Small HSP protein

Overview
NameSmall HSP protein
Smed IDSMED30013692
Length (bp)1051
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Small HSP protein (SMED30013692) t-SNE clustered cells

Violin plots show distribution of expression levels for Small HSP protein (SMED30013692) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Small HSP protein (SMED30013692) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Small HSP protein (SMED30013692) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013692

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013692SMESG000055935.1 Contig651GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30013692SMESG000055935.1 Contig651GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 Contig651GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 Contig651GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 SmedASXL_016637SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 SMED30013692smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 Contig41295newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 Contig41295uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v6_1039_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v6_1039_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 dd_Smed_v4_1039_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 SMED_02480_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30013692SMESG000059879.1 SMESG000059868.1 SMESG000059853.1 SMED_02480_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Small HSP protein vs. Ensembl Celegans
Match: hsp-16.2 (Heat shock protein Hsp-16.2 [Source:UniProtKB/Swiss-Prot;Acc:P06582])

HSP 1 Score: 47.3654 bits (111), Expect = 1.414e-6
Identity = 27/95 (28.42%), Postives = 54/95 (56.84%), Query Frame = 1
Query:  652 WRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESG 936
            + + +NV + FK +D+K+    + + ++ ++E KTD+  S +    V+ LPE ++   + S L ++G+L IEAP K+        +G+ IP++  
Sbjct:   32 FAINLNVSQ-FKPEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKKEAV------QGRSIPIQQA 119          
BLAST of Small HSP protein vs. Ensembl Celegans
Match: hsp-16.2 (Heat shock protein Hsp-16.2 [Source:UniProtKB/Swiss-Prot;Acc:P06582])

HSP 1 Score: 47.7506 bits (112), Expect = 1.517e-6
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  532 IWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESG 936
            ++G+L R    M         +S     E V ++ K    + + +NV + FK +D+K+    + + ++ ++E KTD+  S +    V+ LPE ++   + S L ++G+L IEAP K+        +G+ IP++  
Sbjct:   14 VFGDLMRDMALMERQFAPVCRISPSESSEIVNNDQK----FAINLNVSQ-FKPEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKKEAV------QGRSIPIQQA 137          
BLAST of Small HSP protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0307161)

HSP 1 Score: 46.9802 bits (110), Expect = 3.859e-6
Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  235 NNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEED----FAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAP 465
            N +      ++ Y P EI +K       + K++VHAKH  + D    + E+ +   +PK V+ E++RS+++K+G+L + AP
Sbjct:   63 NKVLKLRFDVSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 138          
BLAST of Small HSP protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0074733)

HSP 1 Score: 46.9802 bits (110), Expect = 4.683e-6
Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  235 NNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEED----FAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAP 465
            N +      ++ Y P EI +K       + K++VHAKH  + D    + E+ +   +PK V+ E++RS+++K+G+L + AP
Sbjct:   92 NKVLKLRFDVSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 167          
BLAST of Small HSP protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0345918)

HSP 1 Score: 46.9802 bits (110), Expect = 4.683e-6
Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  235 NNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEED----FAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAP 465
            N +      ++ Y P EI +K       + K++VHAKH  + D    + E+ +   +PK V+ E++RS+++K+G+L + AP
Sbjct:   92 NKVLKLRFDVSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 167          
BLAST of Small HSP protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0074734)

HSP 1 Score: 46.9802 bits (110), Expect = 5.418e-6
Identity = 25/81 (30.86%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  235 NNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEED----FAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAP 465
            N +      ++ Y P EI +K       + K++VHAKH  + D    + E+ +   +PK V+ E++RS+++K+G+L + AP
Sbjct:  101 NKVLKLRFDVSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 176          
BLAST of Small HSP protein vs. TrEMBL
Match: H1ZWN3 (Small HSP protein (Fragment) OS=Dugesia japonica OX=6161 GN=smallhsp PE=2 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 2.558e-100
Identity = 143/190 (75.26%), Postives = 167/190 (87.89%), Query Frame = 1
Query:  394 PKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN 963
            P NVD+ENLRS MTK+G+LVLKAPYK +E S V PIK+NRED W+GIWGELGRLNDQMN MIDFGG  SH PR EFV D+NKESGTWRM +NVGKDF SDDIKL+HQN EI+LEAKKE+K  +S SSRYIKEVL+LPEGIE+DK++SKL+DNGQL+IEAPCKKMP++   D+GKVIPVESGD +KMA++N
Sbjct:    1 PSNVDNENLRSIMTKDGVLVLKAPYKNTESSSVNPIKLNREDNWNGIWGELGRLNDQMNQMIDFGGIFSHHPRTEFVADDNKESGTWRMKVNVGKDFTSDDIKLKHQNNEIHLEAKKESKGQDSISSRYIKEVLTLPEGIEQDKIHSKLMDNGQLIIEAPCKKMPNLIRGDEGKVIPVESGDISKMAINN 190          
BLAST of Small HSP protein vs. TrEMBL
Match: A0A267DQU2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005128g1 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 3.413e-20
Identity = 64/230 (27.83%), Postives = 119/230 (51.74%), Query Frame = 1
Query:  226 PKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRL-------NDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVG-KDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPS 891
            PKR   W+ S+ + G++P+E+++K +       K+ + A+H + ED  E K+ I +P++VD E L S  T+EG+L+L+AP+K  E    +  ++ ++ T + +W EL  L        D M H+ D  G                  G  R    +  ++FK ++I++R Q   + +EA+ + +       + ++ +  LP+G + D++ SKL  +G+L I AP +  P+
Sbjct:   61 PKRPRQWTRSVDLRGFEPSEVSVKRDG-----CKMRIAARHEDGEDVTEVKRTIDVPEDVDVEKLSSGFTREGILLLQAPFK-EELRDQQQQQLQKQKTENSVWDELRELLRAPDISQDSMGHVEDVDG------------------GGKRFCAELSVREFKPEEIRVRQQGDCVLVEAEHKEEAGGQRVYKKLERIFQLPDGTKLDQVASKLSHDGRLTILAPFEAPPA 266          
BLAST of Small HSP protein vs. TrEMBL
Match: A0A267EKQ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011207g2 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 4.222e-20
Identity = 69/264 (26.14%), Postives = 136/264 (51.52%), Query Frame = 1
Query:  118 YYSFCFIL*LKLMFRFLDEPIFNSLYWPEYS-HHVIYPKRNNL-----WSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLN-DQMNHMIDFGGALS-HQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKM 885
            + SF +   ++ +F   ++   ++L+ P Y     + PKR+       +ST++ ++ ++ +E+A+K E     + K+ +HAK    ED +E +K + +P++VD + + + MTKEG LV++APY  +E S             S    +LG  + D+M  ++   G  S H+   + V DE      +++T+ V +DF  +++ +R     + + A+   + +     R +    +LP+G++ ++L S+L D G L IEAP   +
Sbjct:   10 FKSFEYPNRMQSIFEDFNDLFSDALFHPFYELERNLQPKRHRAAHHRYFSTAVKLSDFRADEVAVKVE-----DRKVRIHAKRQEGEDMSEVRKTVALPEDVDADKVETRMTKEGFLVVRAPYIRAEKSG--------SGDASNALAQLGANSWDEMRSLLRGPGITSVHE---QLVKDEKTGETRFQVTVPV-RDFHPEEVTVRQVGDRVVVRAEHRDEREGQLVHRSMHREFTLPQGVDRERLVSRLTDCGTLQIEAPAPNL 256          
BLAST of Small HSP protein vs. TrEMBL
Match: T1EE30 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20194832 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.874e-12
Identity = 58/222 (26.13%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  241 LWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFA------EFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKI-SEDSVVKPIK----INREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAP 873
            ++  S  ++ + P+EI +K +       K+IV AKH  EE         EF + + IP NVD   L+ST++K+G+L ++AP  I + D++   +     + R  T   +     +L+   N M   G AL     +     E +    +R+ I++G DF  DD+ ++  ++++ + AK +  T   +S +       LP+ ++ + + + L   G+L++EAP
Sbjct:   64 VFRVSFDVSQFSPDEINVKTQDN-----KLIVQAKH--EEKGGDKTISREFSRQVDIPSNVDPLKLQSTLSKDGILQVEAPVCIPTYDTITSTVNSGNNLERTTTQHPVTFTDIKLS---NIMPGLGSALDKDSCIS----EQEGKKIFRIAIDIGTDFVPDDLMVKTVDRKLSVHAKHQEVTATKTSCKEFSREFDLPDTVDPNTVTASLTAEGRLLLEAP 271          
BLAST of Small HSP protein vs. TrEMBL
Match: A0A419PWF5 (Major egg antigen OS=Clonorchis sinensis OX=79923 GN=CSKR_13512s PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.360e-9
Identity = 66/229 (28.82%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  262 ITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFA----EFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWS---GIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPD--ENKESGTWRMTINVGKD--FKSDDIKLRHQNKEIYLEAKKET--KTDNSSSSRYIKEV---LSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGH 900
            + GY P++I     K    +  + VHAK V + D A    E+ + I +PK+VD + L   +T++G+L+L+AP K ++    K I  +R+   S       E+G+     +       AL+ QP     P   ++ +SG  ++ + +  D  F +DD+ +R     + +  KK+T  KT NSSS+ ++KE      +P+ ++   +N++ L  G+L++EAP  + PSI  
Sbjct:   86 LQGYGPDDI-----KVSTSDNGVTVHAKKVVQTDRALSSREYSRTIYLPKSVDKKQLECHLTEDGVLMLEAPVKAAD---YKSITFDRDRQVSIKPHSETEVGQKRKSED-------ALAIQPTGILGPTVLKDDKSGGEKLHVEIPVDPEFSADDLCVRMDANRVVVSGKKKTVDKTGNSSST-FVKEFSRSYDVPQTVDTFSVNAQ-LQGGKLLVEAPLLR-PSISQ 296          
BLAST of Small HSP protein vs. Ensembl Nematostella
Match: EDO40917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5R0])

HSP 1 Score: 44.669 bits (104), Expect = 2.205e-6
Identity = 28/82 (34.15%), Postives = 45/82 (54.88%), Query Frame = 1
Query:  229 KRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFA----EFKKCIKIPKNVDHENLRSTMTKEGLLVLKA 462
            K+N L    + +  Y+P EI+ K    E G VK  V  +HVNE +F     EF++   +P+ +D EN+ S ++  G L ++A
Sbjct:    3 KKNTLEIAKLDVKEYRPEEISFK---VENGVVK--VQGRHVNEGEFGFELKEFRRTFTLPEGIDPENVTSRISNHGHLHIEA 79          
BLAST of Small HSP protein vs. Planmine SMEST
Match: SMESG000059853.1 (SMESG000059853.1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 269/270 (99.63%), Postives = 270/270 (100.00%), Query Frame = 1
Query:  154 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN 963
            MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKH+NEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHINEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN 270          
BLAST of Small HSP protein vs. Planmine SMEST
Match: SMESG000059879.1 (SMESG000059879.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 265/270 (98.15%), Postives = 268/270 (99.26%), Query Frame = 1
Query:  154 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN 963
            MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDF+EFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQN EIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVES ++TKMAVDN
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFSEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNNEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESDESTKMAVDN 270          
BLAST of Small HSP protein vs. Planmine SMEST
Match: SMESG000059868.1 (SMESG000059868.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 265/270 (98.15%), Postives = 268/270 (99.26%), Query Frame = 1
Query:  154 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN 963
            MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDF+EFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQN EIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVES ++TKMAVDN
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFSEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNNEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESDESTKMAVDN 270          
BLAST of Small HSP protein vs. Planmine SMEST
Match: SMESG000030562.1 (SMESG000030562.1)

HSP 1 Score: 350.903 bits (899), Expect = 3.014e-121
Identity = 165/275 (60.00%), Postives = 223/275 (81.09%), Query Frame = 1
Query:  154 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDATKMAVDN*ALTI 978
            +FR+LDEPI +SL+WPE +H V + +++N W+ SIP++GY+P+E+AIKEE + EG  KII+HAKH +E+DF+E KK +KIPKNVDHE+LR+ ++K+G+L+LKAPYK S DS V+P+KI R DTW+GIWGELGRLN+QMNH+ID   A+  +PR EF+ D N  SGTWR+  N+GKDFKSD+IKLRH NK+I+LEA++ETKTDN  SS+YI EV+S+P+ +E DKL SKLLD+G+L++EAPCKKMPS+   + GK IP+E   AT  +V N  +T+
Sbjct:    6 IFRYLDEPICSSLFWPEITH-VGHKRKHNQWTASIPVSGYEPSEVAIKEETSNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLID-SHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE---ATNKSVGNDKMTV 275          
BLAST of Small HSP protein vs. Planmine SMEST
Match: SMESG000033587.1 (SMESG000033587.1)

HSP 1 Score: 65.855 bits (159), Expect = 1.004e-11
Identity = 53/207 (25.60%), Postives = 99/207 (47.83%), Query Frame = 1
Query:  268 GYQPNEIAIKEEKTEEGEVKIIVHAKH----VNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPC 876
            G++P ++ +  + +     K+ ++A+      N++ F EF K I +P +VD +  +   T +G+L+L+AP K  E+     I +  +D   G+     R +   N ++   G          V D+        + I V KD++  D  +  +  +I+++ + E KT NSSS +       +PE ++   ++  LLD G LV+EAP 
Sbjct:  174 GFKPEDLKVIAQDS-----KVTINARKETVTANQKSFKEFSKTITVPPSVDIKKFQCHQTNDGILILEAPIKQQEN-----ISVTLKDGL-GVKAISDRHSTFSNSLVKVTGQSG-----PVVVDDAIYGKKIHLEIPVDKDYEPSDFSVYTELNQIHIKGRHEVKTANSSSFKEFSRYYEVPETLDPMSVSFHLLD-GTLVVEAPL 363          
The following BLAST results are available for this feature:
BLAST of Small HSP protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hsp-16.21.414e-628.42Heat shock protein Hsp-16.2 [Source:UniProtKB/Swi... [more]
hsp-16.21.517e-625.93Heat shock protein Hsp-16.2 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Small HSP protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG142073.859e-630.86gene:FBgn0031037 transcript:FBtr0307161[more]
CG142074.683e-630.86gene:FBgn0031037 transcript:FBtr0074733[more]
CG142074.683e-630.86gene:FBgn0031037 transcript:FBtr0345918[more]
CG142075.418e-630.86gene:FBgn0031037 transcript:FBtr0074734[more]
back to top
BLAST of Small HSP protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H1ZWN32.558e-10075.26Small HSP protein (Fragment) OS=Dugesia japonica O... [more]
A0A267DQU23.413e-2027.83Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EKQ74.222e-2026.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
T1EE302.874e-1226.13Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A419PWF51.360e-928.82Major egg antigen OS=Clonorchis sinensis OX=79923 ... [more]
back to top
BLAST of Small HSP protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO409172.205e-634.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Small HSP protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Small HSP protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059853.10.000e+099.63SMESG000059853.1[more]
SMESG000059879.10.000e+098.15SMESG000059879.1[more]
SMESG000059868.10.000e+098.15SMESG000059868.1[more]
SMESG000030562.13.014e-12160.00SMESG000030562.1[more]
SMESG000033587.11.004e-1125.60SMESG000033587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013692 ID=SMED30013692|Name=Small HSP protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1051bp
CTTTAAATCATCGCTCGGATTCCATAGCCAATAATAATAGCCAGTAATTT
TATATAGATTTACCTAGAATTTTCTAAGATCTTAAAAATAGTATAAAATA
CCGTAAGTGATTTGGATTATTATTCTTTTTGTTTTATACTTTGATTAAAA
CTAATGTTTCGATTTCTAGACGAACCGATTTTTAATTCTTTATATTGGCC
GGAATATTCTCATCATGTAATCTATCCGAAAAGAAACAATTTGTGGTCGA
CTTCTATTCCAATTACCGGATATCAACCCAATGAAATTGCGATCAAAGAA
GAGAAAACTGAAGAAGGCGAAGTTAAAATAATCGTTCATGCTAAGCATGT
AAATGAAGAGGATTTTGCTGAATTTAAGAAATGCATCAAAATCCCAAAGA
ATGTGGACCATGAAAACCTGCGATCTACAATGACTAAAGAAGGTTTACTT
GTTTTGAAAGCTCCATACAAAATTTCTGAAGATTCTGTTGTCAAGCCAAT
TAAAATCAACAGAGAGGATACTTGGAGTGGAATCTGGGGTGAGCTTGGTC
GTCTCAATGACCAAATGAATCATATGATTGATTTCGGAGGTGCATTGAGC
CATCAACCGCGTGTTGAATTTGTTCCCGATGAAAATAAAGAAAGTGGAAC
ATGGAGAATGACAATTAATGTAGGTAAAGATTTTAAGTCGGATGATATTA
AATTGCGTCATCAAAACAAAGAAATTTATCTGGAAGCTAAGAAAGAAACA
AAAACCGACAATTCATCGAGTTCTAGATACATTAAAGAGGTTTTGAGCTT
GCCGGAAGGAATCGAAGAAGATAAATTAAATTCAAAACTTTTAGATAATG
GTCAACTGGTAATAGAAGCTCCTTGTAAAAAGATGCCTAGCATTGGACAT
GATGATAAAGGAAAAGTAATTCCTGTGGAAAGTGGTGATGCTACGAAAAT
GGCAGTTGATAATTGAGCTTTGACTATAAAATACTGCTAAATTTGATTTT
CTGGTTATATATATGTATCATTTTTTATTAATAAATGTGTGAAATGTTTT
G
back to top

protein sequence of SMED30013692-orf-1

>SMED30013692-orf-1 ID=SMED30013692-orf-1|Name=SMED30013692-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=271bp
MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEE
KTEEGEVKIIVHAKHVNEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLV
LKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSH
QPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETK
TDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHD
DKGKVIPVESGDATKMAVDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008978HSP20-like_chaperone
IPR002068A-crystallin/Hsp20_dom
IPR011528NERD
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 134..268
e-value: 1.5E-13
score: 52.5
coord: 24..125
e-value: 1.7E-8
score: 36.1
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 167..243
IPR002068Alpha crystallin/Hsp20 domainPFAMPF00011HSP20coord: 163..258
e-value: 3.2E-9
score: 36.9
coord: 62..118
e-value: 4.1E-7
score: 30.1
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031SHSPcoord: 13..121
score: 12.007
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 248..270
NoneNo IPR availablePANTHERPTHR45640FAMILY NOT NAMEDcoord: 157..262
coord: 31..122
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 39..104
e-value: 1.94403E-10
score: 54.0631
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 159..241
e-value: 3.77522E-11
score: 55.9891