nesprin-1-like

Overview
Namenesprin-1-like
Smed IDSMED30013676
Length (bp)9012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of nesprin-1-like (SMED30013676) t-SNE clustered cells

Violin plots show distribution of expression levels for nesprin-1-like (SMED30013676) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013676

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013676SMESG000016745.1 Contig45322uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013676SMESG000016745.1 Contig45322newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013676SMESG000050918.1 SMESG000016745.1 SMESG000076404.1 Contig21347uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013676SMESG000050918.1 SMESG000016745.1 SMESG000076404.1 Contig21347newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v6_5365_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v6_5365_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30013676SMESG000016747.1 SMESG000016745.1 Contig49432uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013676SMESG000016747.1 SMESG000016745.1 Contig49432newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 4 cellSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013676SMESG000016747.1 SMESG000016745.1 dd_Smed_v4_5365_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 135.191 bits (339), Expect = 1.307e-30
Identity = 165/753 (21.91%), Postives = 339/753 (45.02%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWC--------DNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +  +  +    E    W           L    +  Q      DE+   Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +       E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct:   55 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEV---QFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEK----NKELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 781          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 135.191 bits (339), Expect = 1.312e-30
Identity = 165/753 (21.91%), Postives = 339/753 (45.02%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWC--------DNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +  +  +    E    W           L    +  Q      DE+   Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +       E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct:  331 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEV---QFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEK----NKELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 1057          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 133.65 bits (335), Expect = 5.854e-30
Identity = 168/753 (22.31%), Postives = 344/753 (45.68%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ ++    L    +  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct: 7338 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 8064          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 133.65 bits (335), Expect = 6.785e-30
Identity = 168/753 (22.31%), Postives = 344/753 (45.68%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ ++    L    +  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct: 7004 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 7730          
BLAST of nesprin-1-like vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 133.265 bits (334), Expect = 8.325e-30
Identity = 168/753 (22.31%), Postives = 344/753 (45.68%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ ++    L    +  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct: 7409 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 8135          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303388)

HSP 1 Score: 55.8398 bits (133), Expect = 8.430e-7
Identity = 49/206 (23.79%), Postives = 106/206 (51.46%), Query Frame = 2
Query: 6206 DIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMD--IKLT-ETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMT 6811
            D W R + LA  K  ++ E+  ++   EE+ + ++ W+ E++  L+ P+  + +  + I  KL E  +IQ  +I+ HS +V  VL L  +L+ + D+   + +   ++ + + L++RW N+  +   + ++   ++ +W ++   IKLT E  +++    G+  S +A  E       D+    K  + E ++E+R  LE  ++ +
Sbjct: 11126 DRWQRLKYLAKQKATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQ-RSIEHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKAR---ILTIWNLLQQLIKLTAEHKNWL----GKQESQIAGFER------DQKSHSKHKLEERQMELRAKLEELESQS 11317          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303385)

HSP 1 Score: 55.8398 bits (133), Expect = 8.577e-7
Identity = 49/206 (23.79%), Postives = 106/206 (51.46%), Query Frame = 2
Query: 6206 DIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMD--IKLT-ETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMT 6811
            D W R + LA  K  ++ E+  ++   EE+ + ++ W+ E++  L+ P+  + +  + I  KL E  +IQ  +I+ HS +V  VL L  +L+ + D+   + +   ++ + + L++RW N+  +   + ++   ++ +W ++   IKLT E  +++    G+  S +A  E       D+    K  + E ++E+R  LE  ++ +
Sbjct: 11485 DRWQRLKYLAKQKATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQ-RSIEHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKAR---ILTIWNLLQQLIKLTAEHKNWL----GKQESQIAGFER------DQKSHSKHKLEERQMELRAKLEELESQS 11676          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332404)

HSP 1 Score: 55.8398 bits (133), Expect = 8.789e-7
Identity = 49/206 (23.79%), Postives = 106/206 (51.46%), Query Frame = 2
Query: 6206 DIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMD--IKLT-ETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMT 6811
            D W R + LA  K  ++ E+  ++   EE+ + ++ W+ E++  L+ P+  + +  + I  KL E  +IQ  +I+ HS +V  VL L  +L+ + D+   + +   ++ + + L++RW N+  +   + ++   ++ +W ++   IKLT E  +++    G+  S +A  E       D+    K  + E ++E+R  LE  ++ +
Sbjct: 11057 DRWQRLKYLAKQKATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQ-RSIEHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKAR---ILTIWNLLQQLIKLTAEHKNWL----GKQESQIAGFER------DQKSHSKHKLEERQMELRAKLEELESQS 11248          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332405)

HSP 1 Score: 55.8398 bits (133), Expect = 8.869e-7
Identity = 49/206 (23.79%), Postives = 106/206 (51.46%), Query Frame = 2
Query: 6206 DIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMD--IKLT-ETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMT 6811
            D W R + LA  K  ++ E+  ++   EE+ + ++ W+ E++  L+ P+  + +  + I  KL E  +IQ  +I+ HS +V  VL L  +L+ + D+   + +   ++ + + L++RW N+  +   + ++   ++ +W ++   IKLT E  +++    G+  S +A  E       D+    K  + E ++E+R  LE  ++ +
Sbjct: 11448 DRWQRLKYLAKQKATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQ-RSIEHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKAR---ILTIWNLLQQLIKLTAEHKNWL----GKQESQIAGFER------DQKSHSKHKLEERQMELRAKLEELESQS 11639          
BLAST of nesprin-1-like vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303389)

HSP 1 Score: 55.8398 bits (133), Expect = 8.939e-7
Identity = 49/206 (23.79%), Postives = 106/206 (51.46%), Query Frame = 2
Query: 6206 DIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMD--IKLT-ETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMT 6811
            D W R + LA  K  ++ E+  ++   EE+ + ++ W+ E++  L+ P+  + +  + I  KL E  +IQ  +I+ HS +V  VL L  +L+ + D+   + +   ++ + + L++RW N+  +   + ++   ++ +W ++   IKLT E  +++    G+  S +A  E       D+    K  + E ++E+R  LE  ++ +
Sbjct: 11126 DRWQRLKYLAKQKATKIGELKMTLLRLEERIALIRAWLFEVESQLDKPLNFESYTPNVIEAKLKEHEQIQ-RSIEHHSSNVGEVLNLVEMLLNDADSWRTQVNTSGLAASAQNLEQRWKNVCSQSAERKAR---ILTIWNLLQQLIKLTAEHKNWL----GKQESQIAGFER------DQKSHSKHKLEERQMELRAKLEELESQS 11317          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 134.806 bits (338), Expect = 1.652e-30
Identity = 202/982 (20.57%), Postives = 430/982 (43.79%), Query Frame = 2
Query: 4346 SNHLLDLYEHWELFNGNMKRIVHNFE-QMESVIIDCFN-PMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGN--LNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDE-----MNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLE---SEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLW-RMMD--------IKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV 7156
            S  LL L++H++  +      +H  E Q+E ++    +  + Q ++    +   S+ES+++    F+ +L  Q +                 L++ GH L R +   +     + +   ++       +  EK+  E D   S   P I+      D    +LL+ +     D+  +  + ++  ++    KR + +        N+   +   R +E  SKL+        F+  C+  M FL   + +L  +   NY  +++ Q   E     +  ++ +   ++  G+  LN+ +  +   F   L  L  QW+ +       +  +D  V     Y E +GKL     W   ++ +  D Q       +     ++H+Q +  I  +++ ++I   EA    G  L     D+  ++ +   L ++ E+W  ++ ++     +L     +W   +K I      +++     +  +P  +E L+    + ++  A+++      + L    ++L   LS DD+T+L +R+ L+ +Q  E   Q+ +RR+++  R++ W  F +       E+ E LT +ESK V Q     ++EM++KL     E I  +++ K + E +   G  + + S E ++ +I Y+L K ++ W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL +   +Q  +I+ HS  V SVL LC +L+ + DAC   ++ E I +  + L +RW NI      +  K+ E   LW + +D        +K++E    +    G L  +VA  E      L K +A +  + E+  ++  + + Y+ +  +++ DS     C ++ ++     +++ +Q  V+ +  +++     + +  +  + I  W+ ++D ++  +E     +++ +           + QLK  K      +I LNN++ +SV
Sbjct: 7135 SKSLLQLWQHYKALHAQCSADIHKLEEQVEHLLKSATHRDITQQEVKGLMATEGSVESVLQQLDEFSEQLRQQVDPSAMTTFHTEHLSLTQRLAAVGHALQRQQSLIEVSTRDYERFSKELNSLSRWAEEAEKVLKEQDPVGS---PEISFVQDHMDKLKTQLLK-LSSLSPDLERLNELGYQLPLNDNEIKRLQNL--------NRSWSSNSARTIERFSKLQALVLQRQTFLEKCDAWMSFLTQTEEKLAAEISGNYQSLLDQQREHELFQAEMFSRQQVLNSIVNDGHELLNQGQVKDRDDFGLKLALLSNQWQGVVRRAQQRRGIIDSLVRQWQRYTELIGKL---RHWLHEVSLEPEDQQQGTTVALQQIRGMLDHIQLKERILQRQQGSYILTVEA----GRQLLLWA-DARAEASLHTELTDVQERWRAINIRLDERKKELLSLLRDWDQCEKGITASHEKLRDFKQKLSVPLPDHHEELHTEQIRCKELEASIEGWADDVAGLCILRESLSSGLSADDLTVLHERLILLQRQWEETCHQLCLRRQQVSERLNEWAVFNEK----NKELCEWLTHMESK-VSQNGDVSIEEMIEKLTKDCQEEISVVEENKCQLEQM---GERLAQASHESKAAEIQYKLCKVNERWQHLLDLIAARVKKLRETLVAVQQLDKNMSSLRSWLAHIETELSRPIVYETCDSHEIQRKLNQQQDLQ-RDIEKHSTGVASVLNLCEVLLHDCDACATETECESIQQATRGLDRRWRNICAIAMERRLKIEETWRLWQKFLDDYSRFEEWLKVSERTAALPNSSGVLY-IVAKEE------LKKFEAFQRQVQEFLTQLELINKQYRRLARENRTDS----SCHLRQMVHDGNRRWDILQRRVAAILRRLKHFIGQREEFETARDVILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAFK-----QEISLNNTKVESV 8060          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 134.035 bits (336), Expect = 3.069e-30
Identity = 223/1065 (20.94%), Postives = 463/1065 (43.47%), Query Frame = 2
Query: 4127 LIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPY---SNHLLDLYEHWELFNGNMKRIVHNFE-QMESVIIDCFN-PMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGN--LNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDE-----MNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN------LQKS-EKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLE---SEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLW-RMMD--------IKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV 7156
            L+  +   V+  +E L+++KK   G++              + VSFN+S      + H +  KT L ++IS     S  LL L++H++  +      ++  E Q+E ++    +  + Q ++    +   S+ES+++    F+ +L  Q +                 L++ GH L R +   +     + K   ++       +  EK+  E D   S   P I+      D    +LL+ +     D+  +  + ++  ++    KR + +        N+   +   R +E  SKL+        F+  C+  M FL   + +L  +   NY  +++ Q   E     +  ++ +   ++  G+  LN+ +  +   F   L  L  QW+ +       +  +D  V     Y E +GKL     W   ++ +  D Q       +     ++H+Q +  +  +++ ++I   EA    G  L     D+  ++ +   L ++ E+W  ++ ++     +L     +W   +K I      +++     +  +P  +E L+        L+ S E +  ++    I+R  L S        LS DD+T+L +R+ L+ +Q  E   Q+ +RR+++  R++ W  F +       E+ E LT +ESK V Q     ++EM++KL     E I  +++ K + E +   G  + + S E ++ +I Y+L K ++ W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL +   +Q  +I+ HS  V SVL LC +L+ + DAC   ++ E I +  + L +RW NI      +  K+ E   LW + +D        +K++E    +    G L  +VA  E      L K +A +  + E+  ++  + + Y+ +  +++ DS     C ++ ++     +++ +Q  V+ +  +++     + +  +  + I  W+ ++D ++  +E     +++ +           + QLK  K      +I LNN++ +SV
Sbjct: 7036 LLTGSPEAVQVQVENLQQFKK--IGLH--------------NTVSFNIS------FFHSL--KTCLRSQISDQLRRSKSLLQLWQHYKALHAQCSADIYKLEEQVEHLLKSATHRDITQQEVKGLMATEGSVESVLQQLDEFSEQLRQQVDPSAMTTFHTEHLSLTQRLAAVGHALQRQQSLIEVSTRDYEKFSKELNSLSRWAEEAEKVLKEQDPVGS---PEISFVQDHMDKLKTQLLK-LSSLSPDLERLNELGYQLPLNDNEIKRLQNL--------NRSWSSNSARTIERFSKLQALVLQRQTFLEKCDAWMSFLTQTEEKLASEISGNYQSLLDQQREHELFQAEMFSRQQVLNSIVNDGHELLNQGQVKDRDDFGLKLALLSNQWQGVVRRAQQRRGIIDSLVRQWQRYTELIGKL---RHWLHEVSLEPEDQQQGTTVALQQIRGMLDHIQLKERVLQRQQGSYILTVEA----GRQLLLWA-DARAEALLHTELTDVQERWRAINIRLDERKKELLSLLRDWDQCEKGITASHEKLRDFKQKLSVPLPDHHEELHTEQIRCKELEGSIEGWADDVAGLCILRESLSSG-------LSADDLTVLHERLILLQRQWEETCHQLCLRRQQVSERLNEWAVFNEK----NKELCEWLTHMESK-VSQNGEVSIEEMIEKLTKDCQEEISVVEENKCQLEQM---GERLAQASHESKAAEIQYKLCKVNERWQHLLDLIAARVKKLRETLVAVQQLDKNMSSLRSWLAHIETELSRPIVYETCDSHEIQRKLNQQQDLQ-RDIEKHSTGVASVLNLCEVLLHDCDACATETECESIQQATRGLDRRWRNICAIAMERRLKIEETWRLWQKFLDDYSRFEEWLKVSERTAALPNSSGVLY-IVAKEE------LKKFEAFQRQVQEFLTQLELINKQYRRLARENRTDS----SCHLRQMVHDGNRRWDILQRRVAAILRRLKHFIGQREEFETARDVILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAFK-----QEISLNNTKVESV 8013          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 104.76 bits (260), Expect = 2.013e-21
Identity = 132/688 (19.19%), Postives = 302/688 (43.90%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGN----LNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVY----QVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHF-----INQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   M+FL   + +L  +   N+  ++E Q   E     +  ++ +   +I  G       + ++   F+  L  L  QW+ +       +  +D  +  +  +   +E    W   +  +    Q+        +   ++ +Q R  +  +++ ++I   EA    G  L  +  DS  ++ +Q+ L  + E+W   + ++     +L     +W   +K I      ++      +  +P  +E L     + +   +     +   + L    ++L  Y+S DD+ +L +RI L+ +Q  E+  Q+ +RR+++  +M+ W  F +  +    E+ E LT +ESK  +     ++EM++KL  +    +   +    +L+  G  +   S E ++ DI ++L K ++ W     L   ++K+L E   ++   ++  ++L+ W+  ++  L+ PIV       +I  KL    ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW +I      +  ++ E    WR+    L +  HF     +++    L +    + T   + L K +  +  + E   ++  + + YQ +  +++ D+   +         +++ +Q  VS +  +++   + + +  +  + I  W+ ++D ++  +E
Sbjct: 7373 FLEKCETWMEFLVQTEEKLAVEISGNFQSLMEQQRAHELFQAEMFSRQQILHSIISDGQHMLEQGQVDDRDEFKLKLALLSNQWQGVVRRAQQRRGIIDSLLRQWQRYREMVEKLRKWLLEVNHQTQSLQAGTPVPLQQARAMLDAVQLREKVLLRQQGSYILTVEA----GRQLLLSA-DSRAEAVLQEELLNIQERWRNANIRLDEQKKELAVLLRDWERCEKGIGGSLEKLRAFKRQLSQPLPDRHEELQAEQMRCKDLDSMFDGWKEDLTHLTVLRESLSSYISLDDLRVLQERIELLHRQWEEICHQLSLRRQQVSEKMNEWAIFNNKYK----ELCEWLTQMESKVSHNGDVSIEEMIEKLRKDYQEEVSAAQENKLELQHLGERLARASHETKASDIEHKLSKVNERWQHLLDLIGARVKKLRETLVAVQQLDKNMNSLRSWLAHIETELSRPIVYDTCDYQEIQRKLDLQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRSLDRRWRSICAMSMERRIRIEE---TWRLWQKFLDDYSHFEEWLMLSEKTAALPNSSGVLYTIAKEELKKFETFQRHVHESLTQLELINKQYQRLARENRTDAACSLREMAHNANQRWDNLQRRVSSVLRRLKHFISQREEFETARDCILVWLTEMDLQLTNIE 8047          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 104.76 bits (260), Expect = 2.013e-21
Identity = 132/688 (19.19%), Postives = 302/688 (43.90%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGN----LNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVY----QVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHF-----INQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   M+FL   + +L  +   N+  ++E Q   E     +  ++ +   +I  G       + ++   F+  L  L  QW+ +       +  +D  +  +  +   +E    W   +  +    Q+        +   ++ +Q R  +  +++ ++I   EA    G  L  +  DS  ++ +Q+ L  + E+W   + ++     +L     +W   +K I      ++      +  +P  +E L     + +   +     +   + L    ++L  Y+S DD+ +L +RI L+ +Q  E+  Q+ +RR+++  +M+ W  F +  +    E+ E LT +ESK  +     ++EM++KL  +    +   +    +L+  G  +   S E ++ DI ++L K ++ W     L   ++K+L E   ++   ++  ++L+ W+  ++  L+ PIV       +I  KL    ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW +I      +  ++ E    WR+    L +  HF     +++    L +    + T   + L K +  +  + E   ++  + + YQ +  +++ D+   +         +++ +Q  VS +  +++   + + +  +  + I  W+ ++D ++  +E
Sbjct: 7373 FLEKCETWMEFLVQTEEKLAVEISGNFQSLMEQQRAHELFQAEMFSRQQILHSIISDGQHMLEQGQVDDRDEFKLKLALLSNQWQGVVRRAQQRRGIIDSLLRQWQRYREMVEKLRKWLLEVNHQTQSLQAGTPVPLQQARAMLDAVQLREKVLLRQQGSYILTVEA----GRQLLLSA-DSRAEAVLQEELLNIQERWRNANIRLDEQKKELAVLLRDWERCEKGIGGSLEKLRAFKRQLSQPLPDRHEELQAEQMRCKDLDSMFDGWKEDLTHLTVLRESLSSYISLDDLRVLQERIELLHRQWEEICHQLSLRRQQVSEKMNEWAIFNNKYK----ELCEWLTQMESKVSHNGDVSIEEMIEKLRKDYQEEVSAAQENKLELQHLGERLARASHETKASDIEHKLSKVNERWQHLLDLIGARVKKLRETLVAVQQLDKNMNSLRSWLAHIETELSRPIVYDTCDYQEIQRKLDLQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRSLDRRWRSICAMSMERRIRIEE---TWRLWQKFLDDYSHFEEWLMLSEKTAALPNSSGVLYTIAKEELKKFETFQRHVHESLTQLELINKQYQRLARENRTDAACSLREMAHNANQRWDNLQRRVSSVLRRLKHFISQREEFETARDCILVWLTEMDLQLTNIE 8047          
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Match: syne2b (spectrin repeat containing, nuclear envelope 2b [Source:ZFIN;Acc:ZDB-GENE-071218-5])

HSP 1 Score: 100.138 bits (248), Expect = 3.128e-20
Identity = 113/534 (21.16%), Postives = 244/534 (45.69%), Query Frame = 2
Query: 5471 SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKW----CKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLAN-----LKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI----DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            S Y   M  G  L+ +V D  T++++Q  L  L E W    C V  +    SD + K    W   +  + +    ++E+ +     IP  +       + E+ L       L+   +  SEL +   +L +Y+  DD+ +L +++  +  Q  EL +++ +R++EI  R++ W  F +  R    E+ E LT +E+K  +     ++EM++KL+ + +  I  +      LK  G  +   S + +  +I  +++  +D W         ++++L E   ++   ++  SNL+ W+  ++  L  P++   + I    +I  KL E   +Q  +I+ H+  V SVL LC++L+ + DAC +  + + I +T   L +RW NI      +  ++ E   LW          + ++N  +    +      + T   + L K +A +  + E   ++  + + Y+ +  +++ D   ++   +     +++T+Q+ V+ +  +++   + +       E I  W+ ++D ++  +E
Sbjct:    2 SAYLCVMEVGRQLF-SVSDLQTQTQMQTDLAALQEDWEQCQCMVGKRKTLTSDIIKK----WETCETRLADQTQHLEELQSRLKQSIPDQQ----EEMEEERLLVKEVQDCLEDWAVSLSELSTMKTDLSQYILTDDVLLLQEQVEHLHCQWEELCLKVSMRKQEIADRLNAWIIFNEKNR----ELCEWLTQMENKVAHSAELSIEEMVEKLKKDCMEEINLFSENKTHLKQLGEQLITASNKAKETEINDKIKDINDRWQHLFDHIEARVRKLKETLVTVQQLDKNMSNLRTWLSRVESELAKPVI---YSICHNEEIQRKLAEHQDLQ-RDIEQHTEGVASVLTLCDVLLHDADACGSDGENDSIQQTTLSLDRRWRNICAMSMERRMRIEETWRLWCKFLDDYARFEEWLNTAERTAANPATKDVLYTCAKEELKKFEAFQRQVHERLTQLELVNKQYRRLARENRTDGASKLKLMVHEGNQRWDTLQKRVAAVLRRLKHFTSQREDFEGTREGILVWLTEMDLQLTNVE 518          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 130.954 bits (328), Expect = 3.216e-29
Identity = 171/828 (20.65%), Postives = 363/828 (43.84%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLV--------------RYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV--HFSDIVAKMKESENAI 7204
            D++ +  + +R  ++    KR +++  H TV  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       K  +D  +  +  +    E    W   ++ + V     I      + + ++ +Q +  +  +++ ++I   EA    G+ L     DS  ++ +Q  L ++ E+W   S +++    +L     +W   +K        ++      +  +P +                L + Q+   EL + V+  V              ++++ DDI IL +RI L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+  + D    E    I++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C++K ++     +++ +Q  V+ +  +++     + +  +  ++I  W+ ++D ++  +E     +++ +           + QLK       + +I LNNS+ D +  H   ++ K +  + A+
Sbjct: 5914 DLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQRLLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLVEMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEA----GKQLLLCA-DSVAEAALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPLPDHHD-------------ELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQWEELCHQVSLRRQQVSERLNEWAIFNEKNK----ELCEWLTQMESK-VSQNGDISIEEMIEKLKKDYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKLKETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSA----CKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAF-----QQEISLNNSKIDQIIAHGEQLIEKSEPLDAAV 6689          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 130.568 bits (327), Expect = 4.964e-29
Identity = 171/828 (20.65%), Postives = 363/828 (43.84%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLV--------------RYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV--HFSDIVAKMKESENAI 7204
            D++ +  + +R  ++    KR +++  H TV  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       K  +D  +  +  +    E    W   ++ + V     I      + + ++ +Q +  +  +++ ++I   EA    G+ L     DS  ++ +Q  L ++ E+W   S +++    +L     +W   +K        ++      +  +P +                L + Q+   EL + V+  V              ++++ DDI IL +RI L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+  + D    E    I++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C++K ++     +++ +Q  V+ +  +++     + +  +  ++I  W+ ++D ++  +E     +++ +           + QLK       + +I LNNS+ D +  H   ++ K +  + A+
Sbjct: 7285 DLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQRLLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLVEMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEA----GKQLL-LCADSVAEAALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPLPDHHD-------------ELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQWEELCHQVSLRRQQVSERLNEWAIFNEKNK----ELCEWLTQMESK-VSQNGDISIEEMIEKLKKDYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKLKETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSA----CKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAF-----QQEISLNNSKIDQIIAHGEQLIEKSEPLDAAV 8060          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 130.568 bits (327), Expect = 5.328e-29
Identity = 171/828 (20.65%), Postives = 363/828 (43.84%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLV--------------RYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV--HFSDIVAKMKESENAI 7204
            D++ +  + +R  ++    KR +++  H TV  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       K  +D  +  +  +    E    W   ++ + V     I      + + ++ +Q +  +  +++ ++I   EA    G+ L     DS  ++ +Q  L ++ E+W   S +++    +L     +W   +K        ++      +  +P +                L + Q+   EL + V+  V              ++++ DDI IL +RI L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+  + D    E    I++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C++K ++     +++ +Q  V+ +  +++     + +  +  ++I  W+ ++D ++  +E     +++ +           + QLK       + +I LNNS+ D +  H   ++ K +  + A+
Sbjct: 6791 DLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQRLLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLVEMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEA----GKQLLLCA-DSVAEAALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPLPDHHD-------------ELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQWEELCHQVSLRRQQVSERLNEWAIFNEKNK----ELCEWLTQMESK-VSQNGDISIEEMIEKLKKDYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKLKETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSA----CKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAF-----QQEISLNNSKIDQIIAHGEQLIEKSEPLDAAV 7566          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 130.183 bits (326), Expect = 5.439e-29
Identity = 171/828 (20.65%), Postives = 363/828 (43.84%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLV--------------RYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV--HFSDIVAKMKESENAI 7204
            D++ +  + +R  ++    KR +++  H TV  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       K  +D  +  +  +    E    W   ++ + V     I      + + ++ +Q +  +  +++ ++I   EA    G+ L     DS  ++ +Q  L ++ E+W   S +++    +L     +W   +K        ++      +  +P +                L + Q+   EL + V+  V              ++++ DDI IL +RI L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+  + D    E    I++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C++K ++     +++ +Q  V+ +  +++     + +  +  ++I  W+ ++D ++  +E     +++ +           + QLK       + +I LNNS+ D +  H   ++ K +  + A+
Sbjct: 7218 DLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQRLLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLVEMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEA----GKQLLLCA-DSVAEAALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPLPDHHD-------------ELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQWEELCHQVSLRRQQVSERLNEWAIFNEKNK----ELCEWLTQMESK-VSQNGDISIEEMIEKLKKDYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKLKETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSA----CKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAF-----QQEISLNNSKIDQIIAHGEQLIEKSEPLDAAV 7993          
BLAST of nesprin-1-like vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 130.183 bits (326), Expect = 5.842e-29
Identity = 171/828 (20.65%), Postives = 363/828 (43.84%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEI-----WSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLV--------------RYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSV--HFSDIVAKMKESENAI 7204
            D++ +  + +R  ++    KR +++  H TV  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       K  +D  +  +  +    E    W   ++ + V     I      + + ++ +Q +  +  +++ ++I   EA    G+ L     DS  ++ +Q  L ++ E+W   S +++    +L     +W   +K        ++      +  +P +                L + Q+   EL + V+  V              ++++ DDI IL +RI L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +     +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+  + D    E    I++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C++K ++     +++ +Q  V+ +  +++     + +  +  ++I  W+ ++D ++  +E     +++ +           + QLK       + +I LNNS+ D +  H   ++ K +  + A+
Sbjct: 6788 DLDRLNELGYRLPLNDKEIKRMQSLNRHWTVTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLIETEQKLAVEISGNYQSLLEQQRAHELFQAEMFSRQQILHSIIVDGQRLLEQGQVDDSDEFNLKLTLLSNQWQGVIRRAQQRKGIIDSQIRQWQRYREMAEKLRKWLVEMSYQPVSGLGGIPIPLQQARNLLDEIQLKDKVLHRQQGSYILTVEA----GKQLLLCA-DSVAEAALQTELMDIQERWKATSVRLEEQKKQLAFLLKDWEKCEKGTAESLEKLRNFRKNLSHPLPDHHD-------------ELHAEQMRCKELENAVEGWVEDLAFLTTLKEIFTQHITADDIAILNERIELLQRQWEELCHQVSLRRQQVSERLNEWAIFNEKNK----ELCEWLTQMESK-VSQNGDISIEEMIEKLKKDYQEEIAVARENKMQLQQMGERLAKASHESKASEIEYKLSKVNDRWQHLLDLIGARVKKLKETLVAVQQLDKNMSSLRSWLGHIESELSKPIVYETSDSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDTECDSIQQATRSLDRRWRNICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLTISERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSA----CKLKQMVHEGNQRWDNLQRRVTAILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAK-----------IKQLKAF-----QQEISLNNSKIDQIIAHGEQLIEKSEPLDAAV 7563          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 141.739 bits (356), Expect = 1.421e-32
Identity = 270/1339 (20.16%), Postives = 573/1339 (42.79%), Query Frame = 2
Query: 3260 LKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKI----RDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHL-KFLNLKLRTIEPLVDLYCQRDTGFQSNFISEGMTK-RSKDIH----DLSDESKELHA-------IINEINENSLKVNGWISSQSVECQNIVKNLNS---KMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKS-----------------------LIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPY---SNHLLDLYEHWELFNGNMKRIVHNFEQMESVII------DCFNPMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRR---DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG-NLNEN---ENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHF-----INQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            LK SV + G+ LL+ K+ +   L  +L  ++++W  +   I      L ++ M  + S  +      ++ S +  ++  +  L+ E +IRN    +   E+L K+   K       +DL C++ T   ++F+++ + +  S+D+     D +D +++L A       +   + E    + G + S S E +N V++L +       KL    L   + +  +  +  + +++LIK+        + +V+ +    +++  N   E     +++ +++ L Q W+ L+++   V +L+I +   +G+  +                       L+  +   V+  ++ L+    EL    G   +       +  E    +++T+S+      +    L+ +I+     S  LL L++ ++ ++      +   E+  SV++      D  +      I D    L  +E+ +KDS     +L    E L + +D   +   Q        RL  +++     +        D   F    + +E    E +  L    P+ +   S+    + EL  ++++      D++ +  + +R  ++    KR + +  H ++  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I  G NL E    ++   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ H+    L +  V  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L ++ EKW   S  ++    KL     +W   ++ I N    ++      +  +P  +E L+    + ++    +       +EL    D L  YLS +DI++L +R+ L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L +  D W     L   ++K+L E   ++   ++   +L+ W+  M+  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E    WR+    L +   F     +++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS   +   + G   +++ +Q+ V+ +  +++   + + +  +  ++I  W+ ++D ++  +E
Sbjct: 6837 LKSSVTSTGNQLLRLKKVDTAALRAELSRMDSQWTDLLTGIPVVQEKLHQLQMDKLPSRHAIS----EVMSWISLMESVI--LKDEEDIRNAIGYKAIHEYLQKYKGFK-------IDLNCKQLT---ADFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQLLQGRVGEKIQMLEGLLESWS-EYENSVQSLKAWFANQERKLKEQHLLGDRNSVENALKDCQELEDLIKA-------KEKEVEKIEQNGLALIQNKREEVSG--SVMSTLQELRQTWISLDRT---VEQLKIQLTSALGQWSNHKAACDEINGHLMEARYSLSRFRLLTGSSEAVQVQVDNLQNLHDELEKQEGGLQKFGSITNQLLKECHPPVAETLSSTLQEVNMRWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCASAIQRQEEQTSVLLKAATNKDIADDEVTKWIQDCNDLLKGLET-VKDSLFILRELG---EQLGQQVDVSAAAAIQCEQLCFSQRLGALEQALCKQQAVLQAGVVDYETFAKSLEALEVWMVEAEGILQGQDPTHSSDLSTIQERMEELKGQMLKFSSLAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEHKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIVDGQNLLEQGQVDDREEFSLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLAEVSHLPLSGLGNIPVPLQQVRMLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELTDIQEKWKAASMHLEEQKKKLAFLLKDWEKCERGIANSLEKLRMFKKRLSQPLPDHHEELHAEQMRCKELENAVGRWTDDLTELMLVRDALAVYLSAEDISMLKERVELLQRQWEELCHQVSLRRQQVSERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAVAQENKIQLQEMGERLAKASHESKASEIQYKLSRVKDRWQHLLDLMAARVKKLKETLVAVQQLDKNMGSLRTWLAHMESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEE---TWRLWQKFLDDYSRFEDWLEVSERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSACSLRQMVHGGNQRWDDLQKRVTSILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIE 8117          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 109.383 bits (272), Expect = 6.910e-23
Identity = 138/690 (20.00%), Postives = 309/690 (44.78%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQW----RLAIFAQERDAHI----SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN---LQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   +  L  +Q  L  +   +   ++E Q  +E L   +   +++    + +     +  E E    F +  + L  QW++    +   K  + + V+ +  F   +E       +L   L D    + +V E +        RL    + ++ H+    + Y   +  GE L R      T+  +   +  L E W      +  +  +L      W    K I+ L   ++ +   +   +P  +E L+     +++ EK LAN   S     EL++   +L +++  +D+T+L ++I L+ +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + ++ ++  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V       +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + TN  + L + +A +  I E   ++  + + Y+ +  +++ D+  ++   +     +++ +Q+ V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct:  846 FLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTNQAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQWRFFTTSVE-------DLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKL-RNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHS---LKELQTMKADLSQHILAEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVE 1520          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 108.997 bits (271), Expect = 8.953e-23
Identity = 138/690 (20.00%), Postives = 309/690 (44.78%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQW----RLAIFAQERDAHI----SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN---LQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   +  L  +Q  L  +   +   ++E Q  +E L   +   +++    + +     +  E E    F +  + L  QW++    +   K  + + V+ +  F   +E       +L   L D    + +V E +        RL    + ++ H+    + Y   +  GE L R      T+  +   +  L E W      +  +  +L      W    K I+ L   ++ +   +   +P  +E L+     +++ EK LAN   S     EL++   +L +++  +D+T+L ++I L+ +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + ++ ++  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V       +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + TN  + L + +A +  I E   ++  + + Y+ +  +++ D+  ++   +     +++ +Q+ V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct:  361 FLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTNQAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQWRFFTTSVE-------DLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKL-RNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHS---LKELQTMKADLSQHILAEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVE 1035          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 107.842 bits (268), Expect = 2.444e-22
Identity = 137/690 (19.86%), Postives = 308/690 (44.64%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQW----RLAIFAQERDAHI----SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN---LQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   +  L  +Q  L  +   +   ++E Q  +E L   +   +++    + +     +  E E    F +  + L  QW++    +   K  + + V+ +         F    ++L   L D    + +V E +        RL    + ++ H+    + Y   +  GE L R      T+  +   +  L E W      +  +  +L      W    K I+ L   ++ +   +   +P  +E L+     +++ EK LAN   S     EL++   +L +++  +D+T+L ++I L+ +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + ++ ++  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V       +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + TN  + L + +A +  I E   ++  + + Y+ +  +++ D+  ++   +     +++ +Q+ V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct: 5585 FLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTNQAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQW-------RFFTTSVEDLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKL-RNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHS---LKELQTMKADLSQHILAEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVE 6259          
BLAST of nesprin-1-like vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 107.842 bits (268), Expect = 2.592e-22
Identity = 137/690 (19.86%), Postives = 308/690 (44.64%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQW----RLAIFAQERDAHI----SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN---LQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   +  L  +Q  L  +   +   ++E Q  +E L   +   +++    + +     +  E E    F +  + L  QW++    +   K  + + V+ +         F    ++L   L D    + +V E +        RL    + ++ H+    + Y   +  GE L R      T+  +   +  L E W      +  +  +L      W    K I+ L   ++ +   +   +P  +E L+     +++ EK LAN   S     EL++   +L +++  +D+T+L ++I L+ +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + ++ ++  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V       +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + TN  + L + +A +  I E   ++  + + Y+ +  +++ D+  ++   +     +++ +Q+ V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct: 5586 FLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTNQAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQW-------RFFTTSVEDLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKL-RNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHS---LKELQTMKADLSQHILAEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVE 6260          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q6ZWR6|SYNE1_MOUSE (Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2)

HSP 1 Score: 141.354 bits (355), Expect = 1.236e-31
Identity = 270/1339 (20.16%), Postives = 573/1339 (42.79%), Query Frame = 2
Query: 3260 LKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKI----RDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHL-KFLNLKLRTIEPLVDLYCQRDTGFQSNFISEGMTK-RSKDIH----DLSDESKELHA-------IINEINENSLKVNGWISSQSVECQNIVKNLNS---KMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKS-----------------------LIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPY---SNHLLDLYEHWELFNGNMKRIVHNFEQMESVII------DCFNPMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRR---DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG-NLNEN---ENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHF-----INQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            LK SV + G+ LL+ K+ +   L  +L  ++++W  +   I      L ++ M  + S  +      ++ S +  ++  +  L+ E +IRN    +   E+L K+   K       +DL C++ T   ++F+++ + +  S+D+     D +D +++L A       +   + E    + G + S S E +N V++L +       KL    L   + +  +  +  + +++LIK+        + +V+ +    +++  N   E     +++ +++ L Q W+ L+++   V +L+I +   +G+  +                       L+  +   V+  ++ L+    EL    G   +       +  E    +++T+S+      +    L+ +I+     S  LL L++ ++ ++      +   E+  SV++      D  +      I D    L  +E+ +KDS     +L    E L + +D   +   Q        RL  +++     +        D   F    + +E    E +  L    P+ +   S+    + EL  ++++      D++ +  + +R  ++    KR + +  H ++  ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I  G NL E    ++   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ H+    L +  V  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L ++ EKW   S  ++    KL     +W   ++ I N    ++      +  +P  +E L+    + ++    +       +EL    D L  YLS +DI++L +R+ L+ +Q  EL  Q+ +RR+++  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L +  D W     L   ++K+L E   ++   ++   +L+ W+  M+  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E    WR+    L +   F     +++      S    + T   + L K +A +  + E   ++  + + Y+ +  +++ DS   +   + G   +++ +Q+ V+ +  +++   + + +  +  ++I  W+ ++D ++  +E
Sbjct: 6858 LKSSVTSTGNQLLRLKKVDTAALRAELSRMDSQWTDLLTGIPVVQEKLHQLQMDKLPSRHAIS----EVMSWISLMESVI--LKDEEDIRNAIGYKAIHEYLQKYKGFK-------IDLNCKQLT---ADFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQLLQGRVGEKIQMLEGLLESWS-EYENSVQSLKAWFANQERKLKEQHLLGDRNSVENALKDCQELEDLIKA-------KEKEVEKIEQNGLALIQNKREEVSG--SVMSTLQELRQTWISLDRT---VEQLKIQLTSALGQWSNHKAACDEINGHLMEARYSLSRFRLLTGSSEAVQVQVDNLQNLHDELEKQEGGLQKFGSITNQLLKECHPPVAETLSSTLQEVNMRWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCASAIQRQEEQTSVLLKAATNKDIADDEVTKWIQDCNDLLKGLET-VKDSLFILRELG---EQLGQQVDVSAAAAIQCEQLCFSQRLGALEQALCKQQAVLQAGVVDYETFAKSLEALEVWMVEAEGILQGQDPTHSSDLSTIQERMEELKGQMLKFSSLAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLTSSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEHKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIVDGQNLLEQGQVDDREEFSLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLAEVSHLPLSGLGNIPVPLQQVRMLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELTDIQEKWKAASMHLEEQKKKLAFLLKDWEKCERGIANSLEKLRMFKKRLSQPLPDHHEELHAEQMRCKELENAVGRWTDDLTELMLVRDALAVYLSAEDISMLKERVELLQRQWEELCHQVSLRRQQVSERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAVAQENKIQLQEMGERLAKASHESKASEIQYKLSRVKDRWQHLLDLMAARVKKLKETLVAVQQLDKNMGSLRTWLAHMESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEE---TWRLWQKFLDDYSRFEDWLEVSERTAAFPSSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSACSLRQMVHGGNQRWDDLQKRVTSILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIE 8138          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q8NF91|SYNE1_HUMAN (Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4)

HSP 1 Score: 133.265 bits (334), Expect = 3.998e-29
Identity = 168/753 (22.31%), Postives = 344/753 (45.68%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLE--------FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLF--LILIGKGNLNENE--NCGHFQANLNDLKFQWEKITEHINNSKRYLDKHV---SNYLEFMGKL-----ELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFI--NQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D++ +  + +R  ++    KR + +  H ++I ++          E  SKL+        F+  C   M+FL   + +L  +   NY  ++E Q   E     +  ++ +   +I+ G+  L + +  +   F   L  L  QW+ +       +  +D  +     Y E   KL     E+ ++    L    +  Q      DE   +Q++  +F +++ ++I   EA    G+ L  +  DSG ++ +Q  L E+ EKW   S +++    KL     +W   +K I +    ++      +  +P  +E L+    + ++    + S     ++L    D L  Y+S DDI+IL +R+ L+ +Q  EL  Q+ +RR++I  R++ W  F +  +    E+ E LT +ESK V Q     ++EM++KL+ +    I   +     L+  G  + + S E ++ +I Y+L K +D W     L   ++K+L E   ++   ++  S+L+ W+  ++  L  PIV       +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW+      +  + ++  ++      S    I T   + L K +A +  + E   ++  + + Y+ +  +++ DS     C +K ++     +++ +Q+ V+ +  +++     + +  +  ++I  W+ ++D ++  +E
Sbjct: 7409 DLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTT--------ERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDE---VQFKEKVFLRQQGSYILTVEA----GKQLLLSA-DSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDTLSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNK----ELCEWLTQMESK-VSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSA----CSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIE 8135          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q8WXH0|SYNE2_HUMAN (Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 1.294e-23
Identity = 144/703 (20.48%), Postives = 316/703 (44.95%), Query Frame = 2
Query: 4988 LENCSKLEFIAL-------CNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLE-LFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFA-QERDAHISVYEACMA----TGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI----DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            LE CS+L+ I L       C   +  L  ++  L+     +  E++E Q  ++ L   +   +++    + +     +  E EN   F    + L  +W+   + +   K  +D  V  + +F   +E LF    D  T  L+   S +   +  +  Q R  I   + ++ H        A     GE L  T  D  TK  +   + +L + W  +  Q+  M  +       W   +K I+ L + ++ +   +   +P  +E L+   +  ++   +L S      EL++   +L R++  +D+ +L ++I  + +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + R+ +I  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V   + +    +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + T+  + L + +A +  I E   ++  + + Y+ +  +++ D+   +   +     +++ +Q  V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct: 5583 LERCSELQGIGLNEKFLYCCEKWIQLLEKIEEALKVDVANSLPELLEQQKTYKMLEAEVSINQTIADSYVTQSLQLLDTTEIENRPEFITEFSKLTDRWQNAVQGVRQRKGDVDGLVRQWQDFTTSVENLFRFLTD--TSHLL---SAVKGQERFSLYQTRSLIHELKNKEIHFQRRRTTCALTLEAGEKLLLTT-DLKTKESVGRRISQLQDSWKDMEPQLAEMIKQFQSTVETWDQCEKKIKELKSRLQVLKAQSEDPLPELHEDLHNEKELIKELEQSLASWTQNLKELQTMKADLTRHVLVEDVMVLKEQIEHLHRQWEDLCLRVAIRKQEIEDRLNTWVVFNEKNKELCAWLVQMENKVLQTADISIEEMIEKLQKDCMEEINLFSENKLQLKQMGDQLIKASNKSRAAEIDDKLNKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVV---YDVCDDQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTSAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQRRVTAVLRRLRHFTNQREEFEGTRESILVWLTEMDLQLTNVE 6272          
BLAST of nesprin-1-like vs. UniProt/SwissProt
Match: sp|Q6ZWQ0|SYNE2_MOUSE (Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 1.710e-21
Identity = 137/690 (19.86%), Postives = 308/690 (44.64%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQW----RLAIFAQERDAHI----SVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLN---LQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN-----IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   +  L  +Q  L  +   +   ++E Q  +E L   +   +++    + +     +  E E    F +  + L  QW++    +   K  + + V+ +         F    ++L   L D    + +V E +        RL    + ++ H+    + Y   +  GE L R      T+  +   +  L E W      +  +  +L      W    K I+ L   ++ +   +   +P  +E L+     +++ EK LAN   S     EL++   +L +++  +D+T+L ++I L+ +Q  +L +++ IR++EIE R++ W  F +  ++L + + ++   +       ++EM++KL+ + +  I  +      LK  G  + + S + ++ ++  +L K +D W     +  +++K+L E +  I   ++  SNL+ W+  ++  L+ P+V       +I  +L E   +Q  +I+ HS  V SV  +C++L+ + DAC N ++ + I +T + L +RW NI      +  K+ E    WR+    L +   F + +     +         + TN  + L + +A +  I E   ++  + + Y+ +  +++ D+  ++   +     +++ +Q+ V+ +  ++R     + +     E+I  W+ ++D ++  +E
Sbjct: 5585 FLHYCERWIQVLEKIQESLSVEVAHSLPALLEQQKTYEILEAEVSTNQAVADAYVTQSLQLLDTAEIEKRPEFVSEFSKLSDQWQRAARGVRQRKCDISRLVTQW-------RFFTTSVEDLLRFLADTSQLLSAVKEQDCYSLCQTRRLVHELKSKEIHLQRWRTTYALALEAGEKL-RNTPSPETREFVDGQISRLQESWKDTELSLGEVISRLQSTAETWDQCKKKIKKLKKRLQALKAQSEDPLPELHEALHEEKELIKEVEKSLANWTHS---LKELQTMKADLSQHILAEDVTVLKEQIQLLHRQWEDLCLRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQMENKVLQTADVSIEEMIEKLQKDCMEEISLFTENKLQLKQMGDQLIKASSKAKAAELEEKLSKINDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDNQEIQKRLAEQQDLQ-RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMKIEE---TWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTNAKEELKRFEAFQRQIHERLTQLELINKQYRRLARENRTDTASKLKQMVHEGNQRWDNLQKRVTAILRRLRYFTNQREEFEGTRESILVWLTEMDLQLTNVE 6259          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A1S3HP04 (nesprin-1-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106156537 PE=4 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.151e-44
Identity = 166/711 (23.35%), Postives = 335/711 (47.12%), Query Frame = 2
Query: 5009 EFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNL----NENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEI-STFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDH-FINQI----DGRLNSLVANIE-TNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIET---RKLELQDIKSQFLNQLKYL 7099
            +F   C+  M FL   +  L      NY+ ++E Q  +E     ++ ++ +   +I  G+     ++++    FQ  L+ L  QW+ +    N  K  +D ++S++  +    E    W D + + L  F+    ++ ++  L   L    ++   H S+Y+     G  L  ++ D  T+S I+ HL ++ + W ++  ++    + L     +W   ++ I+++ AW+KE+           Y+ L   LQ+  +F     ++   R  L  K   L   +SPDD+TIL  RI L+ KQ  E+  QI +RR  IE R++ W  F D  R++   +S +   + S + + ++++++KL+ +    I + +   +DL + G  + + S E R+ DI Y++ K  D W R Q L   +LK+L E   ++   E+  ++L++W+  ++  L+SP+  ++  +    + L+  +   ++I+ HS  V SVL LC +L+ + DACP   +   +   +  L +RW NI      +  ++ E   LW+    K +E  H F++ +            A++      + L K + L+  + E   E+  + + Y+ +  + + D    +  Q+    + ++ + + +S +  +++ L  V     +  E +  W+ D+D +I  ME     +I+T   R LE Q+      ++L+Y+
Sbjct: 1422 DFQQKCDAWMTFLAQAEQNLAVDIAGNYEGLLEQQKIYELFQSEIYSRQQILQSIISDGHQMMRDSDSDERQEFQRKLSMLDQQWQSVVRRTNQRKAIIDHNISHWQMYKTLREKLSNWLDEMDENLNIFEFSTATLQKIKALIEHLRATQKDLAMHESMYQRVHEAG-CLLVSISDKTTESTIRSHLTDIQQHWFQIIGKLDGRREHLEGILKQWQGCEEGIEDILAWLKEMRKALNVGLAQNYDDLQRQLQQCVEFETAFANAADKRKILLEKEHQLALVVSPDDLTILRQRIVLLTKQWDEIANQIVLRRNCIEDRLNEWTLFNDKYREMLDWLSYMEAKVSSNQEFHIEDILEKLQKDYKEEITNMQVNRDDLFAHGHRLIKSSSEVRANDIEYKISKLRDRWQRLQELVTARLKKLQETLTAVQELEKSMASLRRWLAYIEHALSSPVSYQQADLTEIHRRLQQQQEHQQDIERHSAGVASVLNLCQVLLHDTDACPTDVEVSALQHAKTSLDRRWKNIRALSTERRMRIEETWRLWQ----KFSEDYHRFVDWMKDMEKATTKPRSASVTFAEAKEELRKFETLQRSLHENLAELELINKQYRRLARESRTDVSSMLKGQVTDANNAWDKLSKRLSGIIRRLKHLLNVHEDFKTTREALLVWLTDLDMQITNMEHFSEMDIDTKLHRMLEFQEQIKTRSSKLQYV 2127          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A1S3HMH3 (nesprin-1-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106156537 PE=4 SV=2)

HSP 1 Score: 191.43 bits (485), Expect = 2.234e-44
Identity = 166/711 (23.35%), Postives = 335/711 (47.12%), Query Frame = 2
Query: 5009 EFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNL----NENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEI-STFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDH-FINQI----DGRLNSLVANIE-TNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIET---RKLELQDIKSQFLNQLKYL 7099
            +F   C+  M FL   +  L      NY+ ++E Q  +E     ++ ++ +   +I  G+     ++++    FQ  L+ L  QW+ +    N  K  +D ++S++  +    E    W D + + L  F+    ++ ++  L   L    ++   H S+Y+     G  L  ++ D  T+S I+ HL ++ + W ++  ++    + L     +W   ++ I+++ AW+KE+           Y+ L   LQ+  +F     ++   R  L  K   L   +SPDD+TIL  RI L+ KQ  E+  QI +RR  IE R++ W  F D  R++   +S +   + S + + ++++++KL+ +    I + +   +DL + G  + + S E R+ DI Y++ K  D W R Q L   +LK+L E   ++   E+  ++L++W+  ++  L+SP+  ++  +    + L+  +   ++I+ HS  V SVL LC +L+ + DACP   +   +   +  L +RW NI      +  ++ E   LW+    K +E  H F++ +            A++      + L K + L+  + E   E+  + + Y+ +  + + D    +  Q+    + ++ + + +S +  +++ L  V     +  E +  W+ D+D +I  ME     +I+T   R LE Q+      ++L+Y+
Sbjct: 1422 DFQQKCDAWMTFLAQAEQNLAVDIAGNYEGLLEQQKIYELFQSEIYSRQQILQSIISDGHQMMRDSDSDERQEFQRKLSMLDQQWQSVVRRTNQRKAIIDHNISHWQMYKTLREKLSNWLDEMDENLNIFEFSTATLQKIKALIEHLRATQKDLAMHESMYQRVHEAG-CLLVSISDKTTESTIRSHLTDIQQHWFQIIGKLDGRREHLEGILKQWQGCEEGIEDILAWLKEMRKALNVGLAQNYDDLQRQLQQCVEFETAFANAADKRKILLEKEHQLALVVSPDDLTILRQRIVLLTKQWDEIANQIVLRRNCIEDRLNEWTLFNDKYREMLDWLSYMEAKVSSNQEFHIEDILEKLQKDYKEEITNMQVNRDDLFAHGHRLIKSSSEVRANDIEYKISKLRDRWQRLQELVTARLKKLQETLTAVQELEKSMASLRRWLAYIEHALSSPVSYQQADLTEIHRRLQQQQEHQQDIERHSAGVASVLNLCQVLLHDTDACPTDVEVSALQHAKTSLDRRWKNIRALSTERRMRIEETWRLWQ----KFSEDYHRFVDWMKDMEKATTKPRSASVTFAEAKEELRKFETLQRSLHENLAELELINKQYRRLARESRTDVSSMLKGQVTDANNAWDKLSKRLSGIIRRLKHLLNVHEDFKTTREALLVWLTDLDMQITNMEHFSEMDIDTKLHRMLEFQEQIKTRSSKLQYV 2127          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A2R2MSC6 (nesprin-1-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106156537 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.547e-44
Identity = 166/711 (23.35%), Postives = 335/711 (47.12%), Query Frame = 2
Query: 5009 EFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNL----NENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEI-STFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDH-FINQI----DGRLNSLVANIE-TNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIET---RKLELQDIKSQFLNQLKYL 7099
            +F   C+  M FL   +  L      NY+ ++E Q  +E     ++ ++ +   +I  G+     ++++    FQ  L+ L  QW+ +    N  K  +D ++S++  +    E    W D + + L  F+    ++ ++  L   L    ++   H S+Y+     G  L  ++ D  T+S I+ HL ++ + W ++  ++    + L     +W   ++ I+++ AW+KE+           Y+ L   LQ+  +F     ++   R  L  K   L   +SPDD+TIL  RI L+ KQ  E+  QI +RR  IE R++ W  F D  R++   +S +   + S + + ++++++KL+ +    I + +   +DL + G  + + S E R+ DI Y++ K  D W R Q L   +LK+L E   ++   E+  ++L++W+  ++  L+SP+  ++  +    + L+  +   ++I+ HS  V SVL LC +L+ + DACP   +   +   +  L +RW NI      +  ++ E   LW+    K +E  H F++ +            A++      + L K + L+  + E   E+  + + Y+ +  + + D    +  Q+    + ++ + + +S +  +++ L  V     +  E +  W+ D+D +I  ME     +I+T   R LE Q+      ++L+Y+
Sbjct: 1402 DFQQKCDAWMTFLAQAEQNLAVDIAGNYEGLLEQQKIYELFQSEIYSRQQILQSIISDGHQMMRDSDSDERQEFQRKLSMLDQQWQSVVRRTNQRKAIIDHNISHWQMYKTLREKLSNWLDEMDENLNIFEFSTATLQKIKALIEHLRATQKDLAMHESMYQRVHEAG-CLLVSISDKTTESTIRSHLTDIQQHWFQIIGKLDGRREHLEGILKQWQGCEEGIEDILAWLKEMRKALNVGLAQNYDDLQRQLQQCVEFETAFANAADKRKILLEKEHQLALVVSPDDLTILRQRIVLLTKQWDEIANQIVLRRNCIEDRLNEWTLFNDKYREMLDWLSYMEAKVSSNQEFHIEDILEKLQKDYKEEITNMQVNRDDLFAHGHRLIKSSSEVRANDIEYKISKLRDRWQRLQELVTARLKKLQETLTAVQELEKSMASLRRWLAYIEHALSSPVSYQQADLTEIHRRLQQQQEHQQDIERHSAGVASVLNLCQVLLHDTDACPTDVEVSALQHAKTSLDRRWKNIRALSTERRMRIEETWRLWQ----KFSEDYHRFVDWMKDMEKATTKPRSASVTFAEAKEELRKFETLQRSLHENLAELELINKQYRRLARESRTDVSSMLKGQVTDANNAWDKLSKRLSGIIRRLKHLLNVHEDFKTTREALLVWLTDLDMQITNMEHFSEMDIDTKLHRMLEFQEQIKTRSSKLQYV 2107          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A2R2MQ62 (nesprin-1-like OS=Lingula unguis OX=7574 GN=LOC112042292 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.644e-41
Identity = 135/543 (24.86%), Postives = 263/543 (48.43%), Query Frame = 2
Query: 5009 EFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNL----NENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEI-STFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR 6622
            +F   C+  M FL   +  L      NY+ ++E Q  +E     ++ ++ +   +I  G+     ++++    FQ  L+ L  QW+ +    N  K  +D ++S++  +    E    W D + + L  F+    ++ ++  L   L    ++   H S+Y+     G  L  ++ D  T+S I+ HL ++ + W ++  ++    + L     +W   ++ I+++ AW+KE+           Y+ L   LQ+  +F     ++   R  L  K   L   +SPDD+TIL  RI L+ KQ  E+  QI +RR  IE R++ W  F D  R++   +S +   + S + + ++++++KL+ +    I + +   +DL + G  + + S E R+ DI Y++ K  D W R Q L   +LK+L E   ++   E+  ++L++W+  ++  L+SP+  ++  +    + L+  +   ++I+ HS  V SVL LC +L+ + DACP   +   +   +  L +RW NI      +  ++ E   LW+
Sbjct: 2600 DFQQKCDAWMTFLAQAEQNLAVDIAGNYEGLLEQQKIYELFQSEIYSRQQILQSIISDGHQMMRDSDSDERQEFQRKLSMLDQQWQSVVRRTNQRKAIIDHNISHWQMYKTLREKLSNWLDEMDENLNIFEFSTATLQKIKALIEHLRATQKDLAMHESMYQRVHEAG-CLLVSISDKTTESTIRSHLTDIQQHWFQIIGKLDGRREHLEGILKQWQGCEEGIEDILAWLKEMRKALNVGLAQNYDDLQRQLQQCVEFETAFANAADKRKILLEKEHQLALVVSPDDLTILRQRIVLLTKQWDEIANQIVLRRNCIEDRLNEWTLFNDKYREMLDWLSYMEAKVSSNQEFHIEDILEKLQKDYKEEITNMQVNRDDLFAHGHRLIKSSSEVRANDIEYKISKLRDRWQRLQELVTARLKKLQETLTAVQELEKSMASLRRWLAYIEHALSSPVSYQQADLTEIHRRLQQQQEHQQDIERHSAGVASVLNLCQVLLHDTDACPTDVEVSALQHAKTSLDRRWKNIRALSTERRMRIEETWRLWQ 3141          
BLAST of nesprin-1-like vs. TrEMBL
Match: A0A210QXB7 (Nesprin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09398 PE=4 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.857e-36
Identity = 163/725 (22.48%), Postives = 328/725 (45.24%), Query Frame = 2
Query: 4955 NKIIQAI----QDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGN--LNEN--ENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVL---DSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKF-RIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMM--DIKLTETDHFINQIDGRLNSLVANIETNPDKNLDK-----IQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEID----MMEINQP-KNIETRKLE 7054
            NKI+Q I    QD          F   C+  M FL   +  L  +   N  ++ + Q  FE     ++ K+ +   +I  G   + E   E+   FQ  L+ L  QW+ +    N  K  +D  +  +  F    E    W       +  F+ ++ S+ ++ +L  +    A+  +    + E  +       R +L   DS     ++    +L + W ++   +     KL     +W + ++ I+++  W+K+      +D+P  Y+ L   L + +       +++I R  L SK   L + + PDD+ +L  RI L++KQ  EL  Q  +R + I   M  W  F +  R L     ++   + S + Y +++++ K++ +    + D + +   L  QG ++ + S E RS DI  ++Q+ ++ W     + N + ++L E   ++   +   +NL+KW+  M+  L+ PI+ +   R +I  KL E  ++Q  +I+ HS  V SVL LC +L+ + DACP+  +   +    K L +RW  I  +   + +++ E   LW  +  D KL   D ++  I+     ++ +     D +L K      ++L+  + E    + ++   Y+ +  + + D    +  +M+     ++ +Q+ VS +  Q++Q + ++    S  + + +W+ D D ++     ++ ++ P K  ETR+L+
Sbjct: 9246 NKILQGIILIQQD----------FTEKCDAWMTFLAQTEQDLSTEIAGNLADLTDQQRNFEKFESDMYTKQQILHAIISDGQKMMKEGKVEDKEEFQQKLHLLAEQWQSVVRRANQRKAIIDNTIKQWQAFNELTERLRDWLTEKEFGMKAFEVDLVSLQKIKNLLEK----ARHTETEFKLQEDVLKKMHDQSRPLLQRADSDATDELKVCTAQLQQYWHQLCGSLDDHCQKLEAVLRQWQECEEDIEDILGWLKDTRQSFGADLPTAYDQLQAELNRCKDIETEFVNAEIKRDTLLSKEARLGQVIQPDDLNVLHQRIRLLNKQWDELRNQAALRAQRINDNMFRWSTFNERVRDLMEWTDQMEVKVISTKKYHIEDLLTKMQRDFREEMADREREKVRLVEQGKELMKVSSEVRSSDIDNKIQRLEEKWQHLSSVLNFRQRKLQETLLAVQQLDLSMANLRKWLSNMEHDLSGPIIYQVCNRKEIQEKLCEQQELQT-DIEHHSAGVGSVLNLCEVLLHDTDACPSEVEFNALQTAMKNLDRRWRTICQQSPERRARIEETWELWHTLLEDFKL--FDDWLTDIE---QEVIGSPRDQLDVSLTKEEVKHFESLQKRVHENLPSLESINRQYRRLAREGRTDHANHLKREMQDANDSWDKLQQCVSNMTRQLKQSSNLRQDFTSVRDDLYTWLNDTDMQLTNIEHLLSMDTPTKMAETRRLQ 9950          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 119.398 bits (298), Expect = 7.122e-26
Identity = 152/765 (19.87%), Postives = 334/765 (43.66%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMD-------QASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDE----MNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSI----QNLFAWIKEISTFTTSDIPFYEGLNLNLQ--------KSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLW-RMMD--------IKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            D+  +  + +R  ++       Q  ++ + +   H T   +K+  A+  R         F+  C   + FL   + +L  +   NY  ++E Q   E     +  ++ +   +I  G    N  + E+   F   L  L  QW+ +       +  +D  V  +  +    E    W   + +     +    ++ +    ++H+Q +  +  +++ +++   EA    G  L  +  D+  ++ +Q  L +L E+W   S ++     +L     +W   +K I    + L A+ +++S      +P +     N Q         +E +  ++    ++R       D L   LS DD+T+L +R+ L+ +Q  E   Q+ +RR+++  +++ W  F +       E+ E LT +ESK V Q     ++EM++KL  +    I   +   + L+  G  +   S E ++ +I Y+L K ++ W     L   ++K+L E   ++   ++  S+L+ W+  ++  L+ PIV +    +   K L   +    +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   LW + +D        +K +E    +    G L ++         + L K +A +  + E   ++  + + Y+ +  +++ DS     C+++ ++     +++T+Q  V+ +  +++   + + +  +  ++I  W+ ++D ++  +E
Sbjct: 7245 DLEHLNGLGYRLPLNDQEMIRLQNLNRTWASCSAHTTERFSKLQAAVLQRQ-------SFLEKCEAWLTFLTQTEEKLAAEISGNYQSLLEQQREHELFQAEMFSRQQILYSIISDGHQLLNQGQVEDRDDFGLKLALLSNQWQGVVRRAQQRRGIIDGLVCQWQRYTELAEKLRHWLKEVQEPEEQQEGGTVTLQQARGILDHIQLKERVLQRQQGSYVLAVEA----GRQLLLSA-DARAEALLQSELTDLQERWRSTSIRLDERKKELLSLLKDWEQCEKGIAVSHEKLRAFKRKLSLA----LPDHHEELHNEQIRCKELEGSTEGWTDDVTGLCVLR-------DALSSNLSSDDLTVLQERLELLQRQWEETCHQLALRRQQVSEKLNEWAVFNEK----NKELCEWLTHMESK-VSQNGDITIEEMIEKLRKDYQEEISVVEENKQQLEQMGERLARSSHESKAAEIQYKLSKVNERWQHLLDLIAARVKKLRETLVAVQQLDKNMSSLRSWLAHIETELSRPIVYETCDTNEIQKKLNQQQDMQRDIEKHSTGVASVLNLCEVLLHDCDACATETECDSIQQATRGLDRRWRNICAVAMERRLKIEETWRLWQKFLDDYSRFEDWLKASERTAALPNSSGVLYTVA-------KEELKKFEAFQRQVQECLTQLELINKQYRRLARENRTDS----SCRLRQMVHDGNRRWDTLQRRVTAILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIE 7970          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 101.679 bits (252), Expect = 1.375e-20
Identity = 133/693 (19.19%), Postives = 306/693 (44.16%), Query Frame = 2
Query: 5012 FIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNL----NENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKL--------VDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQ-----VDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWR--MMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLL----SKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            F+  C   M+FL   + +L  +   N+  ++E Q   E     +  ++ +   +I  G       + ++   F+  L  L  QW+ +       +  +D  +  +  +   +E    W   ++ +         V  Q     +D    +Q +  +  +++ ++I   EA    G  L  +  DS  ++ +Q+ L  + E+W   +  ++    +L     +W   ++ I      ++      +  +P  +E L     +               + L    ++L  Y+SP+D+ +L +RI L+ +Q  E+  Q+ +RR+++  +++ W  F +  +    E+ E LT +E K V Q     ++EM++KL  +    +   + + + L+  G  + + S E ++ +I ++L K  + W     L + + K+L E   ++   ++  S+L+ W+  ++  L+ PIV       +I  KL    ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW +I      +  K+ E   LW+  + D    E    +++    L +    + T   + L K +A +  + E   ++  + + Y+ +  +++ D+     C+++ +      +++ +Q  VS +  +++   + + +  +  ++I  W+ ++D ++  +E
Sbjct: 2974 FLEKCETWMEFLVQTEEKLAVEISGNFQSLMEQQRAHELFQAEMFSRQQILHSIISDGQRMLEQGQVDDRDEFKLKLALLSNQWQGVVRRAQQRRGIIDSLIRQWQRYRDMVEKLRKWLAEVSHQTEALHPRAPVPLQQARAMLDA---VQLKEKVLQRQQGSYILTVEA----GRQLLLSA-DSRAEASLQEELLSIQERWRHANICLEEQKRELAVLLRDWERCEEGIGGSLEKLRSFKRQLSQTLPDQHEELQAEQMRCRDLEGTFDGWTEDLAHLTVLRESLSSYISPEDLCVLQERIELLHRQWEEICHQLSLRRQQVSEKLNEWAIFNEKYK----ELCEWLTHMECK-VSQNGDISIEEMIEKLRKDYQEELAVAQEEKQQLQQMGERLVKASHESKASEIEHKLNKVSERWQHLLDLISARAKKLRETLVAVQQLDKNMSSLRTWLTHIETELSRPIVYDTCDFQEIQRKLDLQQELQ-RDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRTLDRRWRSICAMSMERRLKIEETWRLWQKFLDDFSRFEDWLAMSERTAALPNSSGVLYTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDA----ACRLREMAHDGNHRWDNLQRRVSSILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIE 3648          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: syne2b (spectrin repeat containing, nuclear envelope 2b [Source:ZFIN;Acc:ZDB-GENE-071218-5])

HSP 1 Score: 66.2402 bits (160), Expect = 4.882e-10
Identity = 66/314 (21.02%), Postives = 143/314 (45.54%), Query Frame = 2
Query: 6245 LKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIE--TRKLELQDIKSQF-LNQLKYLKDIEIESKIILNNSQSDSVHFSD 7168
            +++L E    +   ++  SNL+ W+  ++  L+ P+V      D I  KL E  +    +I+ H+  V SVL LC++L+ + DAC +  + + I +T + L +RW NI   +  +   + E   LWR      +  + ++   +    +  +   + T   + L K +A +  + E   ++  + + Y+ +  +++ D+  ++   +     +++T+Q  V     +++   + + +     E I  W+ ++D ++  +E     +I    R+L LQ  + +  LN  K    I     +I  +S  D+V   D
Sbjct:    1 VRKLKETLVMVQQLDKNMSNLRTWLSRIEGQLSKPVVYSICHGDEIQRKLAEQQQELQRDIEQHTEGVASVLTLCDVLLHDADACGSDVENDSIQQTTRSLDRRWRNI-CAMSMERRMIEETWRLWRKFLEDYSRFEVWLTTAEQTAANPASTDVLYTCAKEELKKFEAFQRQVHERLTQLELVNKQYRRLARENRTDTSNKLKTMVNEGNQRWDTLQRRVPAWLRRLKHFTSQREEFEGTREAILVWLTEMDLQLTNVEHFSESDIHDKMRQLNLQAFQQEITLNTNKIDALIVFGENLIQKSSPLDAVLIED 313          
BLAST of nesprin-1-like vs. Ensembl Cavefish
Match: ENSAMXT00000054961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:61145939:61162094:1 gene:ENSAMXG00000029675.1 transcript:ENSAMXT00000054961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 7.584e-7
Identity = 48/251 (19.12%), Postives = 117/251 (46.61%), Query Frame = 2
Query: 6272 SIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            ++   ++  SNL+ W+   +  L  P+       D I  +L E   +Q  +I+ H+  V SVL LC++L+ + DAC + S+ + I  T + L +RW NI      +  ++ E   LW       +  + ++N  +       ++  + T   + L + +A + ++ E   ++  +   Y  +  + + D+   +   +     +++++Q+ ++ +  ++R     + +  S  E++  W+ ++D ++  +E
Sbjct:    3 TVQQLDKNMSNLRTWLSRTEAELAKPVHYSVCHGDEIQRRLAEQQDLQ-RDIEQHTEGVASVLTLCDVLLHDEDACSSDSENDSIQLTSRSLDQRWRNICSMSLERRMRIEETWRLWCTFQDDYSCFEDWLNLAERTAAEPHSSDVLYTVAKEELKRYEAFQREVHEKLTQLELINNQYIRLARESRTDTSSRLRAMVHKGNQRWDSLQKRLAAILRRLRHFTIQREEFESTRESLLVWLTEMDLQLTNVE 252          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009426.1 (pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1 gene:ENSPMAG00000008375.1 transcript:ENSPMAT00000009426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 1.036e-32
Identity = 144/794 (18.14%), Postives = 335/794 (42.19%), Query Frame = 2
Query: 4856 DINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKG----NLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSN---YLEFMGKLEL-FHVWCD-----NLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIP-FYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQF-LNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMK 7186
            +++ +  + +R  +D  S +R + +    T++  +  +           +  F+  C   ++FL   +  L  +   ++D ++  Q   E     +  ++ +   +I  G    +  E E+   F   L  L  QW+ +       K  +D  ++    Y E   KL      W D      L  + +  Q     +D+   LQ R   F +++  +I   EA    G+ L  +  D+ T+  +Q  L    + W      ++    ++     EW   +K +      ++ +    +  +P  ++ L       ++  ++++      ++L +  D L R+   DDI+ L +R+ L+ +Q  EL   + +R++ I  R++ W  F +  +KL   + ++ + +       ++EM++KL+ E    +         L   G  +   S E  + +I Y+L K  D W   Q L   ++K+L +   ++   E   S+L+ W+  ++  L+ P+V +        + L   +    +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  K+ E   +W+      +  + ++ + +    S   +  +       L K +  +  + E   ++  + + Y+ +  + + DS   +   +     +++ +Q+ V+++  ++R     + +  +  ET+  W+ ++D ++  +E     +   +  +LQ  + +  LN+ K  +  ++  ++++ +   DS    D + +++
Sbjct: 7085 ELDRLNELGYRLPLDNQSIRRLQLLNRRWTLLSAQTCERFSKLQAFLLQRQSFLEKCESWLEFLEHTEGALATEIAGSHDALLAQQRSHELFQAEMFSRQQILHSIIVDGHSLLDQGEVEDRDEFNLKLTLLSDQWQGVVRRAQQRKGIIDGLLAQWQRYQELAAKLRARLEQWADLARPQPLPPRSLSLQQARALLDD---LQMREKAFLRQQGNYIVSVEA----GKQLLLSA-DASTEEELQAELTGFQQSWKAAGKHLEQRRRQVATLLQEWESCEKEMAESLEKLRGLKIKLSKPLPEHHDDLKSENVSCKELESSVEEWAAELAQLTAMRDALARHFGVDDISGLQERMELLQRQWEELGQHVSLRKQMITERLNKWSLFNEKYKKLCEWLGQMESKVTHNGDVSIEEMLEKLQKEYQQEMNAGAQHHVHLDEMGRLLMGASSESTASEIEYKLSKVADGWRHLQDLLTARVKKLRDTLVAVQQLERNMSSLRSWLSHIEAELSRPLVYESCERREIQRQLGQQQQLQRDIEKHSAGVGSVLSLCEVLLHDCDACATETECDSIQQATRNLDRRWRNICTMSMDRKYKIEETWHMWQKFQEDYSRFEEWLRKAESTAASPNTSGIVYLAARDELKKFEGFQRQVHESLTQLELINKQYRRLARESRTDSTSRLRHMVLDGNQRWDELQKRVAIILRRLRHFIGQREEFEASRETVLVWLTEMDLQLTNVEHFSECSTPAKIRQLQAFQKEIALNRCKLGRLEDMGQRLMVRSEPGDSAVVEDELEELR 7870          
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010752.1 (pep scaffold:Pmarinus_7.0:GL476415:502507:525271:-1 gene:ENSPMAG00000009738.1 transcript:ENSPMAT00000010752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 1.793e-7
Identity = 37/204 (18.14%), Postives = 102/204 (50.00%), Query Frame = 2
Query: 6419 NIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLS---KFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            +I+ HS  V SVL  C  L+++ DAC  +++ E +S+  + L++RW NI      +  ++ +   LW+      T  + ++ +++    S  ++  + T   + L + + ++  + E   ++  + + Y+ +  +++ D+     C  + +LS   +++ +Q  V+ +  +++   + + +  +  E++  W+  +D ++  +E
Sbjct:    6 DIEEHSASVSSVLGACGALLQDCDACAGKAESEGLSQATRGLERRWRNICATAMERRLRIEDTWRLWQKFREDHTRLEEWLVELERTAASPSSSLVLYTQAKEELKRFEGIQRQVHESLTQLELVNKQYRRLARENRTDA---TCCLRRMVLSCNQRWDDLQRRVAAILRRLKHFVSQRDEFETTRESLVVWLTQMDLQLTNLE 206          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: syne2b (spectrin repeat containing, nuclear envelope 2b [Source:ZFIN;Acc:ZDB-GENE-071218-5])

HSP 1 Score: 67.0106 bits (162), Expect = 2.831e-10
Identity = 55/256 (21.48%), Postives = 119/256 (46.48%), Query Frame = 2
Query: 6299 SNLKKWMLEMKETLNSPIVLKKFRID-IPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVAN--IETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLEL 7057
            SNL+ W+  ++  L  P+V      D I  KL E   +Q  +I+ HS  V +VL LC++L+ + DAC   S+ + I +T   L  RW NI      +  ++ E   LWR      +  + ++   +    S  +   + T+  + L + +A +  + E   ++  + + Y+ +  +++ DS   +   +     +++ +Q  V+ +  +++   + + +     E I  W+ ++D ++  +E     +IE +  +L
Sbjct:   26 SNLRTWLSRIEAELAKPVVYSVCHSDEIQRKLEEQQDLQ-RDIEQHSESVAAVLTLCDVLLHDADACSPDSENDSIQQTTHSLDCRWRNICAMSMERRMRIEETWRLWRKFLDDYSRFEDWLKTAELTAASPGSADVLYTSAKEELKRFEAFQRQVQERHTQLELVNKQYRRLARENRTDSASRLKGMVNDGNQRWDCLQRRVAAILRRLKHFTSQREEFEGSREAILMWLTEMDLQLTNVEHFSESDIEDKMRQL 280          
BLAST of nesprin-1-like vs. Ensembl Medaka
Match: ENSORLT00000040222.1 (pep primary_assembly:ASM223467v1:24:8953331:8961054:-1 gene:ENSORLG00000024631.1 transcript:ENSORLT00000040222.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 4.002e-9
Identity = 54/274 (19.71%), Postives = 134/274 (48.91%), Query Frame = 2
Query: 6236 NNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRI-DIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLW-RMMD--------IKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLS----KFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMME 7015
            ++++K+L E   ++   ++  S+L+ W+  ++  L+ PI  +     +I  KL +  ++Q  +I+ HS  V SVL LC +L+ + DAC   ++ + I +  + L +RW NI      +  ++ E   LW + +D        +K +E    +    G L ++         + L K +A +  + E   ++  + + Y+ +  +++ DS     C+++ ++     +++ +Q+ V  +  +++   + + +  +  ++I  W+ ++D ++  +E
Sbjct:    9 SSRVKKLRETLVAVQQLDKNMSSLRSWLSYIEAELSRPIAYEACDYQEIARKLNQQQELQ-HDIEKHSTGVASVLNLCEVLLHDCDACSTETECDSIQQATRGLDRRWRNICAMSMERRLRIEETWRLWQKFLDDYSKFEDWLKTSEKTAALPNSSGVLYTVA-------KEELKKFEAFQRQVQECLTQLELINKQYRRLARENRTDS----SCRLREMVHNGNRRWDNLQKRVGAILRRLKHFISQREEFETARDSILVWLTEMDLQLTNIE 270          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 3346.6 bits (8676), Expect = 0.000e+0
Identity = 1711/1733 (98.73%), Postives = 1724/1733 (99.48%), Query Frame = 2
Query: 2951 SQNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDVIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLRTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLXXXXXXXXXXXXXXXXXXXXXXXXXLGLKSNQLCHSSTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLNSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLIGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITXXXXXXXXXXXXNELSDSWKMLRYMAECWIANMQRIVGN 8149
            ++NIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMD+IHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKL TIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNV+TQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEE+LRLIRSEVSFNLSQTISTIYTHPIISKTELINKI PYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNP NQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMK LDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSD+MKSMSDKLNKRHAEWHDVD SIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFID+CRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLK+FRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNIN KIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLK NQLCHS+TSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLL+SVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNL+GIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKE EIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQR++ N
Sbjct: 9517 ARNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDIIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLHTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVKTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEQLRLIRSEVSFNLSQTISTIYTHPIISKTELINKIFPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPSNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKNLDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDEMKSMSDKLNKRHAEWHDVDNSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFIDSCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKEFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINDKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLKINQLCHSTTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLSSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLVGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKESEIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQRVIFN 11249          

HSP 2 Score: 1540.01 bits (3986), Expect = 0.000e+0
Identity = 785/804 (97.64%), Postives = 790/804 (98.26%), Query Frame = 1
Query:    1 ENVLPEDQAKIKSVPFSETKFLNNINEKPITVHSYEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLVVNAYEYTVADKLPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRAMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFEWIVEPDSLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRRDVEKSQNDTDRDNLNVLRKSSIIMTDDGSNASEIYQKDIFXXXXXXXXXXXXXXXDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWKLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEVQVQLLDILNELSDNDRYLFEIFDSEIYEFYKSIXXXXXXXXXXXXQCFSNDANTQTMDRHRDEEEKLEKSIQTYIRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKLGEIDSEMHLL 2412
            ENVLPEDQAKIKSVPFSETKFLNNINEKPIT HS EEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVL VNAYEYTV+DK PTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRR MKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFE IVEPD LLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNR DVEKSQNDTDRDNLN LRKSSIIMTD GSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVW+LLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKE QVQLLDILNELSDNDRYL EIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTY+RDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQK GE+DSEMH +
Sbjct: 8533 ENVLPEDQAKIKSVPFSETKFLNNINEKPITFHSCEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLAVNAYEYTVSDKFPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRTMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFESIVEPDCLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRLDVEKSQNDTDRDNLNALRKSSIIMTDGGSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWQLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEAQVQLLDILNELSDNDRYLSEIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTYVRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKFGEMDSEMHFI 9336          

HSP 3 Score: 363.614 bits (932), Expect = 6.819e-100
Identity = 178/186 (95.70%), Postives = 181/186 (97.31%), Query Frame = 3
Query: 2424 EGFSLEMAQILESNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSHNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKTQSDEVLSVWESLNNKLILNSSKVGYIVTKAR--ISSVKS 2975
            EGFSLEMAQIL+SNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVS NVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRK+QSDEVLSVWESLNNKLILNSSKVGYIVTKAR  IS + S
Sbjct: 9341 EGFSLEMAQILQSNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSPNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKSQSDEVLSVWESLNNKLILNSSKVGYIVTKARNIISQIPS 9526          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 3342.75 bits (8666), Expect = 0.000e+0
Identity = 1711/1733 (98.73%), Postives = 1724/1733 (99.48%), Query Frame = 2
Query: 2951 SQNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDVIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLRTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLXXXXXXXXXXXXXXXXXXXXXXXXXLGLKSNQLCHSSTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLNSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLIGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITXXXXXXXXXXXXNELSDSWKMLRYMAECWIANMQRIVGN 8149
            ++NIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMD+IHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKL TIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNV+TQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEE+LRLIRSEVSFNLSQTISTIYTHPIISKTELINKI PYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNP NQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMK LDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSD+MKSMSDKLNKRHAEWHDVD SIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFID+CRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLK+FRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNIN KIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLK NQLCHS+TSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLL+SVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNL+GIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKE EIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQR++ N
Sbjct: 9707 ARNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDIIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLHTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVKTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEQLRLIRSEVSFNLSQTISTIYTHPIISKTELINKIFPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPSNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKNLDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDEMKSMSDKLNKRHAEWHDVDNSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFIDSCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKEFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINDKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLKINQLCHSTTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLSSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLVGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKESEIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQRVIFN 11439          

HSP 2 Score: 1541.17 bits (3989), Expect = 0.000e+0
Identity = 785/804 (97.64%), Postives = 790/804 (98.26%), Query Frame = 1
Query:    1 ENVLPEDQAKIKSVPFSETKFLNNINEKPITVHSYEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLVVNAYEYTVADKLPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRAMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFEWIVEPDSLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRRDVEKSQNDTDRDNLNVLRKSSIIMTDDGSNASEIYQKDIFXXXXXXXXXXXXXXXDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWKLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEVQVQLLDILNELSDNDRYLFEIFDSEIYEFYKSIXXXXXXXXXXXXQCFSNDANTQTMDRHRDEEEKLEKSIQTYIRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKLGEIDSEMHLL 2412
            ENVLPEDQAKIKSVPFSETKFLNNINEKPIT HS EEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVL VNAYEYTV+DK PTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRR MKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFE IVEPD LLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNR DVEKSQNDTDRDNLN LRKSSIIMTD GSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVW+LLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKE QVQLLDILNELSDNDRYL EIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTY+RDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQK GE+DSEMH +
Sbjct: 8723 ENVLPEDQAKIKSVPFSETKFLNNINEKPITFHSCEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLAVNAYEYTVSDKFPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRTMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFESIVEPDCLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRLDVEKSQNDTDRDNLNALRKSSIIMTDGGSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWQLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEAQVQLLDILNELSDNDRYLSEIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTYVRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKFGEMDSEMHFI 9526          

HSP 3 Score: 363.614 bits (932), Expect = 7.314e-100
Identity = 178/186 (95.70%), Postives = 181/186 (97.31%), Query Frame = 3
Query: 2424 EGFSLEMAQILESNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSHNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKTQSDEVLSVWESLNNKLILNSSKVGYIVTKAR--ISSVKS 2975
            EGFSLEMAQIL+SNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVS NVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRK+QSDEVLSVWESLNNKLILNSSKVGYIVTKAR  IS + S
Sbjct: 9531 EGFSLEMAQILQSNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSPNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKSQSDEVLSVWESLNNKLILNSSKVGYIVTKARNIISQIPS 9716          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 3338.13 bits (8654), Expect = 0.000e+0
Identity = 1711/1740 (98.33%), Postives = 1724/1740 (99.08%), Query Frame = 2
Query: 2951 SQNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDVIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLRTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTELINKISPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPMNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSE-------KFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQXXXXXXXXXARMSVWPQFIDNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLXXXXXXXXXXXXXXXXXXXXXXXXXLGLKSNQLCHSSTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLNSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLIGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITXXXXXXXXXXXXNELSDSWKMLRYMAECWIANMQRIVGN 8149
            ++NIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMD+IHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKL TIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNV+TQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEE+LRLIRSEVSFNLSQTISTIYTHPIISKTELINKI PYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNP NQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMK LDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSD+MKSMSDKLNKRHAEWHDVD SIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSE       KFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFID+CRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLK+FRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNIN KIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLK NQLCHS+TSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLL+SVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNL+GIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKE EIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQR++ N
Sbjct: 9558 ARNIISQIPSCGLKTDIEEFSEKWEYISTQISSGFKDEKNASELLHNFEKQSAQLELHMDIIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSVLTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSSESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKLHTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEINENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKEVIEHMKNLIKSLVNVKTQIKMDVDFMSMWVISIESNLHSECDNHEAILKSIEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKLERYKKELFGMNGLYHRHEEQLRLIRSEVSFNLSQTISTIYTHPIISKTELINKIFPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPSNQNQISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKNLDKYTSKKFQNALSSNGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLLMPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFETIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQHQNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQANLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDKLVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVLDSGTKSRIQDHLQELHEKWCKVSDEMKSMSDKLNKRHAEWHDVDNSIQNLFAWIKEISTFTTSDIPFYEGLNLNLQKSEIIQECLYKFLANLKSSQIIRSELRSKVDNLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFIDSCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDLKSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYESIGSFEEKSSNLKKWMLEMKETLNSPIVLKEFRIDIPIKLLETSKIQLENIQSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINDKIQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKNLDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSKFETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQPKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIVAKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLKINQLCHSTTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLSSVVGDIKSITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLVGIKNYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPNSKSRKSSESIRRESVERRLSLKESEIQQLIPLEQWIKESWSIIEKKADLSNLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNELSDSWKMLRYMAECWIANMQRVIFN 11297          

HSP 2 Score: 1540.78 bits (3988), Expect = 0.000e+0
Identity = 785/804 (97.64%), Postives = 790/804 (98.26%), Query Frame = 1
Query:    1 ENVLPEDQAKIKSVPFSETKFLNNINEKPITVHSYEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLVVNAYEYTVADKLPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRAMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFEWIVEPDSLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRRDVEKSQNDTDRDNLNVLRKSSIIMTDDGSNASEIYQKDIFXXXXXXXXXXXXXXXDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWKLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEVQVQLLDILNELSDNDRYLFEIFDSEIYEFYKSIXXXXXXXXXXXXQCFSNDANTQTMDRHRDEEEKLEKSIQTYIRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKLGEIDSEMHLL 2412
            ENVLPEDQAKIKSVPFSETKFLNNINEKPIT HS EEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVL VNAYEYTV+DK PTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRR MKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFE IVEPD LLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNR DVEKSQNDTDRDNLN LRKSSIIMTD GSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVW+LLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKE QVQLLDILNELSDNDRYL EIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTY+RDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQK GE+DSEMH +
Sbjct: 8574 ENVLPEDQAKIKSVPFSETKFLNNINEKPITFHSCEEFQLFEIPVSMFSEILINGIAMISVTEGQIFELVPGDVLAVNAYEYTVSDKFPTFIIIKPSTINNQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNEPIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKTPIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESMRRTMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQFESIVEPDCLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKARETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDNMPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSRFLILRSGVNSTKLLTHDTLADIEIHMKNRLDVEKSQNDTDRDNLNALRKSSIIMTDGGSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNVSEKSHENDIRQDRVVWQLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMPNDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIINSQMSSVDENKESKEAQVQLLDILNELSDNDRYLSEIFDSEIYEFYKSILNLLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTYVRDESKRVSFLDIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKFGEMDSEMHFI 9377          

HSP 3 Score: 363.614 bits (932), Expect = 7.298e-100
Identity = 178/186 (95.70%), Postives = 181/186 (97.31%), Query Frame = 3
Query: 2424 EGFSLEMAQILESNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSHNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKTQSDEVLSVWESLNNKLILNSSKVGYIVTKAR--ISSVKS 2975
            EGFSLEMAQIL+SNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVS NVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRK+QSDEVLSVWESLNNKLILNSSKVGYIVTKAR  IS + S
Sbjct: 9382 EGFSLEMAQILQSNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFKDYFSNFHIYREALESLRLKVSPNVADRLNNQHLEVIKRSDVLEEQAQEKFLELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKSQSDEVLSVWESLNNKLILNSSKVGYIVTKARNIISQIPS 9567          
BLAST of nesprin-1-like vs. Planmine SMEST
Match: SMESG000016747.1 (SMESG000016747.1)

HSP 1 Score: 181.03 bits (458), Expect = 2.940e-52
Identity = 117/117 (100.00%), Postives = 117/117 (100.00%), Query Frame = 3
Query: 8625 NEFISVDSDIHLRFADKLLSHPIANSNISNTIDNQRLAQGDFSYSMIQSEDSVISSSATWTRKLCXXXXXXXXXXXXXXXXXXXXXXXXXECENNWECSSPLSGVTVKKHWSKSAAI 8975
            NEFISVDSDIHLRFADKLLSHPIANSNISNTIDNQRLAQGDFSYSMIQSEDSVISSSATWTRKLCQSLLISIPIIMLTILLLFLLFMLQPECENNWECSSPLSGVTVKKHWSKSAAI
Sbjct:   18 NEFISVDSDIHLRFADKLLSHPIANSNISNTIDNQRLAQGDFSYSMIQSEDSVISSSATWTRKLCQSLLISIPIIMLTILLLFLLFMLQPECENNWECSSPLSGVTVKKHWSKSAAI 134          
The following BLAST results are available for this feature:
BLAST of nesprin-1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE11.307e-3021.91spectrin repeat containing nuclear envelope protei... [more]
SYNE11.312e-3021.91spectrin repeat containing nuclear envelope protei... [more]
SYNE15.854e-3022.31spectrin repeat containing nuclear envelope protei... [more]
SYNE16.785e-3022.31spectrin repeat containing nuclear envelope protei... [more]
SYNE18.325e-3022.31spectrin repeat containing nuclear envelope protei... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nesprin-1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msp3008.430e-723.79gene:FBgn0261836 transcript:FBtr0303388[more]
Msp3008.577e-723.79gene:FBgn0261836 transcript:FBtr0303385[more]
Msp3008.789e-723.79gene:FBgn0261836 transcript:FBtr0332404[more]
Msp3008.869e-723.79gene:FBgn0261836 transcript:FBtr0332405[more]
Msp3008.939e-723.79gene:FBgn0261836 transcript:FBtr0303389[more]
back to top
BLAST of nesprin-1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syne1a1.652e-3020.57spectrin repeat containing, nuclear envelope 1a [S... [more]
syne1a3.069e-3020.94spectrin repeat containing, nuclear envelope 1a [S... [more]
syne1b2.013e-2119.19spectrin repeat containing, nuclear envelope 1b [S... [more]
syne1b2.013e-2119.19spectrin repeat containing, nuclear envelope 1b [S... [more]
syne2b3.128e-2021.16spectrin repeat containing, nuclear envelope 2b [S... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE13.216e-2920.65spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE14.964e-2920.65spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE15.328e-2920.65spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE15.439e-2920.65spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE15.842e-2920.65spectrin repeat containing, nuclear envelope 1 [So... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syne11.421e-3220.16spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne26.910e-2320.00spectrin repeat containing, nuclear envelope 2 [So... [more]
Syne28.953e-2320.00spectrin repeat containing, nuclear envelope 2 [So... [more]
Syne22.444e-2219.86spectrin repeat containing, nuclear envelope 2 [So... [more]
Syne22.592e-2219.86spectrin repeat containing, nuclear envelope 2 [So... [more]
back to top
BLAST of nesprin-1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6ZWR6|SYNE1_MOUSE1.236e-3120.16Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 S... [more]
sp|Q8NF91|SYNE1_HUMAN3.998e-2922.31Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV... [more]
sp|Q8WXH0|SYNE2_HUMAN1.294e-2320.48Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV... [more]
sp|Q6ZWQ0|SYNE2_MOUSE1.710e-2119.86Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 S... [more]
back to top
BLAST of nesprin-1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HP042.151e-4423.35nesprin-1-like isoform X3 OS=Lingula unguis OX=757... [more]
A0A1S3HMH32.234e-4423.35nesprin-1-like isoform X1 OS=Lingula unguis OX=757... [more]
A0A2R2MSC62.547e-4423.35nesprin-1-like isoform X2 OS=Lingula unguis OX=757... [more]
A0A2R2MQ628.644e-4124.86nesprin-1-like OS=Lingula unguis OX=7574 GN=LOC112... [more]
A0A210QXB75.857e-3622.48Nesprin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
syne1a7.122e-2619.87spectrin repeat containing, nuclear envelope 1a [S... [more]
syne1b1.375e-2019.19spectrin repeat containing, nuclear envelope 1b [S... [more]
syne2b4.882e-1021.02spectrin repeat containing, nuclear envelope 2b [S... [more]
ENSAMXT00000054961.17.584e-719.12pep primary_assembly:Astyanax_mexicanus-2.0:3:6114... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009426.11.036e-3218.14pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1... [more]
ENSPMAT00000010752.11.793e-718.14pep scaffold:Pmarinus_7.0:GL476415:502507:525271:-... [more]
back to top
BLAST of nesprin-1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nesprin-1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of nesprin-1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
syne2b2.831e-1021.48spectrin repeat containing, nuclear envelope 2b [S... [more]
ENSORLT00000040222.14.002e-919.71pep primary_assembly:ASM223467v1:24:8953331:896105... [more]
back to top
BLAST of nesprin-1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016745.16.819e-10098.73SMESG000016745.1[more]
SMESG000016745.17.314e-10098.73SMESG000016745.1[more]
SMESG000016745.17.298e-10098.33SMESG000016745.1[more]
SMESG000016747.12.940e-52100.00SMESG000016747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013676 ID=SMED30013676|Name=nesprin-1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=9012bp
GAGAATGTTTTACCTGAAGATCAAGCAAAAATTAAAAGTGTACCATTCTC
TGAAACAAAGTTCCTTAATAATATTAATGAAAAACCCATAACGGTTCACT
CATACGAGGAATTTCAGTTGTTTGAAATTCCAGTGAGTATGTTCAGTGAG
ATTTTAATTAATGGTATTGCTATGATTTCTGTGACAGAAGGTCAGATATT
TGAATTGGTTCCCGGTGATGTATTGGTGGTGAATGCCTACGAATACACAG
TTGCCGATAAGTTGCCAACGTTCATTATCATTAAACCAAGTACGATAAAC
AATCAGCTCACAATGTCTACGGTTGAGAAGTGTCGAATTTCCGTTGAGCG
TCCAGTTAAAATCGAAATCGACGATTTTAATATCCCTGAAGGCGGCGGTC
CAGAATTATTAGTGGTATCCCCTGGACAGAAACTCGTCATTAATAATGAA
CCGATTGCGTTATTGGATACTAAATATTGTGTAATTGAAATTACCGACCC
TGAATGGAACATAGCATGTATTTGGCAAGATCAGATCCAAACATTGATGA
TTAATGAAGTTCCGATTCCTCAAAGTCATGAGCCAAAAACATTCAAGACC
CCGATTGTCATTGACAACAAAATTGAATTATTCAAAATAGAAAAAAATAT
TTGCGATAAAGTCGCTGTAATACCTTTCAACTTATTCAAATGTAACAAGT
GCTCGGTGCTGAATGTCGTTGAAGGTTTCCTGGTGTCAACCGAATCCATG
AGAAGGGCTATGAAACCCGATGACATGATTTTGATCCATGATGTCTCTTC
ATTTACTGTAAATGATGTTACTACTTACCGTTTGGAGGACATGGAGTCAG
TTGTGATCCTTTGCAATGGATCTTTGCCTCTATCAATGGAGTTCCAGCAG
TTTGAGTGGATTGTAGAACCAGATAGTCTATTGCCCGGTATAATCCAATC
CGACGATCAGAGGGCCGGCAATGCGTCTCCGCCTGGATTATTAGCCGACT
ACAATGGTAAACCGATGGATATTACCGAAGATGTTATTCAGAAAGCCAGA
GAAACCGTTGAAAGAATCAGCAACAGACAAAAGGGCAAGGAACTACAAAA
TGAAACCAATGAAATAGTCATAGATCTGAATGAGCTTGAGGAATGGATTG
ACACAATAAACCAGTTATTAGCATCTCTTTCTCCAGCTGAAATCGACAAC
ATGCCAGCTTTAGAAAAGAAGAAATCTCAGATAAATGAGATCATTGAGGA
GGTTGATTGCAAAACTGGTGATTTGGAATCACTGGAAGTCAAATTAGAAC
AGCATTCCGATACTTTAGAAGAGTCGTTATCGGTTCCTTTAAGATCACGA
TTCTTAATATTGAGATCTGGGGTTAATTCTACGAAGCTTTTGACCCATGA
CACATTAGCTGACATTGAAATTCATATGAAAAATCGACGCGATGTTGAGA
AAAGTCAAAACGATACAGATCGAGATAATTTGAATGTCCTCAGAAAATCC
TCCATTATAATGACGGATGACGGATCAAACGCTTCGGAAATTTATCAGAA
AGATATATTTCAAGAATTGTCCAATAACTTACTGACATCGCAGAATTTGT
TGGAAGACCTTAAACGAAATGCAGAAATAGTTGATATCCCGAAAAATGTT
AGTGAGAAAAGTCACGAAAACGATATTCGGCAAGATCGCGTGGTTTGGAA
ACTTCTTCTGTCTCGGTGCAAAACTCGATACCGAGAGATCAAAGACAAAA
GTAGCAGTCGAATTTGGAAGAGATTATCTCCATCGTTTTTGGTAATGCCC
AACGACCAAAATGTTAATTCGTTACCGGCTATAAAAGAAAAGGTTGAACA
TCTTTTTGATCGTATCAAAGAAAAATCGAACAAAGATGTTATTAGTGTGA
TGAAGTTGATTGAATCAGCATCTCAAATCATAGAAAACAAGATTATCAAT
AGCCAGATGTCCTCTGTGGACGAAAATAAGGAAAGCAAGGAAGTTCAAGT
TCAGTTGCTAGATATTCTCAATGAGCTCTCAGATAATGATAGATATTTAT
TCGAAATTTTCGATTCGGAAATCTATGAATTCTACAAATCTATTCTAAAT
CTGTTGAAAGACAGATTGAAATTGTTAGACCAGTGTTTCTCCAATGACGC
AAACACCCAGACGATGGATCGGCATCGGGATGAAGAGGAAAAGCTAGAAA
AATCCATACAAACGTACATTAGAGACGAATCAAAACGAGTGTCATTTCTC
GATATTGATAGCGATAAAGTCAAAAAAATTGACTGTCATAAAACGGAATA
TTGTGATAAATTATCGGAACTGTTGAGGAAGAGCTATGACCTTCGGGCAA
GTAATCCCAATGATTTCGATTTGCAGAAATTGGGAGAAATTGATTCTGAA
ATGCACTTATTGCTTTGAACTTGGAAGGATTCAGTCTGGAAATGGCTCAG
ATTCTTGAAAGCAATTATCAATATGAGCAATTGCTGAATAATTACAGTCA
GTTTTTGTTGACTGGAACCTTCAAATTGTGCGGTAAATTCATGACAGTAA
AAGATTTTACCGACATGAGAATCCGAGTTATTCAATTCAAGGATTATTTT
AGCAATTTCCATATATATCGAGAGGCACTTGAATCTTTAAGGCTGAAAGT
TTCCCATAACGTAGCCGACAGGTTAAACAATCAGCATTTGGAAGTTATAA
AACGAAGTGATGTTTTGGAAGAACAGGCCCAGGAAAAATTTTTAGAATTG
TTACACACTCTTTATGATTGGTCAGAATTCGAACGGAACTTCATAGAATT
GCAAAGCTGCTTGATAACTATGGAGAAAAGCATTAATGATATTAAGAAAG
ATGATAGAAAAACCCAATCGGATGAAGTTCTGTCCGTCTGGGAATCGTTG
AATAATAAATTAATATTGAATTCATCAAAGGTTGGCTACATTGTCACTAA
AGCCAGAATATCATCAGTCAAATCCCAAGTTGTGGTTTGAAGACTGATAT
AGAGGAGTTTTCTGAAAAATGGGAATATATAAGTACACAAATCTCTTCGG
GTTTCAAAGATGAAAAGAATGCCTCTGAATTATTGCATAATTTTGAAAAA
CAATCTGCACAGCTCGAACTTCACATGGACGTTATCCATGATATTATTAT
GGAGATAGAGGAACAACTTCAAATTGATAGCATAGTTAGTTTCCAAAATA
TTACTCAACGACAGTTAAATATATTTCATCTCAAAGAACGATTTTATCGT
GAAGAAAATCTCAAGAAATCCGTCTTGACTATTGGGGACAACTTATTAAA
AACCAAGAGATACAATTTGACACAACTTAATCGTAAATTATGCTCTTTGG
AAAACAAATGGGAAGCAATCTCTGATAAGATAAGGGATTTAGAGGAAATA
TCTATGAGTCCAGTATTCTCATCGGAATCTTTTGAGATTCCTCGAGAGGA
CATCAAATCTTTGGTTAGATCTATTGATATGTCATTGGAAAAATTGAGAT
CCGAAACCAACATCAGAAATTTGTCTGATCTGGAAACATTTGACGAACAC
TTGAAATTTTTGAATTTAAAATTGCGTACAATTGAGCCGTTGGTTGATTT
GTATTGTCAACGGGACACTGGATTTCAATCAAATTTCATAAGTGAAGGAA
TGACAAAGAGATCTAAAGATATTCATGATCTAAGTGATGAAAGTAAAGAG
CTGCATGCAATAATCAACGAAATAAATGAAAATTCTCTTAAAGTCAACGG
CTGGATTTCTTCTCAGTCTGTTGAATGCCAAAACATTGTTAAAAATTTAA
ACTCAAAAATGAATCTCAAACTTGGTGCGACAAAATTAAAGTCATTTCAA
GAGACCTCTAATCATCATAAGGAAGTCATTGAACACATGAAGAACTTAAT
AAAGTCTCTCGTTAATGTGAGAACTCAGATAAAAATGGATGTGGATTTCA
TGTCTATGTGGGTGATTTCTATTGAAAGTAATTTGCACTCTGAATGCGAT
AATCATGAAGCCATTTTGAAATCAATTGAAGTGCTTAATCAATATTGGAT
GGAGTTGGAAAAATCAGAGTTGAGAGTTTTGGAATTGGAGATTGATATCG
ATCATTTTATTGGTGAATCGAAATCATTGATCTTTAGCACATTGAATTGT
GTGAAGTTTCATTTGGAAAAGCTCGAACGCTACAAAAAAGAATTATTTGG
AATGAACGGTCTGTATCATAGGCATGAAGAAAAATTGAGATTAATCAGGT
CGGAAGTGAGTTTTAACCTCAGTCAAACGATCAGCACAATTTACACACAT
CCCATCATTAGTAAAACAGAATTAATAAATAAAATTTCCCCCTATTCTAA
TCACTTACTCGACCTGTATGAGCATTGGGAACTGTTTAATGGCAACATGA
AAAGAATCGTTCACAATTTTGAACAAATGGAGTCAGTAATAATCGACTGT
TTCAATCCAATGAATCAGAACCAAATCTCCGATTTTCCGTCCCATCTCAA
CAGCATTGAATCTATGATCAAAGATTCACAGAATTTTGCTAATAAATTAA
ATGGCCAATCTGAATATTTAATGAAAATTTTAGATAAATATACAAGTAAG
AAGTTCCAAAACGCCTTATCATCGAATGGGCATCGGTTGAATAGGATTAA
AAGGTTCAGAGATACATTGAAAACTAAGTTTTATAAGAATGGCAATGATA
TGCGATTTTTTTATTTACATTGTCAAAGGATGGAAAAAATTAATAATGAG
GTTGATATGTCGTTGAGTTTGTTAATGCCTTCAATTGCATTGGGTTCGTC
ATCTTTTGATCACGATATTTGTGAGTTATTGAGGGAGATTGTCGAGTCTC
GTCGAGACATCAATGAAATCAAATCCATCTCTCACAGATTTCACATGGAT
CAAGCCAGCTCAAAACGTTTCGAGACCATTGTTACTCATCGGACCGTGAT
AATTAATAAAATCATTCAAGCCATTCAGGATAGAGATCTTGAAAATTGTT
CAAAACTGGAATTTATCGCTCTCTGTAATTATTGTATGGACTTTCTGAGA
TTCTTGCAGCCACAATTGCAGCATCAGAACTTCCAAAACTATGATGAAGT
CGTTGAGATGCAGCTTTGTTTTGAGTTTCTCCACTTTCTTCTCCATCCGA
AAGAGTCGTTGTTTTTGATTTTGATTGGAAAAGGAAACTTGAACGAAAAT
GAAAACTGTGGCCATTTCCAGGCAAATCTCAATGACCTGAAATTCCAATG
GGAAAAAATCACGGAACATATTAATAACTCTAAACGATATCTCGACAAGC
ACGTATCAAATTATCTGGAATTCATGGGAAAACTCGAATTGTTTCATGTT
TGGTGTGATAATCTCACAGACAAGCTTGTAGATTTTCAATCTGAAATCTG
GTCGGTGGATGAAATGAACCATTTGCAGTGGCGCCTGGCGATATTTGCCC
AAGAACGCGATGCTCACATCTCTGTCTATGAAGCTTGCATGGCGACCGGA
GAAAGCTTGTACCGAACGGTATTAGACAGCGGCACCAAATCCCGAATTCA
AGACCACCTTCAAGAATTGCACGAGAAATGGTGCAAAGTATCCGATCAAA
TGAAATCAATGAGTGATAAATTAAATAAACGGCACGCCGAATGGCATGAC
GTTGATAAGAGTATTCAGAATCTTTTTGCTTGGATTAAAGAAATCAGCAC
ATTTACAACTTCGGATATTCCTTTCTACGAGGGTCTCAATCTCAATTTGC
AGAAATCTGAGAAATTCTTGGCTAACCTGAAATCATCTCAAATCATTCGG
TCAGAACTACGAAGCAAAGTGGACAATTTGGTGCGCTATTTGAGTCCGGA
TGACATAACGATTCTATTTGATCGGATCTACTTGATTGATAAGCAGTGCT
ATGAACTCGTTGTTCAAATTGAGATCCGGCGTCGGGAAATCGAGGCTAGA
ATGAGTGTTTGGCCCCAGTTTATCGATAATTGTAGAAAATTGACTTCGGA
AGTCTCTGAAATTTTGACAATGTTAGAAAGTAAAGAAGTTTATCAAGTTG
ATGAAATGATGGATAAATTGGAATCTGAAATCATTCCAACAATCAAGGAT
TATAAATCGAAATTCGAAGATCTCAAATCCCAGGGACTTGATATTCAAGA
GAAGTCAGGAGAAGATCGGTCGAAGGACATAACTTATAGATTGCAAAAGT
TCGACGATATCTGGAACAGAGCTCAATTATTAGCTAATAATAAATTGAAA
GAACTTCATGAAATCTACGAGTCGATTGGAAGCTTTGAAGAGAAATCGAG
CAATTTGAAAAAGTGGATGTTGGAAATGAAAGAAACGTTAAATAGCCCAA
TTGTGTTGAAAAAATTCCGCATTGATATTCCGATAAAATTGCTGGAAACA
AGCAAAATTCAATTAGAAAACATCCAATCTCACAGTGGAGATGTCAGATC
GGTGTTGTTGCTCTGTAATTTGCTTATGCGCAACGTTGACGCGTGTCCCA
ATCGCAGCGATAAAGAGAAAATTTCCGAAACGAGAAAGAAATTGAAAAAA
CGCTGGGATAATATTAATTATAAAATACAATGGAAAATATCCAAACTCAA
TGAACTGATCCCTCTGTGGAGAATGATGGACATAAAACTAACCGAAACTG
ACCATTTCATAAACCAAATTGATGGCCGGCTGAATAGCCTCGTTGCAAAC
ATTGAGACAAATCCTGACAAAAATCTAGATAAAATTCAAGCTTTGAAAAT
TGACATTACTGAGTACGAGCTGGAAATGAGAAATCTTTTGGAAACCTACC
AAACGATGACAACTCAAGACCAGTTGGACAGTCGAGGAGAAATTGATTGT
CAAATGAAAGGGTTGTTAAGTAAATTCGAAACAATTCAAGAGGAAGTCTC
AGTGTTGGACACCCAAATGCGCCAATTGGCCACCGTAAAGACACAACTGA
ATAGCTGTTGTGAAACTATCAAATCGTGGATAGCTGACGTGGATAAGGAG
ATAGATATGATGGAAATTAATCAACCGAAAAATATCGAAACTCGAAAATT
GGAGCTCCAGGATATTAAAAGCCAGTTTCTTAATCAGTTAAAATATTTGA
AAGATATTGAAATCGAGTCGAAAATTATTTTGAATAACTCTCAATCAGAC
TCTGTCCACTTTTCCGACATCGTTGCGAAAATGAAAGAGAGTGAAAATGC
AATTCATAATTTGTCAATAAGATTGAGAGATAGCATTCGGTCTGGGTCGA
GAAAAAGTTCTCGTAGTGAAGCTGGATCGAGGGCCAGTGCTCAATCATCT
CTTGGTTTAAAGAGCAACCAATTGTGCCATTCATCCACTTCAATAGGGGT
TTCCGATCCAAATAAAAAGGTAAGCAGCCTTGTTCGAGAATTGAACTCTA
ATATTATTGGAGTTGAACAATATTTGCAATGGACCAATAATTTATTAAAC
TCTGTTGTCGGTGACATCAAGTCCATTACATTTGAAGAATCTTTGGATAA
TAATAAAAATTTTAACTCCTTCGTTGATCTGATTGTTGCTAGTCGGTATA
AGGTAGATCTGGTTAAAGGTTTTAGTGAAGAAATACAGCAAATGATACAT
AACCATAATCTGATAGGTATTAAGAATTATTCACCTGAAGCTGTGGAAGA
TATTCAAGTTCGGTGGAAATCCTTGTACGATTTATGTGTGGAAAGAGACA
AAATATATTCAACTGAAATACCTGTTTTGTTAGCTAACACTGACGACAAG
GAAAGCGCTTTATTGTCACCTAACTCCAAATCAAGGAAATCGAGTGAATC
TATTCGTCGAGAATCTGTAGAAAGAAGACTCAGTTTAAAAGAATTGGAAA
TTCAACAACTTATCCCTTTGGAGCAATGGATCAAAGAGTCGTGGTCTATC
ATTGAAAAGAAAGCTGATCTGTCTAATCTCAGTCGAATTTGTAAAACCGG
TTTGCCACCAATTCAATCAGAACTAGAATCATTGAGATTGTTTTTAAATG
GCTATAAAAATTGGAATTTCGCCTATATTACAGTTGTTAGTTCTCCAAGA
GTATCTCCGTCGAAATCAAATGAATTGTCGGACTCCTGGAAAATGTTGCG
ATACATGGCTGAGTGTTGGATTGCTAACATGCAAAGGATTGTTGGCAACT
CTGCTGACATTCACCGAGAACTGAACCGAATCACAGATCAGATCCGATCA
TTGAAAAATGAATCAAGAAATATCCATTCCATTACAGATGGGTTCATTGA
TCAGTTCGAGGACGTGAAAAATGGCCAAGTTTATTGGAAGACTCAAATCG
AGCCAATATCCAGTAATAATAGCCACAACTTAATTTTGGACCGAAAATTA
ACGGAAAAAATGAACAAATTCATGAAAGATTTGATTCATCTTGACAGTTT
GATTCTCAGGATCTCCCAGGCGATTATTGAGTCTGATAATTTGAATATTC
ATGGCTATACAATCAAAAGCTCGACTCCTATCCAAATTGAGTATGATGCC
GAAACGACTGCTCCGTTTCCAACGTCTGCGTCTTTCAGTGATGATGAGGA
TGATTTAGCTAATGATTCTAGTCGTATGGTTCCATCTATAAGTAGTTTTG
AACAGCCTTATGTCCCGATGTTGCAATGAATTCATTTCTGTCGATTCAGA
CATCCATCTGCGTTTTGCAGATAAACTCTTATCTCATCCGATTGCTAATT
CTAACATTTCTAACACTATTGACAACCAACGCTTGGCTCAGGGTGATTTC
TCATATTCCATGATCCAATCAGAGGATTCAGTCATATCCAGCTCGGCAAC
TTGGACAAGGAAATTGTGCCAGAGTTTGCTTATATCAATTCCTATTATTA
TGCTCACTATATTATTGTTGTTCCTCCTCTTTATGCTCCAGCCGGAATGC
GAAAACAACTGGGAGTGCTCCTCCCCATTGTCGGGAGTCACCGTGAAAAA
GCATTGGTCTAAATCGGCGGCAATATAAAAAATCTATCATTGGCTTTTGA
TGATTATTTATG
back to top

protein sequence of SMED30013676-orf-1

>SMED30013676-orf-1 ID=SMED30013676-orf-1|Name=SMED30013676-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MSRCCNEFISVDSDIHLRFADKLLSHPIANSNISNTIDNQRLAQGDFSYS
MIQSEDSVISSSATWTRKLCQSLLISIPIIMLTILLLFLLFMLQPECENN
WECSSPLSGVTVKKHWSKSAAI*
back to top

protein sequence of SMED30013676-orf-2

>SMED30013676-orf-2 ID=SMED30013676-orf-2|Name=SMED30013676-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MAQILESNYQYEQLLNNYSQFLLTGTFKLCGKFMTVKDFTDMRIRVIQFK
DYFSNFHIYREALESLRLKVSHNVADRLNNQHLEVIKRSDVLEEQAQEKF
LELLHTLYDWSEFERNFIELQSCLITMEKSINDIKKDDRKTQSDEVLSVW
ESLNNKLILNSSKVGYIVTKARISSVKSQVVV*
back to top

protein sequence of SMED30013676-orf-3

>SMED30013676-orf-3 ID=SMED30013676-orf-3|Name=SMED30013676-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=806bp
ENVLPEDQAKIKSVPFSETKFLNNINEKPITVHSYEEFQLFEIPVSMFSE
ILINGIAMISVTEGQIFELVPGDVLVVNAYEYTVADKLPTFIIIKPSTIN
NQLTMSTVEKCRISVERPVKIEIDDFNIPEGGGPELLVVSPGQKLVINNE
PIALLDTKYCVIEITDPEWNIACIWQDQIQTLMINEVPIPQSHEPKTFKT
PIVIDNKIELFKIEKNICDKVAVIPFNLFKCNKCSVLNVVEGFLVSTESM
RRAMKPDDMILIHDVSSFTVNDVTTYRLEDMESVVILCNGSLPLSMEFQQ
FEWIVEPDSLLPGIIQSDDQRAGNASPPGLLADYNGKPMDITEDVIQKAR
ETVERISNRQKGKELQNETNEIVIDLNELEEWIDTINQLLASLSPAEIDN
MPALEKKKSQINEIIEEVDCKTGDLESLEVKLEQHSDTLEESLSVPLRSR
FLILRSGVNSTKLLTHDTLADIEIHMKNRRDVEKSQNDTDRDNLNVLRKS
SIIMTDDGSNASEIYQKDIFQELSNNLLTSQNLLEDLKRNAEIVDIPKNV
SEKSHENDIRQDRVVWKLLLSRCKTRYREIKDKSSSRIWKRLSPSFLVMP
NDQNVNSLPAIKEKVEHLFDRIKEKSNKDVISVMKLIESASQIIENKIIN
SQMSSVDENKESKEVQVQLLDILNELSDNDRYLFEIFDSEIYEFYKSILN
LLKDRLKLLDQCFSNDANTQTMDRHRDEEEKLEKSIQTYIRDESKRVSFL
DIDSDKVKKIDCHKTEYCDKLSELLRKSYDLRASNPNDFDLQKLGEIDSE
MHLLL*
back to top

protein sequence of SMED30013676-orf-4

>SMED30013676-orf-4 ID=SMED30013676-orf-4|Name=SMED30013676-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1835bp
MDVIHDIIMEIEEQLQIDSIVSFQNITQRQLNIFHLKERFYREENLKKSV
LTIGDNLLKTKRYNLTQLNRKLCSLENKWEAISDKIRDLEEISMSPVFSS
ESFEIPREDIKSLVRSIDMSLEKLRSETNIRNLSDLETFDEHLKFLNLKL
RTIEPLVDLYCQRDTGFQSNFISEGMTKRSKDIHDLSDESKELHAIINEI
NENSLKVNGWISSQSVECQNIVKNLNSKMNLKLGATKLKSFQETSNHHKE
VIEHMKNLIKSLVNVRTQIKMDVDFMSMWVISIESNLHSECDNHEAILKS
IEVLNQYWMELEKSELRVLELEIDIDHFIGESKSLIFSTLNCVKFHLEKL
ERYKKELFGMNGLYHRHEEKLRLIRSEVSFNLSQTISTIYTHPIISKTEL
INKISPYSNHLLDLYEHWELFNGNMKRIVHNFEQMESVIIDCFNPMNQNQ
ISDFPSHLNSIESMIKDSQNFANKLNGQSEYLMKILDKYTSKKFQNALSS
NGHRLNRIKRFRDTLKTKFYKNGNDMRFFYLHCQRMEKINNEVDMSLSLL
MPSIALGSSSFDHDICELLREIVESRRDINEIKSISHRFHMDQASSKRFE
TIVTHRTVIINKIIQAIQDRDLENCSKLEFIALCNYCMDFLRFLQPQLQH
QNFQNYDEVVEMQLCFEFLHFLLHPKESLFLILIGKGNLNENENCGHFQA
NLNDLKFQWEKITEHINNSKRYLDKHVSNYLEFMGKLELFHVWCDNLTDK
LVDFQSEIWSVDEMNHLQWRLAIFAQERDAHISVYEACMATGESLYRTVL
DSGTKSRIQDHLQELHEKWCKVSDQMKSMSDKLNKRHAEWHDVDKSIQNL
FAWIKEISTFTTSDIPFYEGLNLNLQKSEKFLANLKSSQIIRSELRSKVD
NLVRYLSPDDITILFDRIYLIDKQCYELVVQIEIRRREIEARMSVWPQFI
DNCRKLTSEVSEILTMLESKEVYQVDEMMDKLESEIIPTIKDYKSKFEDL
KSQGLDIQEKSGEDRSKDITYRLQKFDDIWNRAQLLANNKLKELHEIYES
IGSFEEKSSNLKKWMLEMKETLNSPIVLKKFRIDIPIKLLETSKIQLENI
QSHSGDVRSVLLLCNLLMRNVDACPNRSDKEKISETRKKLKKRWDNINYK
IQWKISKLNELIPLWRMMDIKLTETDHFINQIDGRLNSLVANIETNPDKN
LDKIQALKIDITEYELEMRNLLETYQTMTTQDQLDSRGEIDCQMKGLLSK
FETIQEEVSVLDTQMRQLATVKTQLNSCCETIKSWIADVDKEIDMMEINQ
PKNIETRKLELQDIKSQFLNQLKYLKDIEIESKIILNNSQSDSVHFSDIV
AKMKESENAIHNLSIRLRDSIRSGSRKSSRSEAGSRASAQSSLGLKSNQL
CHSSTSIGVSDPNKKVSSLVRELNSNIIGVEQYLQWTNNLLNSVVGDIKS
ITFEESLDNNKNFNSFVDLIVASRYKVDLVKGFSEEIQQMIHNHNLIGIK
NYSPEAVEDIQVRWKSLYDLCVERDKIYSTEIPVLLANTDDKESALLSPN
SKSRKSSESIRRESVERRLSLKELEIQQLIPLEQWIKESWSIIEKKADLS
NLSRICKTGLPPIQSELESLRLFLNGYKNWNFAYITVVSSPRVSPSKSNE
LSDSWKMLRYMAECWIANMQRIVGNSADIHRELNRITDQIRSLKNESRNI
HSITDGFIDQFEDVKNGQVYWKTQIEPISSNNSHNLILDRKLTEKMNKFM
KDLIHLDSLILRISQAIIESDNLNIHGYTIKSSTPIQIEYDAETTAPFPT
SASFSDDEDDLANDSSRMVPSISSFEQPYVPMLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR020559PRibGlycinamide_synth_CS
IPR018159Spectrin/alpha-actinin
Vocabulary: molecular function
TermDefinition
GO:0004637phosphoribosylamine-glycine ligase activity
GO:0003723RNA binding
GO:0003779actin binding
GO:0005515protein binding
GO:0005521lamin binding
GO:0019899enzyme binding
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0051015actin filament binding
Vocabulary: biological process
TermDefinition
GO:0009113purine nucleobase biosynthetic process
GO:0006997nucleus organization
GO:0007030Golgi organization
GO:0007283spermatogenesis
GO:0030154cell differentiation
GO:0042692muscle cell differentiation
GO:0090286cytoskeletal anchoring at nuclear membrane
GO:0090292nuclear matrix anchoring at nuclear membrane
Vocabulary: cellular component
TermDefinition
GO:0000932P-body
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005640nuclear outer membrane
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030017sarcomere
GO:0031965nuclear membrane
GO:0034993LINC complex
GO:0045211postsynaptic membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 424..444
NoneNo IPR availableCOILSCoilCoilcoord: 721..741
NoneNo IPR availableCOILSCoilCoilcoord: 338..358
NoneNo IPR availableCOILSCoilCoilcoord: 519..539