTTGCCCCACCAATAGATTACTACAGAAATATCGTTCC
ATTTTACCTAGCGAAAATGGGAATTGAAATTTCCATAAATTTAATTAAAA
GAGGATTTTATCCACGTGGCGGCGGACTTGTTAGTGTAGATATTGAAAGA
ATAAACGACACCATAACACCGATAAATATCACCGATAGAGGACAGATTAT
AAAAGTCGCTTCTGAATGTTTTGTTGCGGGAACATTGCCCATATCGGTTG
CCAAGCAAATGTGTACAACAATTGAAAAAGTTATAAAGTCAAATAAGAAT
TATCGTCACTTGACTATATTATCAAATGTTTATAAAGAAACTCCAAATAA
AGCCATTGGGAATGGTTCGGGATGTATGTTAACTGTTGAAACGTCGCTAG
GATGCCGGTTCGGTTTTAATATTGTTGGCAAACGTGATTTGTCAGGAGAG
GACATGGGGAAAAATGTTGCCGAACAGTTCATTCAGTTTTTTGAGAATTC
TAACGGCTGTGTCGACATACATATGCAAGATCAGATTTTGATTTTCATGG
CATTGGCTAAAGGGAAATCGTCAATAAAATGCAGCGAACTGAGTCTTCAT
TCTCAGACTTGCATTTATGTGCTTGAAAATTTGATTGGAGTGAAATTTGA
CATCCAGACAGTGGAAAAGTCAAAAGATGTTATTGTTGAATGCGAAGGAT
TGGGGATTACATGCAAGGAATATTAGACATGCTTTCTGATTAGGCAGTTT
ATTTCTGTTTAAACCGAAATTTTCAATGCTCTATAAAATTTGGATCTTTT
GGAAATTGTGAAATGTGATTTGGCT
back to top

protein sequence of SMED30013694-orf-1

>SMED30013694-orf-1 ID=SMED30013694-orf-1|Name=SMED30013694-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MANSNFTIDGSILEGGGQIIRISLTCSSICKLPISIENIRGKRPKPGLQN
QHLASVKLLKDVCNAELTGASLQSISLRFAPKTVNHGHYEVDSKTAGSVC
LIIQSIAPTLLFAKEMSTLTLIGGTDAEFAPPIDYYRNIVPFYLAKMGIE
ISINLIKRGFYPRGGGLVSVDIERINDTITPINITDRGQIIKVASECFVA
GTLPISVAKQMCTTIEKVIKSNKNYRHLTILSNVYKETPNKAIGNGSGCM
LTVETSLGCRFGFNIVGKRDLSGEDMGKNVAEQFIQFFENSNGCVDIHMQ
DQILIFMALAKGKSSIKCSELSLHSQTCIYVLENLIGVKFDIQTVEKSKD
VIVECEGLGITCKEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036553RPTC_insert
IPR017770RNA3'_term_phos_cyc_type_1
IPR037136RNA3'_phos_cyclase_dom_sf
IPR000228RNA3'_term_phos_cyc
IPR023797RNA3'_phos_cyclase_dom
IPR013791RNA3'-term_phos_cycl_insert
IPR020719RNA3'_term_phos_cycl-like_CS
IPR013792RNA3'P_cycl/enolpyr_Trfase_a/b
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003963RNA-3'-phosphate cyclase activity
GO:0005524ATP binding
GO:0016874ligase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000228RNA 3'-terminal phosphate cyclasePIRSFPIRSF005378RNA_3-term_P_cyclasecoord: 2..362
e-value: 2.0E-115
score: 383.2
IPR000228RNA 3'-terminal phosphate cyclasePANTHERPTHR11096RNA 3' TERMINAL PHOSPHATE CYCLASEcoord: 3..361
IPR036553RNA 3'-terminal phosphate cyclase, insert domain superfamilyGENE3DG3DSA:3.30.360.20coord: 187..289
e-value: 5.2E-107
score: 359.6
IPR036553RNA 3'-terminal phosphate cyclase, insert domain superfamilySUPERFAMILYSSF52913RNA 3'-terminal phosphate cyclase, RPTC, insert domaincoord: 186..290
IPR013791RNA 3'-terminal phosphate cyclase, insert domainPFAMPF05189RTC_insertcoord: 185..286
e-value: 2.0E-13
score: 50.7
IPR017770RNA 3'-terminal phosphate cyclase type 1TIGRFAMTIGR03399TIGR03399coord: 7..341
e-value: 3.8E-104
score: 346.3
IPR017770RNA 3'-terminal phosphate cyclase type 1PANTHERPTHR11096:SF0RNA 3'-TERMINAL PHOSPHATE CYCLASEcoord: 3..361
IPR023797RNA 3'-terminal phosphate cyclase domainPFAMPF01137RTCcoord: 13..342
e-value: 5.2E-80
score: 268.0
IPR037136RNA 3'-terminal phosphate cyclase domain superfamilyGENE3DG3DSA:3.65.10.20coord: 8..340
e-value: 5.2E-107
score: 359.6
IPR020719RNA 3'-terminal phosphate cyclase-like, conserved sitePROSITEPS01287RTCcoord: 158..168
IPR013792RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/betaSUPERFAMILYSSF55205EPT/RTPC-likecoord: 293..347
IPR013792RNA 3'-terminal phosphate cyclase/enolpyruvate transferase, alpha/betaSUPERFAMILYSSF55205EPT/RTPC-likecoord: 7..185