MAP3K-1

Overview
NameMAP3K-1 (AFJ24738.1)
Smed IDSMED30013686
Length (bp)4036
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MAP3K-1 (SMED30013686) t-SNE clustered cells

Violin plots show distribution of expression levels for MAP3K-1 (SMED30013686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MAP3K-1 (SMED30013686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MAP3K-1 (SMED30013686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013686h1SMcG0004369 SmedASXL_015065SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30013686h1SMcG0004369 dd_Smed_v4_5198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013686h1SMcG0004369 dd_Smed_v4_5198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013686h1SMcG0004369 dd_Smed_v4_5198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013686h1SMcG0004369 dd_Smed_v6_5198_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013686h1SMcG0004369 dd_Smed_v4_5198_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MAP3K-1 vs. Ensembl Human
Match: MAP3K1 (mitogen-activated protein kinase kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:6848])

HSP 1 Score: 308.916 bits (790), Expect = 2.176e-85
Identity = 143/285 (50.18%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG       YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + Y  Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1228 PGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSN--YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFR 1509          

HSP 2 Score: 70.8626 bits (172), Expect = 1.881e-11
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1536 TGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANHHRFKAVH-CYGRLSLLERLLDKF 1955
            +G +++    V++ +  D  Y ++V AL+  R +L Y  C + +E  ++ R++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + N           GRL L++RLL +F
Sbjct:  628 SGDVVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLQPVVDTILVKCAD-ANSRTSQLSISTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEF 768          

HSP 3 Score: 65.855 bits (159), Expect = 6.211e-10
Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  927 DEITCSICLQEMNIAQLLIFCHN-CSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLE 1136
            +E  C ICL  M   + L  C + C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++ SP++
Sbjct:  439 EEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVD 510          
BLAST of MAP3K-1 vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 186.422 bits (472), Expect = 8.215e-49
Identity = 108/286 (37.76%), Postives = 156/286 (54.55%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS*MFFRYH 3746
            R+   W  G LLG GAF + Y   DV TG  +AVKQ+     S + ++E+  A++ E+ L+  L H  ++   G +  P +  +S+F+ +MPGGS+   L  Y A  E VT  Y  Q   G+ Y+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  D+WS AC ++EMLT   PW +      +A ++ IA+    PKLP  +S D T      +  + K RP + +L      +H    MF  YH
Sbjct:  351 RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEV-NALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTG-NVKLGDFGASKRLQTICLSGTG--MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAE---FEAMAAIFKIATQPTNPKLPPHVS-DYTRDFLKRIFVEAKLRPSADEL-----LRH----MFVHYH 619          
BLAST of MAP3K-1 vs. Ensembl Human
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6854])

HSP 1 Score: 186.422 bits (472), Expect = 8.215e-49
Identity = 108/286 (37.76%), Postives = 156/286 (54.55%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS*MFFRYH 3746
            R+   W  G LLG GAF + Y   DV TG  +AVKQ+     S + ++E+  A++ E+ L+  L H  ++   G +  P +  +S+F+ +MPGGS+   L  Y A  E VT  Y  Q   G+ Y+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  D+WS AC ++EMLT   PW +      +A ++ IA+    PKLP  +S D T      +  + K RP + +L      +H    MF  YH
Sbjct:  351 RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEV-NALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTG-NVKLGDFGASKRLQTICLSGTG--MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAE---FEAMAAIFKIATQPTNPKLPPHVS-DYTRDFLKRIFVEAKLRPSADEL-----LRH----MFVHYH 619          
BLAST of MAP3K-1 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 181.03 bits (458), Expect = 5.267e-47
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNR---DPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+     S + ++E+  A++ E+ L+  L H  ++   G +    +  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P+LP  IS    E   D L R   + ++RP + +L
Sbjct:  358 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEV-SALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQTICMSGTG--MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPQLPSHIS----EHGRDFLRRIFVEARQRPSAEEL 612          
BLAST of MAP3K-1 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 181.415 bits (459), Expect = 5.486e-47
Identity = 102/266 (38.35%), Postives = 149/266 (56.02%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNR---DPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+     S + ++E+  A++ E+ L+  L H  ++   G +    +  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P+LP  IS    E   D L R   + ++RP + +L
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEV-SALECEIQLLKNLQHERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQTICMSGTG--MRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPQLPSHIS----EHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of MAP3K-1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 127.487 bits (319), Expect = 7.628e-30
Identity = 81/265 (30.57%), Postives = 135/265 (50.94%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL-QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            +G G+F + Y+G D RTG ++A+K I +     ++ E+ I+ ++ E+ ++ Q +   V    G+    +   + + + ++ GGS   L    S  L+   +A  L +  +GL Y+HS R +HRD+KGAN+LLD     ++I D+G +  L     +N        +GT  FMAPEV++G EY    D+WS     IE+  G  P  D    + + +++ I     P     Q S    E +  CLN+DP+ RP +S L  ++  K
Sbjct:   25 IGRGSFGEVYKGIDNRTGRVVAIKIIDL-----EQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSK--LWIIMEYLGGGSALDLTK--SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANT------FVGTPFFMAPEVVKG-EYSIEADIWSLGITAIELANGEPPHSD---LHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 270          
BLAST of MAP3K-1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 127.487 bits (319), Expect = 7.642e-30
Identity = 81/265 (30.57%), Postives = 135/265 (50.94%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL-QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            +G G+F + Y+G D RTG ++A+K I +     ++ E+ I+ ++ E+ ++ Q +   V    G+    +   + + + ++ GGS   L    S  L+   +A  L +  +GL Y+HS R +HRD+KGAN+LLD     ++I D+G +  L     +N        +GT  FMAPEV++G EY    D+WS     IE+  G  P  D    + + +++ I     P     Q S    E +  CLN+DP+ RP +S L  ++  K
Sbjct:   20 IGRGSFGEVYKGIDNRTGRVVAIKIIDL-----EQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSK--LWIIMEYLGGGSALDLTK--SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANT------FVGTPFFMAPEVVKG-EYSIEADIWSLGITAIELANGEPPHSD---LHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 265          
BLAST of MAP3K-1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 127.487 bits (319), Expect = 9.253e-30
Identity = 81/265 (30.57%), Postives = 135/265 (50.94%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL-QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            +G G+F + Y+G D RTG ++A+K I +     ++ E+ I+ ++ E+ ++ Q +   V    G+    +   + + + ++ GGS   L    S  L+   +A  L +  +GL Y+HS R +HRD+KGAN+LLD     ++I D+G +  L     +N        +GT  FMAPEV++G EY    D+WS     IE+  G  P  D    + + +++ I     P     Q S    E +  CLN+DP+ RP +S L  ++  K
Sbjct:   40 IGRGSFGEVYKGIDNRTGRVVAIKIIDL-----EQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSK--LWIIMEYLGGGSALDLTK--SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANT------FVGTPFFMAPEVVKG-EYSIEADIWSLGITAIELANGEPPHSD---LHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 285          
BLAST of MAP3K-1 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 128.257 bits (321), Expect = 9.258e-30
Identity = 81/265 (30.57%), Postives = 134/265 (50.57%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL-QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            +G G+F + Y+G D RTG ++A+K I +  +     E+ I+ ++ E+ ++ Q +   V    G+    +   + + + ++ GGS   L    S  L+   +A  L +  +GL Y+HS R +HRD+KGAN+LLD     ++I D+G +  L     +N        +GT  FMAPEV++G EY    D+WS     IE+  G  P  D    + + +++ I     P     Q S    E +  CLN+DP+ RP +S L  ++  K
Sbjct:  190 IGRGSFGEVYKGIDNRTGRVVAIKIIDLEQA-----EDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSK--LWIIMEYLGGGSALDLTK--SGKLDESHIAVILREILKGLEYLHSERKIHRDIKGANVLLDRQTAAVKICDYGVAKPLDTVLKANT------FVGTPFFMAPEVVKG-EYSIEADIWSLGITAIELANGEPPHSD---LHPMRVLFLIPKNPPPVLQGSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFIK 435          
BLAST of MAP3K-1 vs. Ensembl Celegans
Match: nsy-1 (Mitogen-activated protein kinase kinase kinase nsy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21029])

HSP 1 Score: 128.642 bits (322), Expect = 1.678e-29
Identity = 83/266 (31.20%), Postives = 134/266 (50.38%), Query Frame = 3
Query: 2919 LLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTD---NIISMFVRWMPGGSVASLL-NQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVL----RGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            +LG G +   Y  RD+ T   + VK+I +      K +E ++ +  E++L   L H N++  LG      D   +   +F+  +PGGS++SLL +++    E     Y  Q   GL Y+H  +I+HRD+KG N+L+++     +ISDFG   RL+ G +     F     GT+ +MAPEV+    RG  YG   D+WSF C ++EM TG  P+ +    N  A M+ +   +  P +P +I+      +  C   +   RP +  L
Sbjct:  669 VLGKGTYGTVYAARDMDTQRQIVVKEIEV------KYDEEVQPLMEEISLHSTLCHANIVQYLGCDLVGKDGSNDHFLIFMEHVPGGSLSSLLRSKWGPMNENAMNYYGKQILEGLKYLHELKIVHRDIKGDNVLVNTYSGVCKISDFGTCKRLA-GLNPVTETFT----GTLQYMAPEVIDHGQRG--YGAPADIWSFGCTMVEMATGRPPFVEMQ--NPQAAMFRVGMFKTHPPIPTEITEKCRNFIKSCFLPEACDRPSAKDL 919          
BLAST of MAP3K-1 vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0083819)

HSP 1 Score: 140.198 bits (352), Expect = 4.231e-33
Identity = 87/278 (31.29%), Postives = 143/278 (51.44%), Query Frame = 3
Query: 2883 EYRSGY-EWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFL---EPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVL----RGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            EY   Y E  +  +LG G +   Y  RD +T + +A+K++       +KN + ++ +  E+ L  QL H N++  LG+     +    +F+  +PGGS++ LL      L   E     Y+ Q   GL Y+H   I+HRD+KG N+L+++    ++ISDFG S RL     +  +       GT+ +MAPEV+    RG  YG + D+WSF C  +EM TG  P+ +    +  A M+ +   ++ P +PE++SA+    +  C       RP +S+L
Sbjct:  410 EYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVP------EKNSQDVQPLHEEIKLHSQLRHRNIVRYLGS--CSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRL-----ARINPMTETFTGTLQYMAPEVIDQGVRG--YGPAADIWSFGCTNVEMATGKPPFIELGSAH--AAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQL 670          
BLAST of MAP3K-1 vs. Ensembl Fly
Match: Ask1 (gene:FBgn0014006 transcript:FBtr0300256)

HSP 1 Score: 140.198 bits (352), Expect = 4.712e-33
Identity = 87/278 (31.29%), Postives = 143/278 (51.44%), Query Frame = 3
Query: 2883 EYRSGY-EWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFL---EPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVL----RGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            EY   Y E  +  +LG G +   Y  RD +T + +A+K++       +KN + ++ +  E+ L  QL H N++  LG+     +    +F+  +PGGS++ LL      L   E     Y+ Q   GL Y+H   I+HRD+KG N+L+++    ++ISDFG S RL     +  +       GT+ +MAPEV+    RG  YG + D+WSF C  +EM TG  P+ +    +  A M+ +   ++ P +PE++SA+    +  C       RP +S+L
Sbjct:  577 EYEYDYDEQNRKMVLGKGTYGTVYAARDKQTQVRIAIKEVP------EKNSQDVQPLHEEIKLHSQLRHRNIVRYLGS--CSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAFYSKQILEGLKYLHEQDIVHRDIKGDNVLVNTYSGVVKISDFGTSKRL-----ARINPMTETFTGTLQYMAPEVIDQGVRG--YGPAADIWSFGCTNVEMATGKPPFIELGSAH--AAMFKVGFYKKHPNIPEELSANAKNFILRCFAISVMDRPSASQL 837          
BLAST of MAP3K-1 vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0083684)

HSP 1 Score: 134.42 bits (337), Expect = 3.101e-31
Identity = 78/276 (28.26%), Postives = 142/276 (51.45%), Query Frame = 3
Query: 2898 YEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVL---RGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            + W +G  +G G F K Y   +  TG LMA+K+I+I           +K V  E+ ++  + H N++   G      + +I  F+     G++ SL+       E +T  +  Q   G+S +H + I+HRD+K AN+ L      L++ DFG++ ++     +   + +G  +GT A+MAPEV      + +GR+ D+WS  C ++EM +G +PW   +  ++  +M+ +   E+ P+ PE +S +  + +  CL  DPK+R  + +L  +   K+
Sbjct: 1280 FRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGET----RALKNVAEELKILEGIKHKNLVRYYGIEVHREELLI--FMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKI-QAHTTVPGELQG-YVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFD--SNFQIMFKVGMGEK-PQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCKY 1544          
BLAST of MAP3K-1 vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0331353)

HSP 1 Score: 134.42 bits (337), Expect = 3.594e-31
Identity = 78/276 (28.26%), Postives = 142/276 (51.45%), Query Frame = 3
Query: 2898 YEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVL---RGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            + W +G  +G G F K Y   +  TG LMA+K+I+I           +K V  E+ ++  + H N++   G      + +I  F+     G++ SL+       E +T  +  Q   G+S +H + I+HRD+K AN+ L      L++ DFG++ ++     +   + +G  +GT A+MAPEV      + +GR+ D+WS  C ++EM +G +PW   +  ++  +M+ +   E+ P+ PE +S +  + +  CL  DPK+R  + +L  +   K+
Sbjct: 1187 FRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGET----RALKNVAEELKILEGIKHKNLVRYYGIEVHREELLI--FMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKI-QAHTTVPGELQG-YVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFD--SNFQIMFKVGMGEK-PQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCKY 1451          
BLAST of MAP3K-1 vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 127.487 bits (319), Expect = 1.122e-29
Identity = 78/265 (29.43%), Postives = 132/265 (49.81%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL-QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            +G G+F + ++G D RT  ++A+K I +  +     E+ I  ++ E+ ++ Q + P V    G+    T   I M   ++ GGS   L+   S   E + +   L +  +GL Y+HS R LHRD+K AN+LL   G  ++++DFG + +L     +N +  +   +GT  +MAPEV++  +Y    D+WS     IE+  G  P    N   H   +  +     PP+L    +    + +  CLN+DP+ RP + +L  Y   K
Sbjct:   19 IGKGSFGEVFKGIDNRTQQVVAIKIIDLEEA-----EDEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIM--EYLGGGSALDLMKAGS--FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQG-DVKLADFGVAGQL-----TNTTSKRNTFVGTPFWMAPEVIKQSQYDAKADIWSLGITAIELAKGEPP----NSELHPMRVLFLIPKNNPPQLTGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFIK 264          
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 309.686 bits (792), Expect = 1.990e-86
Identity = 145/286 (50.70%), Postives = 197/286 (68.88%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            PG       YR G EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHP+++ +LGA      N  ++FV WM GGSV+ LLN+Y AF E V + Y  Q  RGL+Y+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P  RP S +L  + VF+H
Sbjct: 1018 PGHTKAKQPYREGNEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGLLNHPHIIRMLGATCE--KNNYNLFVEWMAGGSVSHLLNKYGAFKEGVIINYTEQLLRGLAYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMSCAKPPWNAEKHSNHLALIFKIASATTAPSIPPHLSPGLRDVTLRCLELQPTDRPPSRELLKHPVFRH 1300          

HSP 2 Score: 137.117 bits (344), Expect = 5.539e-32
Identity = 139/548 (25.36%), Postives = 230/548 (41.97%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSW-PSDDISRDIVSPLEYGPSVA------------------DSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANH---HRFKAVHCYGRLSLLERLLDKF 1955
            Y       ++  + +    +L Q  P SF +   S  +++ V IGPQTC C         + +F C+H+LF+M +V Q+   DPLL  K LKN EV+ LF++++ R   ++  P R                           S   ++ S M N  +H           +    +  E   E  C ICL +M   + L  C   C N+ H  C+ IW +EC++N++ L CPLCR  W P D  S +  S +E   S A                  D +F +P+        QHI  +  T +A                            +P    F   +   L S   + RE  LR+++      ++ A   +S+           +S D+V           ++    V++ +  D  Y ++V AL+  R +L Y  C + SE  R+ +++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + +    + ++A+   GRL L++RLL +F
Sbjct:  126 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIGPQTCSC--------GRGTF-CIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSR---------------------------STIQKFVSRMSN--SHTSCTSSASPSSNESSMKDEE---EQMCPICLLDMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNHDPLICPLCRAKWKPHDFYSYEAPSTVESTTSPASSSSSSSSLHAESSRTGQDGDFSLPQ-----YGVQHIP-QTYTELA----------------------------EPWIKVFGLELVGCLFSRNWNIREMALRRLSHDVSGALLLANGEHSLAGAGAGAGLAEVSGDVV-----------VESCCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSASERTRLQQLLRPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQMGELAVGREILKAGSIGIGGVDYVLNCILGSKTEANNWQAL--LGRLCLIDRLLLEF 584          
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 310.071 bits (793), Expect = 2.474e-86
Identity = 145/286 (50.70%), Postives = 197/286 (68.88%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            PG       YR G EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHP+++ +LGA      N  ++FV WM GGSV+ LLN+Y AF E V + Y  Q  RGL+Y+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P  RP S +L  + VF+H
Sbjct: 1050 PGHTKAKQPYREGNEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGLLNHPHIIRMLGATCE--KNNYNLFVEWMAGGSVSHLLNKYGAFKEGVIINYTEQLLRGLAYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMSCAKPPWNAEKHSNHLALIFKIASATTAPSIPPHLSPGLRDVTLRCLELQPTDRPPSRELLKHPVFRH 1332          

HSP 2 Score: 138.658 bits (348), Expect = 1.987e-32
Identity = 137/542 (25.28%), Postives = 234/542 (43.17%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHG-FSVSS---NHKPIGY---------CFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANH---HRFKAVHCYGRLSLLERLLDKF 1955
            Y       ++  + +    +L Q  P SF +   S  +++ V IGPQTC C         + +F C+H+LF+M +V Q+   DPLL  K LKN EV+ LF++++ R   ++  P R   +                           ++ S M N  +H           +    +  E   E  C ICL +M   + L  C   C N+ H  C+ IW +EC++N++ L CPLCR  W   D                   F+   S+   ++ +    R  +  A+S+S  +SS  + +    + G FS+      H P  Y          F   +   L S   + RE  LR+++      ++ A   +S+           +S D+V           ++    V++ +  D  Y ++V AL+  R +L Y  C + SE  R+ +++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + +    + ++A+   GRL L++RLL +F
Sbjct:  138 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIGPQTCSC--------GRGTF-CIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSRSTIQ---------------------------KFVSRMSN--SHTSCTSSASPSSNESSMKDEE---EQMCPICLLDMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNHDPLICPLCRAKWKPHD-------------------FY---SYEAPSTVESTTSRSQSQTAASSSSSSSSLHAESSRTGQDGDFSLPQYGVQHIPQTYTELAEPWIKVFGLELVGCLFSRNWNIREMALRRLSHDVSGALLLANGEHSLAGAGAGAGLAEVSGDVV-----------VESCCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSASERTRLQQLLRPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQMGELAVGREILKAGSIGIGGVDYVLNCILGSKTEANNWQAL--LGRLCLIDRLLLEF 602          
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-090313-412])

HSP 1 Score: 309.301 bits (791), Expect = 2.674e-86
Identity = 145/286 (50.70%), Postives = 197/286 (68.88%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            PG       YR G EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHP+++ +LGA      N  ++FV WM GGSV+ LLN+Y AF E V + Y  Q  RGL+Y+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P  RP S +L  + VF+H
Sbjct: 1010 PGHTKAKQPYREGNEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGLLNHPHIIRMLGATCE--KNNYNLFVEWMAGGSVSHLLNKYGAFKEGVIINYTEQLLRGLAYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMSCAKPPWNAEKHSNHLALIFKIASATTAPSIPPHLSPGLRDVTLRCLELQPTDRPPSRELLKHPVFRH 1292          

HSP 2 Score: 128.257 bits (321), Expect = 3.242e-29
Identity = 139/548 (25.36%), Postives = 221/548 (40.33%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSW-PSDDISRDIVSPLEYGPSVA------------------DSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANH---HRFKAVHCYGRLSLLERLLDKF 1955
            Y       ++  + +    +L Q  P SF +   S  +++ V IGPQTC C         + +F C+H+LF+M +V Q+   DPLL  K LKN EV  L               Y PN K  +NI  E    G    F +D                                        +E  C ICL +M   + L  C   C N+ H  C+ IW +EC++N++ L CPLCR  W P D  S +  S +E   S A                  D +F +P+        QHI  +  T +A                            +P    F   +   L S   + RE  LR+++      ++ A   +S+           +S D+V           ++    V++ +  D  Y ++V AL+  R +L Y  C + SE  R+ +++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + +    + ++A+   GRL L++RLL +F
Sbjct:  138 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKFRVFIGPQTCSC--------GRGTF-CIHVLFVMLRVFQLEPSDPLLWRKTLKNFEVRRL---------------YNPN-KAPQNIKWENSGRG----FMKDE---------------------------------------EEQMCPICLLDMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNHDPLICPLCRAKWKPHDFYSYEAPSTVESTTSPASSSSSSSSLHAESSRTGQDGDFSLPQ-----YGVQHIP-QTYTELA----------------------------EPWIKVFGLELVGCLFSRNWNIREMALRRLSHDVSGALLLANGEHSLAGAGAGAGLAEVSGDVV-----------VESCCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSASERTRLQQLLRPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQMGELAVGREILKAGSIGIGGVDYVLNCILGSKTEANNWQAL--LGRLCLIDRLLLEF 569          
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 181.415 bits (459), Expect = 2.545e-50
Identity = 100/276 (36.23%), Postives = 161/276 (58.33%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLL----GTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEE-PPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            W +G +LG GA+   Y G   + G L+AVKQ+++  S+ +  E+    ++ EV+L+  L H N++  LG   S  +NI+S+F+ ++PGGS++++L Q+    E V + Y+ Q   G++Y+H+NR++HRDLKG N++L  +G+ +++ DFG + RLS  + S  S  KG LL    GT  +MAPEV+    +GR  D+WS  C + EM TG  P     H N +A +Y I +     P L +  S D  + +  CL RD ++RP + +L  +    H
Sbjct:   21 WTKGEVLGKGAYGTVYCGLTSQ-GQLIAVKQVALDASTSEIAEKEYDRLEREVDLLKNLKHTNIVGFLGTALS--ENIVSIFMEYIPGGSISNILGQFGPLPEKVFVLYSQQILEGVAYLHANRVIHRDLKGNNIMLMPTGV-VKLIDFGCARRLSCLQTSTGS--KGDLLKSVHGTPYWMAPEVINETGHGRKSDIWSIGCTVFEMATGKPPLA---HMNKMAALYYIGARRGLMPSLSDDFSTDAKDFVQACLTRDQRQRPSAEELLRHPFISH 287          
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 187.578 bits (475), Expect = 2.206e-49
Identity = 101/263 (38.40%), Postives = 151/263 (57.41%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+    +S + ++E+  A++ E+ L+  L+H  ++   G +    +  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL       +S     + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P+LP  IS    + L  C+  + K RP + +L
Sbjct:  356 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVHFDPASPETSKEV-SALECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQT--ICMSSTGVRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---FEAMAAIFKIATQPTNPQLPSHISEHTRDFLR-CIFVEAKYRPSAEEL 610          
BLAST of MAP3K-1 vs. Ensembl Xenopus
Match: slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:Xenbase;Acc:XB-GENE-5755357])

HSP 1 Score: 304.679 bits (779), Expect = 2.345e-84
Identity = 142/285 (49.82%), Postives = 198/285 (69.47%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG     + YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  +  E+++A++ E+ +M  L+HPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + YA Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1096 PGHTKARNHYREEMEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSTEQGEVVEALREEIRMMSHLSHPNIIRMLGATCEKSN--YNLFIEWMAGGSVALLLSKYGAFKELVIINYAEQLLRGLSYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSLGCSIIEMACAKPPWNAEKHSNHLALIFKIASATTAPTIPPHLSPGLRDVTLRCLELQPQDRPPSRELLKHPVFR 1377          

HSP 2 Score: 115.931 bits (289), Expect = 2.533e-25
Identity = 96/359 (26.74%), Postives = 160/359 (44.57%), Query Frame = 3
Query:  927 DEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLEYGPSV------ADSNFFVPRSHSTA--TSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGG----FTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKS-SLPVTGWQRLAKFAIANHHRFKAVHC-YGRLSLLERLLDKF 1955
            +E  C ICL  M   + L  C   C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++  P++  P +      +      P S      TS  ++ H  + NI                      F+     +P    F   +   L S   + RE  LR+++      ++ A    +   N  N    T  T + ++ G      +  ++++    V++ +  D  Y ++V AL+  R +L Y  C T +E +++ R+++PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI KS S+ + G   +    +A            GRL L++RLL +F
Sbjct:  311 EEQMCPICLLGMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNREPLICPLCRAKWRSQDFNSVELPGPVDSPPILRAVQQQSLQQLPTPGSQRRPQDTSL-NLTHYGVQNIP---------------------FAYKDMAEPWIQVFGMELVSCLFSRNWNIREMALRRLSHDVSGALLLANGEST--GNSCNSSGTTSGTSLNAASGSSQSTISGDVVVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHTITERKKLQRLLNPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQAGELAVGREILKSGSIGIGGVDYVLHCILATQAEPNNWQSLLGRLCLIDRLLLEF 644          
BLAST of MAP3K-1 vs. Ensembl Xenopus
Match: slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:Xenbase;Acc:XB-GENE-5755357])

HSP 1 Score: 304.679 bits (779), Expect = 3.436e-84
Identity = 142/285 (49.82%), Postives = 198/285 (69.47%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG     + YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  +  E+++A++ E+ +M  L+HPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + YA Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1161 PGHTKARNHYREEMEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSTEQGEVVEALREEIRMMSHLSHPNIIRMLGATCEKSN--YNLFIEWMAGGSVALLLSKYGAFKELVIINYAEQLLRGLSYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSLGCSIIEMACAKPPWNAEKHSNHLALIFKIASATTAPTIPPHLSPGLRDVTLRCLELQPQDRPPSRELLKHPVFR 1442          

HSP 2 Score: 141.354 bits (355), Expect = 4.898e-33
Identity = 136/523 (26.00%), Postives = 222/523 (42.45%), Query Frame = 3
Query:  444 ILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDC--DEPRPNESLDEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLEYGPSV------ADSNFFVPRSHSTA--TSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGG----FTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKS-SLPVTGWQRLAKFAIANHHRFKAVHC-YGRLSLLERLLDKF 1955
            +L Q  P SF +   S  ++Y V IGPQ C C         + +F C+HLLF+M +V Q+   D +L  K LKN EV+ LF+++                           H   +SR    + +   ++ S M +            +      DE       +E  C ICL  M   + L  C   C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++  P++  P +      +      P S      TS  ++ H  + NI                      F+     +P    F   +   L S   + RE  LR+++      ++ A    +   N  N    T  T + ++ G      +  ++++    V++ +  D  Y ++V AL+  R +L Y  C T +E +++ R+++PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI KS S+ + G   +    +A            GRL L++RLL +F
Sbjct:  255 LLQQIGPNSFLIGGDSPDNKYRVFIGPQACSC--------GRGTF-CIHLLFVMLRVFQLEPSDTMLWRKALKNFEVESLFQKY---------------------------HSRRSSRIKAPSRNTIQKFVSRMSSSHTLSSSTTSTSSSDTSMKDE-------EEQMCPICLLGMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNREPLICPLCRAKWRSQDFNSVELPGPVDSPPILRAVQQQSLQQLPTPGSQRRPQDTSL-NLTHYGVQNIP---------------------FAYKDMAEPWIQVFGMELVSCLFSRNWNIREMALRRLSHDVSGALLLANGEST--GNSCNSSGTTSGTSLNAASGSSQSTISGDVVVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHTITERKKLQRLLNPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQAGELAVGREILKSGSIGIGGVDYVLHCILATQAEPNNWQSLLGRLCLIDRLLLEF 709          
BLAST of MAP3K-1 vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 183.341 bits (464), Expect = 8.241e-48
Identity = 100/271 (36.90%), Postives = 151/271 (55.72%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            W  G LLG GAF + Y   DV  G  +AVKQ+     S + ++E+  A++ E+ L+    H  ++   G +  PT+  +S+FV +MPGGS+   L  Y A  E VT  Y  Q  +G+SY+H N I+HRD+KGAN+L DS+G  +++ DFGAS R+     S        + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW   +    +A ++ IA+    P+LP+ +S    + +      + K+RP + +L  +    H
Sbjct:  354 WRLGKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEV-NALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAG-NVKLGDFGASKRIQTICMSGTG--IKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPW---SEYEAMAAIFKIATQPTKPRLPDTVSDACRDFMKQIFVEE-KRRPTAEELLRHLFVSH 616          
BLAST of MAP3K-1 vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 182.956 bits (463), Expect = 1.197e-47
Identity = 100/271 (36.90%), Postives = 151/271 (55.72%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            W  G LLG GAF + Y   DV  G  +AVKQ+     S + ++E+  A++ E+ L+    H  ++   G +  PT+  +S+FV +MPGGS+   L  Y A  E VT  Y  Q  +G+SY+H N I+HRD+KGAN+L DS+G  +++ DFGAS R+     S        + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW   +    +A ++ IA+    P+LP+ +S    + +      + K+RP + +L  +    H
Sbjct:  361 WRLGKLLGRGAFGEVYLCYDVDKGRELAVKQVPFDPDSQETSKEV-NALECEIQLLKLHRHERIVQYYGCLRDPTERKLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAG-NVKLGDFGASKRIQTICMSGTG--IKSVTGTPYWMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPW---SEYEAMAAIFKIATQPTKPRLPDTVSDACRDFMKQIFVEE-KRRPTAEELLRHLFVSH 623          
BLAST of MAP3K-1 vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 180.644 bits (457), Expect = 6.241e-47
Identity = 98/263 (37.26%), Postives = 149/263 (56.65%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+     S + ++E+  A++ E+ L+  L+H  ++   G++    +  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P+LP   S    + +   L  + ++RP + +L
Sbjct:  347 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPDSPETSKEV-SALECEIQLLKNLHHDRIVQYYGSLRDKGEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQTICMSGTG--IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPQLPPNTSEQCRDFVKRILV-EARQRPTAEEL 601          
BLAST of MAP3K-1 vs. Ensembl Mouse
Match: Map3k1 (mitogen-activated protein kinase kinase kinase 1 [Source:MGI Symbol;Acc:MGI:1346872])

HSP 1 Score: 309.301 bits (791), Expect = 1.196e-85
Identity = 143/285 (50.18%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG       YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + Y  Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1209 PGHTKAKQPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSN--YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFR 1490          

HSP 2 Score: 104.76 bits (260), Expect = 5.510e-22
Identity = 77/253 (30.43%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHN-CSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLE 1136
            Y       ++  + +    +L Q  P SF +   S  ++Y V IGPQ C C         + +F C+HLLF+M +V Q+   DP+L  K LKN EV+ LF++++ R   ++  P R                 NT +          ++ S M N   H L           +  +  E   E  C ICL  M   + L  C + C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++ SP+E
Sbjct:  294 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSC--------GRGAF-CIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSR-----------------NTIQ----------KFVSRMSN--CHTLSSSSTSTSSSENSIKDEE---EQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVE 505          

HSP 3 Score: 69.3218 bits (168), Expect = 3.960e-11
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1536 TGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANHHRFKAVH-CYGRLSLLERLLDKF 1955
            +G +++    V++ +  D  Y ++V AL+  R +L Y  C + +E  ++ R++ PV+  +L  C D +  + +Q+ +S + EL  GQ G +A+GREI K  S+ V G   +    + N           GRL L++RLL +F
Sbjct:  624 SGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCAD-ANSRTSQLSISTVLELCKGQAGELAVGREILKAGSIGVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLLEF 764          
BLAST of MAP3K-1 vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 187.578 bits (475), Expect = 2.280e-49
Identity = 108/286 (37.76%), Postives = 157/286 (54.90%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS*MFFRYH 3746
            R+   W  G LLG GAF + Y   DV TG  +AVKQ+  +  S + ++E+  A++ E+ L+  L H  ++   G +  P +  +S+F+ +MPGGS+   L  Y A  E VT  Y  Q   G+ Y+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  D+WS AC ++EMLT   PW +      +A ++ IA+    PKLP  +S D T      +  + K RP + +L      +H    MF  YH
Sbjct:  351 RAPTNWRLGKLLGQGAFGRVYLCYDVDTGRELAVKQVQFNPESPETSKEV-NALECEIQLLKNLLHERIVQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTG-NIKLGDFGASKRLQTICLSGTG--MKSVTGTPYWMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAE---FEAMAAIFKIATQPTNPKLPPHVS-DYTRDFLKRIFVEAKLRPSAEEL-----LRH----MFVHYH 619          
BLAST of MAP3K-1 vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 182.57 bits (462), Expect = 1.271e-47
Identity = 103/266 (38.72%), Postives = 150/266 (56.39%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNR---DPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+     S + ++E+  A++ E+ L+  L H  ++   G +    + I+++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P+LP  IS    E   D L R   + ++RP + +L
Sbjct:  362 WRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEV-SALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQTICMSGTG--IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPQLPSHIS----EHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of MAP3K-1 vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 166.007 bits (419), Expect = 8.418e-43
Identity = 91/271 (33.58%), Postives = 149/271 (54.98%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLS-NGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            W +G +LG GA+   Y G     G L+AVKQ+++  S     E+  + ++ EV+L+  L H N++  LG      +N +S+F+ ++PGGS++S++N++    E V   Y  Q  +G++Y+H N ++HRD+KG N++L  +G+ +++ DFG + RL+  G +   SD    + GT  +MAPEV+    YGR  D+WS  C + EM TG  P    +     A+ Y  A     P LP + S    + +  CL RD  +RP + +L  +   K
Sbjct:  248 WTKGEILGRGAYGTVYCGL-TSLGQLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLE--ENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGI-IKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRMA--AMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFLK 512          
BLAST of MAP3K-1 vs. Ensembl Mouse
Match: Map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:MGI Symbol;Acc:MGI:1203481])

HSP 1 Score: 166.392 bits (420), Expect = 6.862e-41
Identity = 91/271 (33.58%), Postives = 149/271 (54.98%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLS-NGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            W +G +LG GA+   Y G     G L+AVKQ+++  S     E+  + ++ EV+L+  L H N++  LG      +N +S+F+ ++PGGS++S++N++    E V   Y  Q  +G++Y+H N ++HRD+KG N++L  +G+ +++ DFG + RL+  G +   SD    + GT  +MAPEV+    YGR  D+WS  C + EM TG  P    +     A+ Y  A     P LP + S    + +  CL RD  +RP + +L  +   K
Sbjct: 1044 WTKGEILGRGAYGTVYCGL-TSLGQLIAVKQVALDTSDKLATEKEYRKLQEEVDLLKALKHVNIVAYLGTCLE--ENTLSIFMEFVPGGSISSIINRFGPLPEMVFCKYTRQILQGVAYLHDNCVVHRDIKGNNVMLMPTGI-IKLIDFGCAKRLAWAGLNGTHSDMLKSMRGTPYWMAPEVINESGYGRKSDIWSIGCTVFEMATGKPPLASMDRM--AAMFYIGAHRGLMPPLPARFSEPAADFVRLCLTRDQHERPSALQLLKHSFLK 1308          
BLAST of MAP3K-1 vs. UniProt/SwissProt
Match: sp|P53349|M3K1_MOUSE (Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus OX=10090 GN=Map3k1 PE=1 SV=3)

HSP 1 Score: 309.301 bits (791), Expect = 6.380e-85
Identity = 143/285 (50.18%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG       YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + Y  Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1209 PGHTKAKQPYREDAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMGHLNHPNIIRMLGATCEKSN--YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVAVRCLELQPQDRPPSRELLKHPVFR 1490          

HSP 2 Score: 95.9005 bits (237), Expect = 2.075e-18
Identity = 74/255 (29.02%), Postives = 111/255 (43.53%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDC--DEPRPNESLDEITCSICLQEMNIAQLLIFCHN-CSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLE 1136
            Y       ++  + +    +L Q  P SF +   S  ++Y V IGPQ C C         + +F C+HLLF+M +V Q+   DP+L  K LKN EV+ LF+++                           H   +SR    + +   ++ S M N            +  +   DE       +E  C ICL  M   + L  C + C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++ SP+E
Sbjct:  294 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSC--------GRGAF-CIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKY---------------------------HSRRSSRIKAPSRNTIQKFVSRMSNSHTLSSSSTSTSSSENSIKDE-------EEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVE 505          

HSP 3 Score: 68.9366 bits (167), Expect = 3.118e-10
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1536 TGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANHHRFKAVH-CYGRLSLLERLLDKF 1955
            +G +++    V++ +  D  Y ++V AL+  R +L Y  C + +E  ++ R++ PV+  +L  C D +  + +Q+ +S + EL  GQ G +A+GREI K  S+ V G   +    + N           GRL L++RLL +F
Sbjct:  624 SGDVVEACCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCAD-ANSRTSQLSISTVLELCKGQAGELAVGREILKAGSIGVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLLLEF 764          
BLAST of MAP3K-1 vs. UniProt/SwissProt
Match: sp|Q13233|M3K1_HUMAN (Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4)

HSP 1 Score: 308.916 bits (790), Expect = 1.045e-84
Identity = 143/285 (50.18%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG       YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA    ++   ++F+ WM GGSVA LL++Y AF E V + Y  Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1228 PGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSN--YNLFIEWMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFR 1509          

HSP 2 Score: 70.8626 bits (172), Expect = 9.034e-11
Identity = 43/142 (30.28%), Postives = 76/142 (53.52%), Query Frame = 3
Query: 1536 TGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANHHRFKAVH-CYGRLSLLERLLDKF 1955
            +G +++    V++ +  D  Y ++V AL+  R +L Y  C + +E  ++ R++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + N           GRL L++RLL +F
Sbjct:  628 SGDVVEACCSVLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLQPVVDTILVKCAD-ANSRTSQLSISTLLELCKGQAGELAVGREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEF 768          

HSP 3 Score: 65.855 bits (159), Expect = 2.983e-9
Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 3
Query:  927 DEITCSICLQEMNIAQLLIFCHN-CSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLE 1136
            +E  C ICL  M   + L  C + C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++ SP++
Sbjct:  439 EEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVD 510          
BLAST of MAP3K-1 vs. UniProt/SwissProt
Match: sp|Q62925|M3K1_RAT (Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Map3k1 PE=1 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 3.890e-84
Identity = 142/285 (49.82%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG    +  YR   EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA    ++   ++F+ WM G SVA LL++Y AF E V + Y  Q  RGLSY+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P  +S  L ++   CL   P+ RP S +L  + VF+
Sbjct: 1209 PGHTKANEPYREDTEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSN--YNLFIEWMAGASVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFR 1490          

HSP 2 Score: 103.605 bits (257), Expect = 7.915e-21
Identity = 76/253 (30.04%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHN-CSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI-SRDIVSPLE 1136
            Y       ++  + +    +L Q  P SF +   S  ++Y V IGPQ C C         + +F C+HLLF+M +V Q+   DP+L  K LKN EV+ LF++++ R   ++  P R                 NT +          ++ S M N   H L           +  +  E   E  C ICL  M   + L  C + C N+ H  C+ IW +EC++N E L CPLCR  W S D  S ++ SP++
Sbjct:  289 YSPEETSRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSC--------GRGTF-CIHLLFVMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSR-----------------NTIQ----------KFVSRMSN--CHTLSSSSTSTSSSENSIKDEE---EQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNREPLICPLCRSKWRSHDFYSHELSSPVD 500          

HSP 3 Score: 68.9366 bits (167), Expect = 3.253e-10
Identity = 45/134 (33.58%), Postives = 72/134 (53.73%), Query Frame = 3
Query: 1554 EAF-RVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANHHRFKAVH-CYGRLSLLERLL 1946
            EAF  V++ +  D  Y ++V AL+  R +L Y  C + +E  ++ R++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ V G   +    + N           GRL L++RLL
Sbjct:  624 EAFCSVLSIVCADPVYKVYVAALKTLRAMLVYTPCHSLAERIKLQRLLRPVVDTILVKCAD-ANSRTSQLSISTLLELCKGQAGELAVGREILKAGSIGVGGVDYVLSCILGNQAESNNWQELLGRLCLIDRLL 756          
BLAST of MAP3K-1 vs. UniProt/SwissProt
Match: sp|O22042|M3K3_ARATH (Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ANP3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 7.677e-52
Identity = 113/330 (34.24%), Postives = 187/330 (56.67%), Query Frame = 3
Query: 2805 QTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSI--DKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH--LTS*MFFRYHQYRALSNSISFC 3782
            + NS  R   + + S+PPPGL     E      W +G L+G GAF + Y G ++ +G L+A+KQ+ I+ SS   +K +  I+ ++ EV L+  L+HPN++  LG +     + +++ + ++PGGS++SLL ++ +F EPV + Y  Q   GL Y+H+N I+HRD+KGAN+L+D+ G  +R++DFGAS ++      N +     + GT  +MAPEV+    +  S D+WS  C +IEM TG  PW ++      A +  I   +  P +PE +S +  + L  CL+++P     S +L +  + +H  +T     R   Y A  NS++ C
Sbjct:   35 KINSSIRSSRIGLFSKPPPGLPAPRKEEAPSIRWRKGELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKNLSHPNIVRYLGTVRE--SDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGANILVDNKGC-IRLADFGASKKVVELATVNGAK---SMKGTPYWMAPEVILQTGHSFSADIWSVGCTVIEMATGKPPWSEQYQ--QFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEP-----SLRLSATELLQHPFVTG---KRQEPYPAYRNSLTEC 348          
BLAST of MAP3K-1 vs. UniProt/SwissProt
Match: sp|Q9FZ36|M3K2_ARATH (Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ANP2 PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.764e-51
Identity = 109/306 (35.62%), Postives = 180/306 (58.82%), Query Frame = 3
Query: 2784 FRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISH--SSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSN-GRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            F  +LA++  S  RK  +  +SQ PP       + +    W +G L+G GAF   Y G ++ +G L+AVKQ+ I+   +S +K +  I+ ++ EV L+  L+HPN++  LG +    D  +++ + ++PGGS++SLL ++ AF E V   Y  Q   GL Y+H++ I+HRD+KGAN+L+D+ G  ++++DFGAS +++     S A   K    GT  +MAPEV+    +  S D+WS  C +IEM+TG  PW  +     +A ++ I + +  P +P+ IS+D  + L  CL ++P  RP +S+L
Sbjct:   30 FPSLLADKITSCIRKSMVFAKSQSPPNNSTV--QIKPPIRWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITSNCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVRE--DETLNILLEFVPGGSISSLLEKFGAFPESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANILVDNQGC-IKLADFGASKQVAELATISGAKSMK----GTPYWMAPEVILQTGHSFSADIWSVGCTVIEMVTGKAPWSQQ--YKEIAAIFHIGTTKSHPPIPDNISSDANDFLLKCLQQEPNLRPTASEL 324          
BLAST of MAP3K-1 vs. TrEMBL
Match: A0A224AC19 (Mitogen-activated protein kinase kinase kinase 1 OS=Dugesia japonica OX=6161 GN=MEKK1 PE=2 SV=1)

HSP 1 Score: 1779.22 bits (4607), Expect = 0.000e+0
Identity = 886/1042 (85.03%), Postives = 948/1042 (90.98%), Query Frame = 3
Query:  600 MCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQXXXXXXXXXXXXMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
            MCKVLQVHERDPLLL  +LK +EV+ELF+RF+KR KEKL+NPYRPNDK+CKN NHE++ EGNTSRFGR                         +KNK D +EP PNES+DEITCSICLQEMN AQLL FC NCSNEFHKKCILIWLKECKKN+E LTCPLCRKSWPS+D +RD+ SPLEYGP++ DSN FVPRSHST   FQHINHREITN+ASSTSDLTSSNFSFNINGSKH F++ SNHKP+G+CFS  VA+MLSSDM DKREA LRQVAEQTVQIVVSAGSAYSVEDNK+NCMS TISTDIVSSMGGFTTGLMLKEAFRVIA+LLDDT YTLF+GALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGD+SQKKKAQM LSALFELANGQEGGMALGREIKK+SLPVTGWQRLAKFAI+NHHRFKA+HCYGRLSLLERLLDKFELTL+ILRKLLEFVT QLLLMHRS+HLLNSFDS K+D LETTDVDTGLST+DIRLLSGQRLQKLAKILFINTAKL++SKLKF G+S HD Y+EL KDL+++PQPWK+KF+IKLKIP +   N E  E+D S  N+EKK+ E +  TVTP  VSKSYRISKRYSQ KPVG A+KIG  Q  NSVNSLK+R GS++Q+IRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSS FFSELAIHNSIYGHQFGLQESSSDERNEEEE+ +TN IFRKIL EQ+N+ ++KD LDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHS IDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGA+FSP+DN ISMFVRWMPGGSVASLL  YSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS
Sbjct:    1 MCKVLQVHERDPLLLSNNLKVVEVEELFQRFHKRRKEKLSNPYRPNDKHCKNSNHEDDVEGNTSRFGR-------------------------SKNKPDGNEPHPNESMDEITCSICLQEMNTAQLLKFCQNCSNEFHKKCILIWLKECKKNDEGLTCPLCRKSWPSNDFNRDVTSPLEYGPALTDSNIFVPRSHSTVMPFQHINHREITNMASSTSDLTSSNFSFNINGSKHNFNIPSNHKPLGFCFSPDVAKMLSSDMCDKREAALRQVAEQTVQIVVSAGSAYSVEDNKLNCMSGTISTDIVSSMGGFTTGLMLKEAFRVIAKLLDDTIYTLFIGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDSSQKKKAQMSLSALFELANGQEGGMALGREIKKTSLPVTGWQRLAKFAISNHHRFKAMHCYGRLSLLERLLDKFELTLEILRKLLEFVTYQLLLMHRSIHLLNSFDSSKLDSLETTDVDTGLSTTDIRLLSGQRLQKLAKILFINTAKLLLSKLKFQGYSHHDAYLELLKDLDKIPQPWKDKFIIKLKIPKDHLNNYENVEIDISDHNKEKKKAEGSSVTVTPGSVSKSYRISKRYSQMKPVGGAAKIGNNQLTNSVNSLKMRAGSLTQSIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSAFFSELAIHNSIYGHQFGLQESSSDERNEEEEINKTNTIFRKILQEQSNATNQKDCLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSCIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAVFSPSDNTISMFVRWMPGGSVASLLTHYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 1017          
BLAST of MAP3K-1 vs. TrEMBL
Match: I1ZI84 (MAP3K-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 670.618 bits (1729), Expect = 0.000e+0
Identity = 321/321 (100.00%), Postives = 321/321 (100.00%), Query Frame = 3
Query: 2763 MKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
            MKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS
Sbjct:   15 MKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 335          
BLAST of MAP3K-1 vs. TrEMBL
Match: A0A564XX19 (Protein kinase domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS828 PE=3 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 7.069e-95
Identity = 148/279 (53.05%), Postives = 192/279 (68.82%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
            + G +W  GP LG GAFS CYQ RD+RTG LMAVK++     S  + EE +     EV +M +L HPN+L L G  ++P    + +FV WMPGGS+ SLLNQY AF E V+LAY LQ  RG+S +H + ILHRDLKGANLL+D +G  +RISDFGASARL + + S A  F+GQ++GT AFMAPEVLRGE YGR+CD+WS  CC++EML+G  PW D   TN  ALM+TIAS ++PP   + IS  + + L  C NR P++RP + +L  + VF  +TS
Sbjct:    1 KEGVDWLLGPFLGKGAFSLCYQARDIRTGTLMAVKRLRFVGESGSEAEEQLATAMEEVEIMRRLYHPNILRLFGIAYNPEKKHVDIFVEWMPGGSITSLLNQYGAFTESVSLAYILQVIRGISCLHKHGILHRDLKGANLLVDCTGSVVRISDFGASARLGS-QGSVAGQFQGQVIGTFAFMAPEVLRGEAYGRACDIWSVGCCLLEMLSGKPPWNDSRLTNQYALMFTIASTDQPPPYTKSISPSVRQFLDSCFNRVPEQRPTARRLLQHPVFSAITS 278          
BLAST of MAP3K-1 vs. TrEMBL
Match: A0A5K3FM76 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 5.408e-94
Identity = 157/305 (51.48%), Postives = 204/305 (66.89%), Query Frame = 3
Query: 2811 NSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
             S+D K+ L  E +           YR G +W  GP LG GAFS+CYQ RD+RTG LMAVK++     S  ++ E +     EV +M +L+HPNVL L G  ++P    + +FV WMPGGS+ SLLNQY AF EPV+LAY LQ  RG+S +H + ILHRDLKGANLL+D +G  +RISDFGASARL   + S A  F+GQ++GT AFMAPEVLRGE YGR+CD+WS  CC++EML+G  PW D   TN  ALM+TIASA++PP  P+ IS  + + L  C NR P++RP + +L  + VF  + S
Sbjct:  376 QSLDAKEPLKTEYR-----------YREGVDWLLGPFLGKGAFSQCYQARDLRTGTLMAVKRLRFMGDSSAESMEQLATATEEVAIMRRLHHPNVLRLFGIAYNPEKRHVDIFVEWMPGGSITSLLNQYGAFTEPVSLAYILQVIRGISCLHKHGILHRDLKGANLLVDGTGSVVRISDFGASARLGT-QGSVAGQFQGQVIGTFAFMAPEVLRGETYGRACDIWSVGCCLLEMLSGKPPWNDSRLTNQYALMFTIASADQPPSYPKSISPPVKKFLDSCFNRIPEQRPTARRLLQHPVFSSIVS 668          
BLAST of MAP3K-1 vs. TrEMBL
Match: A0A0B6ZPN5 (Protein kinase domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF74868 PE=3 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 1.636e-90
Identity = 151/302 (50.00%), Postives = 207/302 (68.54%), Query Frame = 3
Query: 2823 RKDSLDIESQPPPGLGVFSSE------YRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVF 3710
            R++ + I  QP    G   ++      Y     W +GPLLGTGA+S CYQ RDVRTG++MAVKQIS   +S  + E++I+A+  E+++M +L+HPN++ +LGA         +MFV WMPGGSVA LL +Y AF E V ++Y  Q  RGL+Y+H N ILHRDLKGANLL+DS+G  LRI DFGASARL++ + + A +F+GQLLGT+AFMAPEVLRGE YGR+CDVWS  C +IEM T   PW   + +NHLAL++ IAS+ + P +PE IS  + +L+  CL ++ + RP +  L  + +F
Sbjct:  143 REEVITIRIQPDEDCGDNENDSKQPMMYLEKVNWVKGPLLGTGAYSSCYQARDVRTGVIMAVKQISFCRNSAQEQEKVIEAISEEIHMMARLSHPNIVRILGATKQGCH--FNMFVEWMPGGSVAYLLGEYGAFTENVLVSYTRQVLRGLAYLHDNHILHRDLKGANLLVDSTGQTLRIGDFGASARLAS-QATGAGEFQGQLLGTIAFMAPEVLRGESYGRACDVWSVGCVMIEMFTTKPPWNATDVSNHLALIFKIASSIDSPPIPENISPPVRDLMLRCLEQNSEDRPSAKDLLLHPLF 441          
BLAST of MAP3K-1 vs. Ensembl Cavefish
Match: map3k1 (mitogen-activated protein kinase kinase kinase 1 [Source:NCBI gene;Acc:103042517])

HSP 1 Score: 312.383 bits (799), Expect = 9.772e-87
Identity = 145/285 (50.88%), Postives = 197/285 (69.12%), Query Frame = 3
Query: 2859 PGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            PG       YR G EW +G  +G GAFS CYQ +DV TG LMAVKQ++   ++  + EE+++A++ E+ +M  LNHPN++ +LGA      N  ++FV WM GGSV+ LLN+Y AF E V + Y  Q  RGL+Y+H N+I+HRD+KGANLL+DS+G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG++YGRSCDVWS  C IIEM     PW    H+NHLAL++ IASA   P +P Q+S  L ++   CL   P  RP S +L  + +F+
Sbjct: 1235 PGHTKAKQPYREGAEWLKGQQIGLGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCE--KNNYNLFVEWMAGGSVSHLLNKYGAFKEGVIINYTEQLLRGLAYLHENQIIHRDIKGANLLIDSTGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMSCAKPPWNAEKHSNHLALIFKIASATTAPTIPPQLSPGLRDVTLRCLELQPADRPPSRELLKHPIFR 1516          

HSP 2 Score: 100.908 bits (250), Expect = 7.180e-21
Identity = 73/245 (29.80%), Postives = 109/245 (44.49%), Query Frame = 3
Query:  387 YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGS-SSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDC--DEPRPNESLDEITCSICLQEMNIAQLLIFCH-NCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDI 1109
            Y       ++  + +    +L Q  P SF +   S  ++Y V IGPQTC C         + +F C+H+LF+M +V Q+   DPLL  K LKN EV+ LF++++ R   ++  P R                 NT +          ++ S M N   +        +      DE       +E  C ICL +M   + L  C   C N+ H  C+ IW +EC++N+E L CPLCR  W S D 
Sbjct:  313 YSPEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQTCSC--------GRGAF-CIHVLFVMLRVFQLESSDPLLWRKTLKNFEVESLFQKYHNRRSSRIKAPSR-----------------NTIQ----------KFVSRMSNSHTNCTSSSSPSSNESSMKDE-------EEQMCPICLLDMLDEESLTVCEEGCRNKLHHHCMSIWAEECRRNHEPLICPLCRAKWKSHDF 514          

HSP 3 Score: 68.9366 bits (167), Expect = 4.057e-11
Identity = 43/134 (32.09%), Postives = 76/134 (56.72%), Query Frame = 3
Query: 1566 VIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREI-KKSSLPVTGWQRLAKFAIANH---HRFKAVHCYGRLSLLERLLDKF 1955
            V++ +  D  Y ++V AL+  R +L Y  C + SE  R+ +++ PV+  +L  C D +  + +Q+ +S L EL  GQ G +A+GREI K  S+ + G   +    + +    + ++A+   GRL L++RLL +F
Sbjct:  652 VLSMVCADPVYKVYVAALKTLRAMLVYTPCHSLSERSRLQQLLRPVVETILVKCAD-ANSRTSQLSVSTLLELCKGQLGELAVGREILKAGSIGIGGVDYVLNCILGSQTESNNWQAL--LGRLCLIDRLLLEF 782          
BLAST of MAP3K-1 vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 183.726 bits (465), Expect = 3.357e-48
Identity = 103/266 (38.72%), Postives = 147/266 (55.26%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            W QG LLG GAF + Y   D  TG  +AVKQ+       + ++E+  A++ E+ L+  L H  ++   G +  P    +S+FV +MPGGS+   L  Y A  E VT  Y  Q  +G+ Y+HSN I+HRD+KGAN+L DSSG  +++ DFGAS R+     S        + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW +      +A ++ IA+    P LPE +S    + L      + K RP +  L S+
Sbjct:  354 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEV-NALECEIQLLKNLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSG-NVKLGDFGASKRIQTICMSGTG--IKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAE---YEAMAAIFKIATQPTKPNLPEGVSDACRDFLRQVFVEE-KWRPTAEGLLSH 611          
BLAST of MAP3K-1 vs. Ensembl Cavefish
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3-like [Source:NCBI gene;Acc:103044968])

HSP 1 Score: 183.726 bits (465), Expect = 3.749e-48
Identity = 103/266 (38.72%), Postives = 147/266 (55.26%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            W QG LLG GAF + Y   D  TG  +AVKQ+       + ++E+  A++ E+ L+  L H  ++   G +  P    +S+FV +MPGGS+   L  Y A  E VT  Y  Q  +G+ Y+HSN I+HRD+KGAN+L DSSG  +++ DFGAS R+     S        + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW +      +A ++ IA+    P LPE +S    + L      + K RP +  L S+
Sbjct:  357 WRQGKLLGRGAFGEVYLCYDADTGRELAVKQVPFDPECHETSKEV-NALECEIQLLKNLRHERIVQYYGCLRDPEQRKLSIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSG-NVKLGDFGASKRIQTICMSGTG--IKTVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAE---YEAMAAIFKIATQPTKPNLPEGVSDACRDFLRQVFVEE-KWRPTAEGLLSH 614          
BLAST of MAP3K-1 vs. Ensembl Cavefish
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 170.629 bits (431), Expect = 7.505e-47
Identity = 96/265 (36.23%), Postives = 152/265 (57.36%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNA-SDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEE-PPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +G +LG GA+   Y G     G L+AVKQ+ +  S+ +  E+    ++ EV+L+  L HPN++  LG     TDN+IS+F+ ++PGGS++S+LN++    E V   Y  Q   G++Y+H NR++HRDLKG NL+L  +G+ +++ DFG + RL+    S   SD    + GT  +MAPEV+    +G+  DVWS  C + EM TG  P     H   +A ++ I + +   P LP+  S +    +  CL  + K+RP ++ L
Sbjct:   16 WAKGEVLGRGAYGTVYCGL-TSQGQLIAVKQVLLDVSTSETAEKEYSRLEREVDLLKNLEHPNIVGFLGTAL--TDNVISIFMEYVPGGSISSVLNRFGPLPEKVFALYTRQVLEGVAYLHENRVIHRDLKGNNLMLMPTGV-VKLIDFGCARRLNRLTHSGGNSDLLKSVHGTPYWMAPEVINETGHGKKSDVWSIGCTVFEMATGKPPLA---HMGKMAALFYIGARKGLMPPLPDDFSEEAKSFVKACL-INQKQRPSAADL 272          
BLAST of MAP3K-1 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 177.178 bits (448), Expect = 6.663e-46
Identity = 99/266 (37.22%), Postives = 148/266 (55.64%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNR---DPKKRPLSSKL 3692
            W +G LLG GAF + Y   DV TG  +A KQ+    +S + ++E+   ++ E+ L+  L+H  ++   G +    +  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL       +S     + GT  +M+PEV+ G+ YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P LP   S    E   D + R   + K RP + +L
Sbjct:  356 WRRGKLLGQGAFGRVYLCYDVDTGRELAAKQVQFDPASPETSKEV-STLECEIQLLKNLHHERIVQYYGCLRDHNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQT--ICMSSTGVRSVTGTPYWMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPILPSHTS----EQTRDFIRRIFVEAKHRPSAEEL 610          
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006402.1 (pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 gene:ENSPMAG00000005783.1 transcript:ENSPMAT00000006402.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.411 bits (716), Expect = 1.012e-85
Identity = 131/280 (46.79%), Postives = 193/280 (68.93%), Query Frame = 3
Query: 2886 YRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNR----ILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            Y+ G EW +G  +G GAFS C+Q +D+ TG LMAVKQ++   ++  + +E+++ ++ E+ +M +L+HPN++ +LGA    ++   ++F+ WM GGSVA+LLN+Y  F E V ++Y  Q  RGL+Y+HSN+    ++HRD+KGANLL+DS G RLRI+DFGA+ARL++ + + A +F+GQLLGT+AFMAPEVLRG +YGRSCD+WS  C IIEM     PW    H+NHLAL++ IAS    P +P  +   L ++   CL   P  RP++  L  + VF+
Sbjct:   18 YQEGAEWLRGQQIGLGAFSSCFQAQDIGTGTLMAVKQVTYVRNTASEQDEVVQTLREEIRMMSRLDHPNIIRMLGATCEKSN--YNLFIEWMAGGSVANLLNKYGPFHERVVISYVEQLLRGLAYLHSNQHSNQLIHRDIKGANLLVDSMGQRLRIADFGAAARLAS-KGTGAGEFQGQLLGTIAFMAPEVLRGLQYGRSCDIWSVGCVIIEMSCAKPPWNAEKHSNHLALIFKIASTTTAPTVPPTLCPGLRDVALRCLELQPSDRPVARDLLKHPVFR 294          
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 181.415 bits (459), Expect = 4.971e-48
Identity = 94/251 (37.45%), Postives = 141/251 (56.18%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELL 3641
            R+   W +G LLG GAF + Y   D  TG  +AVKQ+     S++ ++E+  A++ E+ L+  L H  ++   G +  P    +S+F+ +MPGGS+   L  Y A  E VT  Y  Q   G+S++H N I+HRD+KGAN+L DS+G  +++ DFGAS RL        +     + GT  +M+PEV+ GE YGR  D+WS  C ++EMLT   PW +      +A ++ IA+    P+LP   S    +LL
Sbjct:  354 RAPTNWQRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEV-NALECEIQLLKNLQHERIVQYFGCLRDPQQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTG-NVKLGDFGASKRLQTICSQGTA--MRSVTGTPYWMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAE---FEAMAAIFKIATQPTDPRLPLHASEHARDLL 597          
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 147.517 bits (371), Expect = 1.806e-39
Identity = 89/273 (32.60%), Postives = 141/273 (51.65%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISI-------SHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            W +G  LG GAF   + G     G L+AVK++ +        +    K  E+ K ++ EV L+  L+HPNV+  LG       N  S+F+ ++PGG+VA  +  +    E V  +Y  Q  RGL+Y+H + ++H D+KG+N ++  +G+ +++ DFG + R++     + +     + GT  +MAPEV+ G  Y R  DVWS  C + EM  G  P+ D       AL++        P LP+  S +  E +  C  RD  KRP S +L S+
Sbjct:   15 WIKGNRLGKGAFGTVFLGL-TNQGKLIAVKELELRDAQSANGNQGGQKQSELQK-LQDEVELLTTLHHPNVVEYLGTEME--GNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGV-VKLIDFGCAQRVALALSCHENGGLHSVHGTAYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADM--APMAALLHIGIRNGIMPGLPQAFSKEAQEFVEQCFIRDKLKRPSSQELLSH 280          
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 135.576 bits (340), Expect = 2.605e-32
Identity = 88/260 (33.85%), Postives = 137/260 (52.69%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSV-ASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEE-----YGRSCDVWSFACCIIEMLTGSQPWRDRNHT-NHLALMYTIASAEEPPKL--PEQISADLTELLTDCLNRDPKKR 3674
            LG GAF K Y+ ++  +G+L A K I        K+EE ++    E+ ++   +HPN++ LL A +   +N + +F+ + PGG+V A +L       EP       Q    L+Y+H++RI+HRDLK  N+LL   G  ++++DFG SA+  N R     D     +GT  +MAPEV+  E      Y    D+WS    +IE+     P    NH  N + +M  IA   +PP L  P + SA+ T+ L  CL+++P+ R
Sbjct:   39 LGDGAFGKVYKAQNKESGVLAAAKVIET------KSEEELEDYMVEIEILALCDHPNIVGLLNAFY--YENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEG-DVKLADFGVSAK--NTRTLQRRD---SFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPP----NHELNPMRVMLKIAK-NDPPSLSFPSKWSAEFTDFLKKCLDKNPETR 279          
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006100.1 (pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 gene:ENSPMAG00000005510.1 transcript:ENSPMAT00000006100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 5.390e-29
Identity = 90/307 (29.32%), Postives = 151/307 (49.19%), Query Frame = 3
Query: 2832 SLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSA---FLEPVTLAYALQTARGLSYIHSNR---ILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS*MF 3734
            S D+E+ PP     F  E  S  E     ++G GAF    + +    G+ +A+KQI        ++E   KA   E+  + ++NHPN++ L GA  +P    + + + +  GGS+ ++L+       +     + + LQ A+G++Y+H  +   ++HRDLK  NLLL S G  L+I DFG +  +     +N         G+ A+MAPEV  G  Y   CDV+S+   + E++T  +P+ D        +M+ + +   PP L + +   +  L+T C +++P  RP  S  E  R+  HL    F
Sbjct:    7 SGDMEATPPG----FVEEIDSD-EIIVEEVVGRGAFGVVCKAK--WRGMDVAIKQI--------ESESERKAFIVELRQLSRVNHPNIVRLYGACLNP----VCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMRWCLQCAQGVAYLHCMKPKALIHRDLKPPNLLLISGGTILKICDFGTACDIQTHMTNNK--------GSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPF-DEIGGPAFRIMWAVHNGTRPP-LIKNLPKPIEGLMTRCWDKEPALRP--SMEEIVRIMIHLMKVQF 282          
BLAST of MAP3K-1 vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 177.948 bits (450), Expect = 2.383e-45
Identity = 106/281 (37.72%), Postives = 163/281 (58.01%), Query Frame = 3
Query: 2883 EYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEI---IKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEE-YGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQ----ISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            EY+  + W +G ++G G+F   Y   +V TG +MAVKQ+ +   S  +NE I   ++A+++EV+ +  L+H N++  LG  F   +NI S+F+ ++ GGSV SL+  Y  F EP+      Q  +GL+Y+HS  ILHRD+K  NLLLD  G+  +ISDFG S R S    SN SD    + GTV +MAPE++  ++ Y    D+WS  C ++EM  G +PW   ++   +A M+ I  ++  P +PE     IS      L  C   +P+KRP +++L S+
Sbjct: 1169 EYKE-FAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYS-SQNEAILSTVEALRSEVSTLKDLDHLNIVQYLG--FENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGI-CKISDFGIS-RKSKDIYSN-SDM--TMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSH 1437          
BLAST of MAP3K-1 vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 151.369 bits (381), Expect = 5.722e-38
Identity = 89/298 (29.87%), Postives = 153/298 (51.34%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSI----DKNEE----------------------------------IIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLS--NGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRP 3677
            W +G  +G+G+F   Y G +  TG LMAVKQ+ I +++I    D N++                                  ++ A++ E+NL+ +L+H N++   GA  S     +++F+ ++PGGSV+S+LN Y  F E +   +  Q   G++Y+H   I+HRD+KGAN+L+D  G  ++I+DFG S +LS  N + +     +  L G+V +M+PEV++        D+WS  C +IEM TG  P+ D    + +  ++ I +    P++P   +++    L      D + RP
Sbjct:  415 WLKGACIGSGSFGSVYLGMNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKELHHENIVTYYGA--SQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGC-VKITDFGISKKLSPLNKKQNK----RASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPD---FSQMQAIFKIGT-NTTPEIPSWATSEGKNFLRKAFELDYQYRP 701          
BLAST of MAP3K-1 vs. Ensembl Yeast
Match: SSK22 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; functionally redundant with Ssk2p; interacts with and is activated by Ssk1p; phosphorylates Pbs2p; SSK22 has a paralog, SSK2, that arose from the whole genome duplication [Source:SGD;Acc:S000000669])

HSP 1 Score: 145.591 bits (366), Expect = 1.869e-35
Identity = 89/279 (31.90%), Postives = 151/279 (54.12%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGAS-----ARLSNGRDSNASDFK------GQLLGTVAFMAPEVLRGEEY-GR--SCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLP--EQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +   +G G F + Y   ++  G ++AVK+I I  ++  K  +I   +K E+ ++  LNHPN++   G       + +++F+ +  GGS+ASLL+      E VT  Y  +   GL+Y+H + ++HRD+K  N+LLD +G+ ++  DFG +     +R    R++   DF        +++GT  +MAPE + G    G+  + DVW+  C ++EM TG +PW   N  N  A+MY +A A   P+LP  ++++A     L  CL +DP  R  + +L
Sbjct: 1034 WQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMK--KIFPLIKEEMTVLEMLNHPNIVQYYGV--EVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGI-IKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPW--SNLDNEWAIMYHVA-AGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVEL 1304          
BLAST of MAP3K-1 vs. Ensembl Yeast
Match: SSK2 (MAP kinase kinase kinase of HOG1 mitogen-activated signaling pathway; interacts with Ssk1p, leading to autophosphorylation and activation of Ssk2p which phosphorylates Pbs2p; also mediates actin cytoskeleton recovery from osmotic stress; a HOG-independent function of Ssk2p mediates the calcium-sensitive phenotype of the ptp2 msg5 double disruptant; SSK2 has a paralog, SSK22, that arose from the whole genome duplication [Source:SGD;Acc:S000005314])

HSP 1 Score: 144.821 bits (364), Expect = 3.198e-35
Identity = 93/295 (31.53%), Postives = 156/295 (52.88%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRD------------------SNASDFKG---------QLLGTVAFMAPEVLRGEEY-GR--SCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLP--EQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +   +G G F + Y   D+  G ++AVK+I+I  S     ++I   +K E++++  LNHPN++   G       + +++F+ +  GGS+A+LL       E VT  Y LQ   GL+Y+H + I+HRD+K  N+LLD +G+ ++  DFGA+ +++N                     ++ SD K           ++GT  +MAPE + G    G+  + DVWS  C ++EM+TG +PW   N  N  A+MY +A A   P+ P  +++S+   + L  CL ++P KR  + +L
Sbjct: 1266 WQKRNFIGGGTFGRVYSAVDLDNGEILAVKEINIQDSK--SMQKIFPLIKEEMSVLEILNHPNIVSYYGVEVHR--DKVNIFMEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGV-IKYVDFGAAKKIANNGTRLASMNKIENADGEHEDVTHVSDSKAVKNNENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPW--ANLDNEWAIMYHVA-AGHTPQFPTKDEVSSAGMKFLERCLIQNPSKRASAVEL 1552          
BLAST of MAP3K-1 vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 127.102 bits (318), Expect = 2.708e-30
Identity = 83/275 (30.18%), Postives = 143/275 (52.00%), Query Frame = 3
Query: 2895 GYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRS--CDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFK 3713
            G ++ +G  LG G F++C+Q +D  +G + A K  +++ +SI K+E+  K + +E+ +   ++HPN++  +       D+ + + +   P GS+  LL +     EP    +  Q    + Y+HS R++HRDLK  N+  DS+   L+I DFG +A L     +N S+ K  + GT  ++APEVL G+  G S   D+WS    +  +L G  P++ R+  N +           P   P  IS +   L+ D L+ DP +RP  +++  Y  F+
Sbjct:   79 GKDYHRGHFLGEGGFARCFQIKD-DSGEIFAAK--TVAKASI-KSEKTRKKLLSEIQIHKSMSHPNIVQFIDCF--EDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSN-YNLKIGDFGLAAVL-----ANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARD-VNTIYERIKCRDFSFPRDKP--ISDEGKILIRDILSLDPIERPSLTEIMDYVWFR 338          
BLAST of MAP3K-1 vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 276.559 bits (706), Expect = 3.788e-78
Identity = 127/275 (46.18%), Postives = 187/275 (68.00%), Query Frame = 3
Query: 2886 YRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVF 3710
            Y     W +G LLGTGAFS CY  RDV TG LMAVKQ+S   +S  + +++ + +  E+ ++ +L HP+++  LGA  +      ++F+ WM GGS++ LL++Y  F E + + Y  Q  +G+SY+H N+++HRD+KGAN+L+DS+G  +RI+DFGA+ARL+  + + A +F+GQLLGT+AFMAPEVLRGE YGRSCDVWS  C +IEM TG  PW    H+NHLAL++ IA A  PP +PE ++  + +++  CL   P+ RP +  L  + +F
Sbjct:  571 YLENVHWKKGELLGTGAFSSCYGARDVMTGSLMAVKQVSFCRNSKSEQDKVCQTIMDEIAILARLKHPHLIKCLGA--TRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLAT-QITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPLF 842          

HSP 2 Score: 80.8777 bits (198), Expect = 2.162e-15
Identity = 79/351 (22.51%), Postives = 136/351 (38.75%), Query Frame = 3
Query:  927 DEITCSICLQEMNIAQLLIFC-HNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQH-INHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNH----KPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSL-PVTGWQRLAKFAIANHHRFKAVHCY-GRLSLLERLLDKF 1955
            DE  C ICL EM   + L  C   C+N  H+ C+ IW  EC+   E L CPLCR+           + P E   S++D +   P+    A    + +   E+  +                    H   + +      +P    F   +   L S   + RE  LR+++             YS   N+ + ++D  + +   S+     G               D  Y ++V ALR  R +L +    +  E   +   + PV+  +L  C D +++  A + +  L E    + G +ALGR ++   + P+ G   +    +   H +     + GRL  L +LLD++
Sbjct:   22 DEEVCPICLLEMVEGESLTCCTGGCNNTLHQHCMEIWAAECRLRKERLNCPLCRR-----------ILPPEAAKSLSDRSPTGPKFLPCAPDVPNPLEPGEVITL-------------------PHSNPIPTGQVDLARPWVQAFGEELVSCLFSREWNIREIALRRLSRDI----------YSYLRNEASNLTDLTAVEASCSLLTMMCG---------------DPVYRVYVAALRTLRVMLAHTNYTSRDEKMLIQSYLHPVVEAILAKCSDGNRRISA-LSMKVLLEFCKDESGDLALGRMLRDHRIQPMGGLGFMLACILTTAHEYATWPWWLGRLYFLRKLLDEY 316          
BLAST of MAP3K-1 vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 203.371 bits (516), Expect = 1.054e-58
Identity = 89/195 (45.64%), Postives = 139/195 (71.28%), Query Frame = 3
Query: 2997 ISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIA 3581
            +S   +S  + +++ + +  E+ ++ +L HP+++  LGA  +      ++F+ WM GGS++ LL++Y  F E + + Y  Q  +G+SY+H N+++HRD+KGAN+L+DS+G  +RI+DFGA+ARL+  + + A +F+GQLLGT+AFMAPEVLRGE YGRSCDVWS  C +IEM TG  PW    H+NHLAL++ ++
Sbjct:   70 VSFCRNSKSEQDKVCQTIMDEIAILARLKHPHLIKCLGA--TRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARLAT-QITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIFKVS 261          
BLAST of MAP3K-1 vs. Ensembl Nematostella
Match: EDO47821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL88])

HSP 1 Score: 185.652 bits (470), Expect = 1.333e-52
Identity = 93/265 (35.09%), Postives = 155/265 (58.49%), Query Frame = 3
Query: 2901 EWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSN-GRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            EW +G +LG GAF   + G  V TG L+AVKQ+ +  +++D  E   + ++ EV L+  L H N++  +G     +   I++F+ ++PGGS+A  L ++ AF+EPV   Y  Q   G+SY+H+N ++HRD+KG N++L  +G+ +++ DFG + ++   G   + S+    + GT  +MAPEV+R   +GR  D+WS  C + EM TG  PW   ++   L+ ++ I +    P+L E  SA   + +T C+ RD   RP + +L
Sbjct:    4 EWQKGNVLGKGAFGTVFLGL-VNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLKHKNIVQYIGTCMDDSQCTINIFMEFVPGGSIAQALKRFGAFVEPVFRRYTRQILDGVSYLHNNNVIHRDIKGGNIMLMPNGV-IKLIDFGCAKKICMVGAHVSKSNILRSMRGTPYWMAPEVIRETGHGRKSDIWSIGCTVFEMATGQPPW---SNVPPLSAIFAIGNGSPVPRLDESFSAAAIDFVTSCMTRDQDTRPSADEL 263          
BLAST of MAP3K-1 vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 183.341 bits (464), Expect = 7.174e-52
Identity = 103/265 (38.87%), Postives = 154/265 (58.11%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISH-SSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNI-ISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +G LLG GAF + Y   D+ TG  +AVKQI     +S  KNE  +KA++ E+  M    +  ++   G     TD++ I +F+ ++PGGS+   + Q+ A  E +T  Y+ Q   G+ Y+H+NRI+HRD+KGAN+L D  G  ++++DFGAS RL   R  + + F+  + GT  +MAPEV+ GE YGR  DVWS  C ++EMLT   PW D      +A ++ IA+    P+LP  +S D  E +   L  + K RP + +L
Sbjct:    4 WRKGKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQLNSSTKNE--VKALEGEIEFMKAFRNERIVQYYGI---ETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYG-NVKLADFGASKRLQTIR--SKTGFR-SVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWAD---FEPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADEL 256          
BLAST of MAP3K-1 vs. Ensembl Nematostella
Match: EDO47144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS1])

HSP 1 Score: 131.724 bits (330), Expect = 8.573e-34
Identity = 86/266 (32.33%), Postives = 138/266 (51.88%), Query Frame = 3
Query: 2922 LGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLN-QYSAFLEPV-----TLAYALQTARGLSYIHSNR---ILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            +G GAF   Y+ R  R   ++AVK I        ++E   KA   EV  + +++H N++ L GA+       + + + +  GGS+ +LL+ + S    P+      +++ALQ A G+ Y+HS +   I+HRDLK  NLLL   G  ++I DFG +  L     +N         G+ A+MAPEV  G  Y   CDV+SF   + EM++  +P+ D   +    +M+ +     PP L + I   + EL+T C ++DP KRP  S++
Sbjct:   14 VGHGAFGVVYKAR-WREKFIVAVKTI--------ESEAEKKAFIVEVQQLSRVSHRNIIKLYGAV--TKHEPVCLVMEYAEGGSLYNLLHWKKSTSRAPIYTASHVISWALQCASGVEYLHSMKPKAIIHRDLKPPNLLLTRCGTVVKICDFGTACDLKTYMTNNK--------GSAAWMAPEVFEGNNYTEKCDVYSFGIILWEMISRRKPFDDMAGSPPFRIMWAVHIGRRPP-LIKNIPKPIEELITSCWDKDPDKRPSFSRI 259          
BLAST of MAP3K-1 vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 180.644 bits (457), Expect = 4.229e-47
Identity = 100/263 (38.02%), Postives = 146/263 (55.51%), Query Frame = 3
Query: 2904 WCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKL 3692
            W +G LLG GAF   Y   DV TG  +A KQ+     S + ++E+  A++ E+ L+  L+H  ++   G +   ++  +++F+ +MPGGSV   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS+G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  DVWS  C ++EMLT   PW +      +A ++ IA+    P LP   S D       C+  + K RP + +L
Sbjct:  353 WRRGKLLGQGAFGLVYLCYDVDTGRELAAKQVQFDPDSPETSKEV-SALECEIQLLKNLHHERIVQYYGCLRDHSEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAG-NVKLGDFGASKRLQTICMSGTG--IRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAE---YEAMAAIFKIATQPTNPLLPSHTS-DQARDFIHCIFVEAKHRPSAEEL 607          
BLAST of MAP3K-1 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 177.948 bits (450), Expect = 2.123e-46
Identity = 96/244 (39.34%), Postives = 138/244 (56.56%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQIS 3620
            R+   W QG LLG GAF + Y   D  TG  +A KQ+       + ++E+  A++ E+ L+  L H  ++   G +       +++FV +MPGGS+   L  Y A  E VT  Y  Q  +G+SY+HSN I+HRD+KGAN+L DSSG  +++ DFGAS R+     S        + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW +      +A ++ IA+    P LPE +S
Sbjct:  322 RAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEV-NALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSG-NVKLGDFGASKRIQTICMSGTG--IKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAE---YEAMAAIFKIATQPTKPTLPEGVS 558          
BLAST of MAP3K-1 vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 178.718 bits (452), Expect = 2.732e-46
Identity = 113/321 (35.20%), Postives = 163/321 (50.78%), Query Frame = 3
Query: 2781 IFRKILAEQTNSMDRKDSLDIESQPPPGLGVF---------SSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKH 3716
            +F   L E      R+   DIES   P  G           S   R+   W  G LLG GAF + Y   D  TG  +AVKQ+     S + ++E+  A++ E+ L+  L H  ++   G +    +  +S+F+  MPGGS+   L  Y A  E VT  Y  Q   G+SY+HSN I+HRD+KGAN+L DS G  +++ DFGAS RL     S        + GT  +M+PEV+ GE YGR  D+WS  C ++EMLT   PW +      +A ++ IA+    P+LP  +S    E L      + K+RP + +L  + +F H
Sbjct:  339 VFTPDLEEAPGPARRRRGSDIESNANPSAGPTLSVMDISPPSRSPRAPTNWRLGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPESPETSKEV-SALECEIQLLKNLCHERIVQYYGCLRDTMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVG-NVKLGDFGASRRLQTICLSGTG--IKSVTGTPYWMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAE---FEAMAAIFKIATQPTNPELPVHVSDHCREFLRRIF-VETKQRPSADELLRH-IFVH 650          
BLAST of MAP3K-1 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 177.948 bits (450), Expect = 2.991e-46
Identity = 97/244 (39.75%), Postives = 140/244 (57.38%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQIS 3620
            R+   W QG LLG GAF + Y   D  TG  +A KQ+       + ++E+  A++ E+ L+  L H  ++   G +       +++FV +MPGGS+   L  Y A  E VT  Y  Q  +G+SY+HSN I+HRD+KGAN+L DSSG  +++ DFGAS R+     S  +  K  + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW +      +A ++ IA+    P LPE +S
Sbjct:  352 RAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEV-NALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSG-NVKLGDFGASKRIQTICMS-GTGIKS-VTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAE---YEAMAAIFKIATQPTKPTLPEGVS 588          
BLAST of MAP3K-1 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 177.948 bits (450), Expect = 2.991e-46
Identity = 97/244 (39.75%), Postives = 140/244 (57.38%), Query Frame = 3
Query: 2889 RSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQIS 3620
            R+   W QG LLG GAF + Y   D  TG  +A KQ+       + ++E+  A++ E+ L+  L H  ++   G +       +++FV +MPGGS+   L  Y A  E VT  Y  Q  +G+SY+HSN I+HRD+KGAN+L DSSG  +++ DFGAS R+     S  +  K  + GT  +M+PEV+ GE YGR  DVWS AC ++EMLT   PW +      +A ++ IA+    P LPE +S
Sbjct:  352 RAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAKQVPFDPDCQETSKEV-NALECEIQLLKNLRHDRIVQYYGCLRDLDQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSG-NVKLGDFGASKRIQTICMS-GTGIKS-VTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAE---YEAMAAIFKIATQPTKPTLPEGVS 588          
BLAST of MAP3K-1 vs. Planmine SMEST
Match: SMESG000054386.1 (SMESG000054386.1)

HSP 1 Score: 2371.66 bits (6145), Expect = 0.000e+0
Identity = 1211/1213 (99.84%), Postives = 1211/1213 (99.84%), Query Frame = 3
Query:   87 MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELXXXXXXXXXXXXXXXXPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQXXXXXXXXXXXXMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
            MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELSRSTSTSKVSSKSQTKPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQS IQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQTCCCLTKSST SNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIASSTSDLTSSNFSFNINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQESSSDERNEEEEMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS
Sbjct:    1 MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELSRSTSTSKVSSKSQTKPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQSKIQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQTCCCLTKSSTGSNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIASSTSDLTSSNFSFNINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQESSSDERNEEEEMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 1213          
BLAST of MAP3K-1 vs. Planmine SMEST
Match: SMESG000054386.1 (SMESG000054386.1)

HSP 1 Score: 2305.02 bits (5972), Expect = 0.000e+0
Identity = 1186/1213 (97.77%), Postives = 1186/1213 (97.77%), Query Frame = 3
Query:   87 MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELXXXXXXXXXXXXXXXXPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQXXXXXXXXXXXXNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKSVMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIAXXXXXXXXXXXXXXINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQXXXXXXXXXXXXMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 3725
            MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELSRSTSTSKVSSKSQTKPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQS IQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQTCCCLTKSST SNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGR                         NKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIASSTSDLTSSNFSFNINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQESSSDERNEEEEMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS
Sbjct:    1 MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELSRSTSTSKVSSKSQTKPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHNYRQSKIQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQTCCCLTKSSTGSNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFKRFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGR-------------------------NKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIFCHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLEYGPSVADSNFFVPRSHSTATSFQHINHREITNIASSTSDLTSSNFSFNINGSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIVVSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLDDTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDNSQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIANHHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHLLNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMMSKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTEVDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGIQSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSESEDDISHETSSVFFSELAIHNSIYGHQFGLQESSSDERNEEEEMKRTNAIFRKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESYRVFKHLTS 1188          
BLAST of MAP3K-1 vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 159.458 bits (402), Expect = 6.089e-39
Identity = 94/268 (35.07%), Postives = 143/268 (53.36%), Query Frame = 3
Query: 2910 QGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVK---TEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEE-YGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            Q  +LG G F   + GR++   + +A+K++         NE  IK V+    E+ L  +L+H N++  LG+       +  + +  +PGGS+ SLL +  A  E  T  Y+ Q   GL Y+H NRI+HRD+KG N+L++     L+ISDFG S RL +     AS F     GT+ +MAPE+++G   YG   DVWSF C +IEMLTG  P+ D      +A ++ +    + P  P+ +S +  + L  C   DP KR   + L S+
Sbjct:  662 QRIVLGRGTFGTVFAGRELTKQIKIAIKEV---------NESQIKEVQPLHEEIWLHSRLSHRNIVSYLGS--RSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIM-QRASTFT----GTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLG--TPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSH 911          
BLAST of MAP3K-1 vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 159.073 bits (401), Expect = 7.178e-39
Identity = 94/268 (35.07%), Postives = 143/268 (53.36%), Query Frame = 3
Query: 2910 QGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVK---TEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEE-YGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            Q  +LG G F   + GR++   + +A+K++         NE  IK V+    E+ L  +L+H N++  LG+       +  + +  +PGGS+ SLL +  A  E  T  Y+ Q   GL Y+H NRI+HRD+KG N+L++     L+ISDFG S RL +     AS F     GT+ +MAPE+++G   YG   DVWSF C +IEMLTG  P+ D      +A ++ +    + P  P+ +S +  + L  C   DP KR   + L S+
Sbjct:  662 QRIVLGRGTFGTVFAGRELTKQIKIAIKEV---------NESQIKEVQPLHEEIWLHSRLSHRNIVSYLGS--RSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIM-QRASTFT----GTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLG--TPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSH 911          
BLAST of MAP3K-1 vs. Planmine SMEST
Match: SMESG000004938.1 (SMESG000004938.1)

HSP 1 Score: 159.073 bits (401), Expect = 7.205e-39
Identity = 94/268 (35.07%), Postives = 143/268 (53.36%), Query Frame = 3
Query: 2910 QGPLLGTGAFSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVK---TEVNLMIQLNHPNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYALQTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDSNASDFKGQLLGTVAFMAPEVLRGEE-YGRSCDVWSFACCIIEMLTGSQPWRDRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSSKLESY 3701
            Q  +LG G F   + GR++   + +A+K++         NE  IK V+    E+ L  +L+H N++  LG+       +  + +  +PGGS+ SLL +  A  E  T  Y+ Q   GL Y+H NRI+HRD+KG N+L++     L+ISDFG S RL +     AS F     GT+ +MAPE+++G   YG   DVWSF C +IEMLTG  P+ D      +A ++ +    + P  P+ +S +  + L  C   DP KR   + L S+
Sbjct:  662 QRIVLGRGTFGTVFAGRELTKQIKIAIKEV---------NESQIKEVQPLHEEIWLHSRLSHRNIVSYLGS--RSEKGVFKIIMEQVPGGSLTSLLKKNGALTEETTSYYSNQILEGLKYLHDNRIMHRDIKGDNVLVNMYNGILKISDFGTSKRLGDIM-QRASTFT----GTMQYMAPELIKGPSGYGFPADVWSFGCTVIEMLTGKPPFNDLG--TPIAALFKVGEFSQHPDFPDHLSHEAIDFLEKCFIPDPNKRATVTSLLSH 911          
The following BLAST results are available for this feature:
BLAST of MAP3K-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K12.176e-8550.18mitogen-activated protein kinase kinase kinase 1 [... [more]
MAP3K28.215e-4937.76mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K28.215e-4937.76mitogen-activated protein kinase kinase kinase 2 [... [more]
MAP3K35.267e-4738.35mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K35.486e-4738.35mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-17.628e-3030.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-17.642e-3030.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-19.253e-3030.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-19.258e-3030.57Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
nsy-11.678e-2931.20Mitogen-activated protein kinase kinase kinase nsy... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ask14.231e-3331.29gene:FBgn0014006 transcript:FBtr0083819[more]
Ask14.712e-3331.29gene:FBgn0014006 transcript:FBtr0300256[more]
Mekk13.101e-3128.26gene:FBgn0024329 transcript:FBtr0083684[more]
Mekk13.594e-3128.26gene:FBgn0024329 transcript:FBtr0331353[more]
GckIII1.122e-2929.43gene:FBgn0266465 transcript:FBtr0083399[more]
back to top
BLAST of MAP3K-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k11.990e-8650.70mitogen-activated protein kinase kinase kinase 1, ... [more]
map3k12.474e-8650.70mitogen-activated protein kinase kinase kinase 1, ... [more]
map3k12.674e-8650.70mitogen-activated protein kinase kinase kinase 1, ... [more]
map3k192.545e-5036.23mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k32.206e-4938.40mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a12.345e-8449.82solute carrier family 2 (facilitated glucose trans... [more]
slc2a13.436e-8449.82solute carrier family 2 (facilitated glucose trans... [more]
dennd1a8.241e-4836.90DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a1.197e-4736.90DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
samd86.241e-4737.26sterile alpha motif domain containing 8 [Source:Xe... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k11.196e-8550.18mitogen-activated protein kinase kinase kinase 1 [... [more]
Map3k22.280e-4937.76mitogen-activated protein kinase kinase kinase 2 [... [more]
Map3k31.271e-4738.72mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k198.418e-4333.58mitogen-activated protein kinase kinase kinase 19 ... [more]
Map3k196.862e-4133.58mitogen-activated protein kinase kinase kinase 19 ... [more]
back to top
BLAST of MAP3K-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53349|M3K1_MOUSE6.380e-8550.18Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|Q13233|M3K1_HUMAN1.045e-8450.18Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|Q62925|M3K1_RAT3.890e-8449.82Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|O22042|M3K3_ARATH7.677e-5234.24Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9FZ36|M3K2_ARATH1.764e-5135.62Mitogen-activated protein kinase kinase kinase 2 O... [more]
back to top
BLAST of MAP3K-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224AC190.000e+085.03Mitogen-activated protein kinase kinase kinase 1 O... [more]
I1ZI840.000e+0100.00MAP3K-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A564XX197.069e-9553.05Protein kinase domain-containing protein (Fragment... [more]
A0A5K3FM765.408e-9451.48Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0B6ZPN51.636e-9050.00Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k19.772e-8750.88mitogen-activated protein kinase kinase kinase 1 [... [more]
map3k223.357e-4838.72mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k223.749e-4838.72mitogen-activated protein kinase kinase kinase 3-l... [more]
map3k197.505e-4736.23mitogen-activated protein kinase kinase kinase 19 ... [more]
map3k36.663e-4637.22mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006402.11.012e-8546.79pep scaffold:Pmarinus_7.0:GL481397:10373:21355:-1 ... [more]
map3k24.971e-4837.45mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k191.806e-3932.60mitogen-activated protein kinase kinase kinase 19 ... [more]
slka2.605e-3233.85STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
ENSPMAT00000006100.15.390e-2929.32pep scaffold:Pmarinus_7.0:GL478927:1672:12797:-1 g... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK12.383e-4537.72MAPKKK acting in the protein kinase C signaling pa... [more]
STE115.722e-3829.87Signal transducing MEK kinase; involved in pheromo... [more]
SSK221.869e-3531.90MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
SSK23.198e-3531.53MAP kinase kinase kinase of HOG1 mitogen-activated... [more]
CDC52.708e-3030.18Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361503.788e-7846.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279761.054e-5845.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478211.333e-5235.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414107.174e-5238.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471448.573e-3432.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MAP3K-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k34.229e-4738.02mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k222.123e-4639.34mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k22.732e-4635.20mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k222.991e-4639.75mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k222.991e-4639.75mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of MAP3K-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054386.10.000e+099.84SMESG000054386.1[more]
SMESG000054386.10.000e+097.77SMESG000054386.1[more]
SMESG000004938.16.089e-3935.07SMESG000004938.1[more]
SMESG000004938.17.178e-3935.07SMESG000004938.1[more]
SMESG000004938.17.205e-3935.07SMESG000004938.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013686
GenBankAFJ24738.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013686 ID=SMED30013686|Name=MAP3K-1|organism=Schmidtea mediterranea sexual|type=transcript|length=4036bp
ATGAATATCAAGCAGTAATTTAATATCAAATGCTTGATGAAGTAAAACAC
TAATTAATTTATGAGATTAAATTTATCATTGTAATAATGTCATCTAATAT
ATCAAAGCAAAATTTTTCTCGAAGTATATCTGTTAAACCTCAAAAAAATG
CTTTTGAATATGGAAATGATGGTGAATTAACAACTATATATCTTAACTAT
CCCCGCGAATTATCAAGGTCTACCTCAACGTCAAAAGTAAGCAGCAAATC
TCAAACCAAGCCAATCAAATATCGAAAGTCATCCTCACGAACAAATACTC
CATTTAATGCTACTCGATCGTCATCGTATCATGCCTTATCTTCATCTAAT
CAAATTCTCGAGGACTCATCAAAGAATGATCACAACTATCGTCAAAGTAA
TATCCAAGAAAAATTAAAAATCATCTCCCAACAGAATTTCTGTATTTTAC
CTCAGTGTTCTCCTACTAGTTTCACAGTTTGTGCTGGAAGTAGTTCACGT
TATGTAGTTAATATTGGTCCTCAGACTTGTTGTTGTCTTACGAAATCATC
AACCAGTTCGAACCAACACTCATTTCCTTGTGTTCATCTATTGTTTATTA
TGTGCAAAGTCCTACAAGTTCATGAGAGAGACCCTTTGTTATTGGAGAAG
CATTTGAAAAATATCGAGGTTGATGAATTATTTAAAAGATTCAACAAAAG
AATAAAGGAAAAACTGAACAACCCATATCGGCCGAATGATAAAAACTGTA
AAAATATCAATCACGAAGAAGAGCATGAAGGAAATACCTCTAGATTTGGC
AGGGATGCGACCAGTTTTGGTCTTCAGTACAAATCAGTAATGAAAAACAT
GATGGCTCACGTTCTTGAAAAATGCAGAAACAAAAACAAACACGATTGCG
ATGAGCCACGCCCAAATGAGTCTCTAGATGAAATAACTTGTAGCATTTGT
CTACAAGAAATGAATATTGCTCAATTATTGATTTTCTGCCACAATTGCAG
CAACGAGTTTCACAAAAAGTGTATATTAATATGGCTTAAAGAATGTAAGA
AAAATAATGAAGAACTCACTTGTCCATTGTGCAGAAAATCATGGCCTTCT
GACGATATCAGTCGAGATATTGTTAGTCCATTAGAATACGGTCCGTCAGT
TGCTGATTCTAATTTCTTCGTACCTCGATCACATTCTACTGCAACCTCTT
TTCAACATATCAATCATCGAGAAATAACTAATATTGCTTCATCCACATCA
GATCTTACGTCTTCGAACTTCTCATTCAATATCAATGGTTCGAAACATGG
ATTCAGTGTTTCATCAAACCACAAACCAATTGGCTATTGCTTTTCAGCTC
TTGTTGCTGAAATGCTTTCATCGGATATGAGCGATAAAAGAGAAGCTGGT
TTACGGCAAGTAGCCGAACAAACCGTTCAGATCGTTGTGTCAGCCGGATC
CGCGTATTCTGTTGAAGATAATAAAGTCAATTGTATGTCAGATACTATTT
CTACTGACATTGTCAGTTCTATGGGAGGGTTTACGACTGGTTTGATGTTA
AAAGAAGCCTTTCGTGTTATTGCTCGTTTATTAGATGATACTAGCTACAC
ACTTTTTGTTGGGGCACTGAGAGCGTTTCGAGAAATTTTGGGATATCTCA
TTTGCAGAACCGAGAGTGAAGTTGAAAGAATGAGTAGGATGATATCTCCA
GTTCTTTGCCAACTTCTCAGAATTTGTGGTGACAATTCTCAGAAAAAGAA
AGCTCAAATGTGTTTGTCTGCTTTATTTGAATTAGCCAATGGCCAAGAAG
GAGGAATGGCTTTAGGGCGGGAAATAAAAAAATCAAGTTTGCCAGTTACT
GGATGGCAACGGCTGGCAAAATTCGCCATTGCAAATCATCACAGATTTAA
AGCCGTTCATTGTTACGGCCGCTTGTCGCTTTTGGAGAGATTATTGGACA
AATTCGAATTGACTTTAGACATTTTGAGAAAGCTGTTGGAATTTGTCACT
TCTCAATTGCTTTTAATGCATCGTTCAATGCATCTGTTGAATTCATTCGA
TTCCGGCAAAATGGACGTTCTTGAGACGACCGATGTTGACACTGGTTTGT
CTACATCTGACATCCGTTTATTATCTGGACAACGTCTGCAGAAATTAGCA
AAAATTCTTTTCATAAATACAGCAAAATTGATGATGTCAAAATTAAAATT
CAATGGCTGGTCATCACATGATGTTTATGTGGAATTGTGGAAAGATCTCA
ATAGATTGCCACAGCCGTGGAAAGAAAAGTTCATGATCAAATTGAAAATA
CCATGGGAAAAGTTCATCAATGTTGAATTGACGGAAGTTGATAAATCTTT
GCAGAACAGAGAAAAGAAAAGGCCTGAGGTTACTCCCGCTACAGTTACTC
CTAGTTGTGTAAGTAAAAGTTATCGCATTTCAAAGCGATATTCCCAATCA
AAACCGGTTGGTGCAGCATCTAAAATTGGGGGAATTCAATCGGCCAATAG
TGTTAATTCATTAAAGGTTCGAACCGGGAGTGTTTCACAGACAATCCGTA
GTGCCAGTAGTGGATCATGTCGAATTTCTCCTTTTATACGAATTACTCCT
GAGCCAGCCTATGATGCTGTTCCATTATCGGAAAGTGAAGATGACATATC
ACACGAAACGAGTTCTGTTTTCTTTTCTGAATTGGCTATCCACAATTCTA
TATATGGTCATCAATTTGGGTTGCAGGAATCAAGCTCGGATGAACGTAAC
GAAGAGGAGGAAATGAAGAGAACAAATGCCATATTTCGAAAAATATTGGC
GGAACAAACGAATTCTATGGATAGAAAAGATAGCTTGGACATTGAATCTC
AGCCTCCACCAGGTTTGGGAGTATTTTCTTCAGAATATCGGTCTGGTTAT
GAGTGGTGTCAAGGACCTTTATTAGGCACCGGTGCATTCAGCAAATGCTA
TCAAGGACGAGATGTTCGAACCGGTCTATTGATGGCTGTTAAACAGATCT
CTATCAGTCATAGTTCAATTGATAAAAACGAAGAAATTATTAAAGCAGTA
AAAACCGAAGTAAATCTGATGATTCAACTGAATCATCCCAATGTTCTTCC
ATTACTCGGTGCAATGTTTTCTCCAACTGACAACATTATCAGTATGTTTG
TTCGTTGGATGCCTGGCGGCAGTGTAGCCTCTTTACTCAATCAATACAGT
GCATTTTTGGAGCCAGTTACGCTTGCATACGCCCTTCAAACTGCTAGAGG
CCTGAGTTACATTCATTCTAATCGAATACTTCACAGGGACTTAAAAGGTG
CTAATCTTTTGTTGGACAGCAGCGGTATGCGTTTGCGTATATCTGATTTT
GGTGCGTCAGCCCGTCTTTCAAATGGTCGGGACAGTAATGCAAGCGATTT
TAAGGGCCAGCTTCTGGGGACTGTTGCCTTCATGGCTCCAGAAGTTCTGC
GTGGAGAGGAATATGGTCGATCTTGTGATGTTTGGAGTTTTGCTTGTTGT
ATTATCGAAATGCTTACTGGCAGTCAGCCTTGGCGTGACCGAAATCATAC
TAATCATTTGGCGTTGATGTATACGATTGCCTCTGCCGAAGAGCCTCCAA
AACTTCCTGAACAAATAAGTGCTGATCTCACAGAATTGCTCACCGATTGC
CTCAATAGGGATCCCAAAAAGCGACCTCTCTCATCGAAACTTGAGTCATA
TAGAGTATTTAAACATTTAACATCATGAATGTTTTTTAGATATCATCAAT
ATCGAGCTTTATCAAATAGCATTTCATTTTGTACTTAGATTTTGGGATTT
TCCTAATCTAGCTCACCATCGACAAATATGTAGTACGTGTTGACCATATA
TTATGATGTATAGAAACTGTTATTGATATATCAGGTCTAGACATTCGCTT
TAATATTTTTTCTCTTTCGATTTTAACCAGAAAGAGATTTTATGAGATTA
CTGATTTCGTATAGCCAACCTATATAATGATTTCATGAGATTAAGCATGT
GTGTGTATTTGCTGTGTTATCGAATGGTTGTGTGTG
back to top

protein sequence of SMED30013686-orf-1

>SMED30013686-orf-1 ID=SMED30013686-orf-1|Name=SMED30013686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1214bp
MSSNISKQNFSRSISVKPQKNAFEYGNDGELTTIYLNYPRELSRSTSTSK
VSSKSQTKPIKYRKSSSRTNTPFNATRSSSYHALSSSNQILEDSSKNDHN
YRQSNIQEKLKIISQQNFCILPQCSPTSFTVCAGSSSRYVVNIGPQTCCC
LTKSSTSSNQHSFPCVHLLFIMCKVLQVHERDPLLLEKHLKNIEVDELFK
RFNKRIKEKLNNPYRPNDKNCKNINHEEEHEGNTSRFGRDATSFGLQYKS
VMKNMMAHVLEKCRNKNKHDCDEPRPNESLDEITCSICLQEMNIAQLLIF
CHNCSNEFHKKCILIWLKECKKNNEELTCPLCRKSWPSDDISRDIVSPLE
YGPSVADSNFFVPRSHSTATSFQHINHREITNIASSTSDLTSSNFSFNIN
GSKHGFSVSSNHKPIGYCFSALVAEMLSSDMSDKREAGLRQVAEQTVQIV
VSAGSAYSVEDNKVNCMSDTISTDIVSSMGGFTTGLMLKEAFRVIARLLD
DTSYTLFVGALRAFREILGYLICRTESEVERMSRMISPVLCQLLRICGDN
SQKKKAQMCLSALFELANGQEGGMALGREIKKSSLPVTGWQRLAKFAIAN
HHRFKAVHCYGRLSLLERLLDKFELTLDILRKLLEFVTSQLLLMHRSMHL
LNSFDSGKMDVLETTDVDTGLSTSDIRLLSGQRLQKLAKILFINTAKLMM
SKLKFNGWSSHDVYVELWKDLNRLPQPWKEKFMIKLKIPWEKFINVELTE
VDKSLQNREKKRPEVTPATVTPSCVSKSYRISKRYSQSKPVGAASKIGGI
QSANSVNSLKVRTGSVSQTIRSASSGSCRISPFIRITPEPAYDAVPLSES
EDDISHETSSVFFSELAIHNSIYGHQFGLQESSSDERNEEEEMKRTNAIF
RKILAEQTNSMDRKDSLDIESQPPPGLGVFSSEYRSGYEWCQGPLLGTGA
FSKCYQGRDVRTGLLMAVKQISISHSSIDKNEEIIKAVKTEVNLMIQLNH
PNVLPLLGAMFSPTDNIISMFVRWMPGGSVASLLNQYSAFLEPVTLAYAL
QTARGLSYIHSNRILHRDLKGANLLLDSSGMRLRISDFGASARLSNGRDS
NASDFKGQLLGTVAFMAPEVLRGEEYGRSCDVWSFACCIIEMLTGSQPWR
DRNHTNHLALMYTIASAEEPPKLPEQISADLTELLTDCLNRDPKKRPLSS
KLESYRVFKHLTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR008271Ser/Thr_kinase_AS
IPR019786Zinc_finger_PHD-type_CS
IPR017441Protein_kinase_ATP_BS
IPR007527Znf_SWIM
IPR019787Znf_PHD-finger
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 613..633
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 935..1018
e-value: 2.2E-14
score: 55.3
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 1019..1212
e-value: 4.9E-51
score: 175.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 45..81
NoneNo IPR availablePANTHERPTHR24361MITOGEN-ACTIVATED KINASE KINASE KINASEcoord: 937..1197
NoneNo IPR availablePANTHERPTHR24361:SF414MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 1coord: 937..1197
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 275..339
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 940..1208
e-value: 1.6E-69
score: 246.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 945..1202
e-value: 2.2E-57
score: 194.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 940..1208
score: 42.421
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 275..350
e-value: 3.6E-9
score: 38.2
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 1064..1076
IPR019786Zinc finger, PHD-type, conserved sitePROSITEPS01359ZF_PHD_1coord: 285..332
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 946..969
IPR007527Zinc finger, SWIM-typePROSITEPS50966ZF_SWIMcoord: 139..176
score: 8.073
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 285..333
score: 11.058
IPR019787Zinc finger, PHD-fingerPROSITEPS50016ZF_PHD_2coord: 282..335
score: 8.894
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 940..1204