Hox class homeodomain protein DjAbd-Bb

Overview
NameHox class homeodomain protein DjAbd-Bb
Smed IDSMED30013674
Length (bp)1766
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hox class homeodomain protein DjAbd-Bb (SMED30013674) t-SNE clustered cells

Violin plots show distribution of expression levels for Hox class homeodomain protein DjAbd-Bb (SMED30013674) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hox class homeodomain protein DjAbd-Bb (SMED30013674) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hox class homeodomain protein DjAbd-Bb (SMED30013674) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013674

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013674SMESG000033048.1 SmedASXL_008593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30013674SMESG000033048.1 SmedASXL_008593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
tail regionSMED30013674SMESG000033048.1 SmedASXL_008593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30013674SMESG000033048.1 SmedASXL_008593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30013674SMESG000033048.1 SmedASXL_008593SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30013674SMESG000033048.1 SMED30013674smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013674SMESG000039065.1 Contig4363GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013674SMESG000033048.1 Contig48361uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013674SMESG000033048.1 Contig48361newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013674SMESG000033048.1 Contig4363GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30013674SMESG000033048.1 dd_Smed_v6_9061_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30013674SMESG000033048.1 dd_Smed_v6_9061_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30013674SMESG000033048.1 dd_Smed_v4_9061_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Match: HOXC12 (homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124])

HSP 1 Score: 88.5817 bits (218), Expect = 7.767e-19
Identity = 40/64 (62.50%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            RSRKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  213 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 276          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Match: HOXD12 (homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135])

HSP 1 Score: 86.6557 bits (213), Expect = 2.513e-18
Identity = 40/67 (59.70%), Postives = 53/67 (79.10%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            A  R+RKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L+LS++QVK+WFQNRRMKKK++  R+
Sbjct:  198 APGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVLRE 264          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Match: HOXA10 (homeobox A10 [Source:HGNC Symbol;Acc:HGNC:5100])

HSP 1 Score: 81.2629 bits (199), Expect = 3.474e-18
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
             RKKR PYT++QT+ LE EF  N Y+TR++R EIS  +HL++RQVK+WFQNRRMK KK+
Sbjct:   20 GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 78          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Match: HOXB9 (homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120])

HSP 1 Score: 85.1149 bits (209), Expect = 7.352e-18
Identity = 39/59 (66.10%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            SRKKR PYT+YQT+ LE EF  N Y+TR +R E++  L+LSERQVK+WFQNRRMK KK+
Sbjct:  185 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKM 243          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Match: AC004080.3 (HOXA10-HOXA9 readthrough)

HSP 1 Score: 80.8777 bits (198), Expect = 8.045e-18
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            +RKKR PYT++QT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK+
Sbjct:   46 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 104          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 96.6709 bits (239), Expect = 4.209e-22
Identity = 46/80 (57.50%), Postives = 57/80 (71.25%), Query Frame = 3
Query: 1200 LLDSGSL--TEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPG 1433
            L D G L  T +    RKKRKPYT+ QT+ LE EF  N Y+++QKRWE++  LHL+ERQVK+WFQNRRMK KK + R  G
Sbjct:  184 LNDGGQLEWTSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQRTSG 263          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 96.6709 bits (239), Expect = 4.209e-22
Identity = 46/80 (57.50%), Postives = 57/80 (71.25%), Query Frame = 3
Query: 1200 LLDSGSL--TEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPG 1433
            L D G L  T +    RKKRKPYT+ QT+ LE EF  N Y+++QKRWE++  LHL+ERQVK+WFQNRRMK KK + R  G
Sbjct:  184 LNDGGQLEWTSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKKQKQRTSG 263          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 81.6481 bits (200), Expect = 1.575e-17
Identity = 41/81 (50.62%), Postives = 55/81 (67.90%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTVHENNIQ 1481
            S++ R+ Y+R QT+ LE EF  + Y+TR++R EIS  LHL+ERQVK+WFQNRRMK KK    + GS +   +S   E N Q
Sbjct:  117 SKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAKGEGGSNESDEESNQDEQNEQ 197          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Match: nob-1 (KNOB-like posterior (NO Backside) [Source:UniProtKB/TrEMBL;Acc:G5EFY5])

HSP 1 Score: 76.6406 bits (187), Expect = 2.055e-15
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPG 1433
             +KKR+PY + Q   LE E++ N Y+T ++R E+S +L L E+QVKVWFQNRRMK KKL+ R  G
Sbjct:  162 GKKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLRQRHSG 226          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Match: nob-1 (KNOB-like posterior (NO Backside) [Source:UniProtKB/TrEMBL;Acc:G5EFY5])

HSP 1 Score: 72.0182 bits (175), Expect = 2.442e-15
Identity = 35/65 (53.85%), Postives = 47/65 (72.31%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPG 1433
             +KKR+PY + Q   LE E++ N Y+T ++R E+S +L L E+QVKVWFQNRRMK KKL+ R  G
Sbjct:   11 GKKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRMKDKKLRQRHSG 75          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0346764)

HSP 1 Score: 91.6633 bits (226), Expect = 3.531e-20
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  160 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083381)

HSP 1 Score: 91.2781 bits (225), Expect = 4.048e-20
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  160 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083382)

HSP 1 Score: 91.2781 bits (225), Expect = 4.048e-20
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  160 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0415465)

HSP 1 Score: 91.2781 bits (225), Expect = 4.048e-20
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  160 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Match: Abd-B (gene:FBgn0000015 transcript:FBtr0083385)

HSP 1 Score: 91.2781 bits (225), Expect = 4.048e-20
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  160 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 221          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Match: hoxd12a (homeobox D12a [Source:NCBI gene;Acc:100006598])

HSP 1 Score: 88.9669 bits (219), Expect = 3.029e-19
Identity = 41/67 (61.19%), Postives = 54/67 (80.60%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            +++RSRKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  205 SQVRSRKKRKPYTKPQLTELENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMRE 271          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Match: hoxd12a (homeobox D12a [Source:NCBI gene;Acc:100006598])

HSP 1 Score: 88.5817 bits (218), Expect = 3.462e-19
Identity = 41/67 (61.19%), Postives = 54/67 (80.60%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            +++RSRKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  190 SQVRSRKKRKPYTKPQLTELENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMRE 256          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Match: hoxc12a (homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6])

HSP 1 Score: 86.6557 bits (213), Expect = 1.827e-18
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            R+RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  205 RTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 268          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Match: hoxb9a (homeobox B9a [Source:NCBI gene;Acc:30344])

HSP 1 Score: 85.5001 bits (210), Expect = 3.265e-18
Identity = 39/64 (60.94%), Postives = 50/64 (78.12%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKP 1430
            SRKKR PYT+YQT+ LE EF  N Y+TR +R E++  L+L+ERQVK+WFQNRRMK KK+   +P
Sbjct:  184 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLTERQVKIWFQNRRMKMKKMNKDQP 247          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Match: hoxd9a (homeobox D9a [Source:NCBI gene;Acc:30350])

HSP 1 Score: 85.1149 bits (209), Expect = 4.795e-18
Identity = 37/59 (62.71%), Postives = 49/59 (83.05%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            +RKKR PYT+YQT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK+
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKM 253          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:Xenbase;Acc:XB-GENE-978920])

HSP 1 Score: 87.4261 bits (215), Expect = 1.245e-18
Identity = 40/64 (62.50%), Postives = 51/64 (79.69%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            RSRKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  194 RSRKKRKPYSKIQLAELEGEFMVNEFITRQRRRELSDRLSLSDQQVKIWFQNRRMKKKRLLMRE 257          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Match: ENSXETT00000012547.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32894477:32894749:1 gene:ENSXETG00000005170.1 transcript:ENSXETT00000012547.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.425e-18
Identity = 38/58 (65.52%), Postives = 48/58 (82.76%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            RKKR PYT++QT+ LE EF  N Y+TR++R EIS  +HLS+RQVK+WFQNRRMK KK+
Sbjct:   17 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLSDRQVKIWFQNRRMKLKKM 74          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Match: ache (acetylcholinesterase (Cartwright blood group) [Source:Xenbase;Acc:XB-GENE-923160])

HSP 1 Score: 85.8853 bits (211), Expect = 2.791e-18
Identity = 40/59 (67.80%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            SRKKR PYT+YQT+ LE EF  N Y+TR +R E++  L+LSERQVK+WFQNRRMK KKL
Sbjct:  181 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKL 239          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Match: ENSXETT00000012532.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:32900780:32902234:1 gene:ENSXETG00000005181.1 transcript:ENSXETT00000012532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 2.766e-17
Identity = 36/59 (61.02%), Postives = 49/59 (83.05%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            +RKKR PYT++QT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK+
Sbjct:  195 TRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKKI 253          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Match: tollip (toll interacting protein [Source:Xenbase;Acc:XB-GENE-946207])

HSP 1 Score: 83.1889 bits (204), Expect = 1.242e-16
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            RKKR PYT++QT+ LE EF  N Y+TR++R EIS  ++L++RQVK+WFQNRRMK KK+
Sbjct:  278 RKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSINLTDRQVKIWFQNRRMKLKKM 335          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Match: Hoxc12 (homeobox C12 [Source:MGI Symbol;Acc:MGI:96194])

HSP 1 Score: 88.5817 bits (218), Expect = 5.775e-19
Identity = 40/64 (62.50%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            RSRKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 274          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Match: Hoxa10 (homeobox A10 [Source:MGI Symbol;Acc:MGI:96171])

HSP 1 Score: 81.6481 bits (200), Expect = 1.781e-18
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
             RKKR PYT++QT+ LE EF  N Y+TR++R EIS  +HL++RQVK+WFQNRRMK KK+
Sbjct:   20 GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 78          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Match: Hoxd12 (homeobox D12 [Source:MGI Symbol;Acc:MGI:96204])

HSP 1 Score: 86.2705 bits (212), Expect = 2.341e-18
Identity = 40/67 (59.70%), Postives = 53/67 (79.10%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            A  R+RKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L+LS++QVK+WFQNRRMKKK++  R+
Sbjct:  196 APGRARKKRKPYTKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQRE 262          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Match: Hoxb9 (homeobox B9 [Source:MGI Symbol;Acc:MGI:96190])

HSP 1 Score: 85.1149 bits (209), Expect = 4.379e-18
Identity = 39/59 (66.10%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            SRKKR PYT+YQT+ LE EF  N Y+TR +R E++  L+LSERQVK+WFQNRRMK KK+
Sbjct:  185 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKM 243          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Match: Hoxa10 (homeobox A10 [Source:MGI Symbol;Acc:MGI:96171])

HSP 1 Score: 86.6557 bits (213), Expect = 1.274e-17
Identity = 37/59 (62.71%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
             RKKR PYT++QT+ LE EF  N Y+TR++R EIS  +HL++RQVK+WFQNRRMK KK+
Sbjct:  342 GRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 400          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Match: sp|P09087|ABDB_DROME (Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 9.382e-19
Identity = 38/62 (61.29%), Postives = 51/62 (82.26%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
             ++  RKKRKPY+++QT+ LE EF  NAY+++QKRWE++  L L+ERQVK+WFQNRRMK KK
Sbjct:  383 GQVSVRKKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK 444          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Match: sp|Q9IA16|HXD12_HETFR (Homeobox protein Hox-D12 OS=Heterodontus francisci OX=7792 GN=HOXD12 PE=3 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.580e-18
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 3
Query: 1230 EMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            ++RSR+KRKPYT+ Q   LE+EF  N +I RQKR E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  201 QVRSRRKRKPYTKQQIAELENEFLANEFINRQKRKELSDRLNLSDQQVKIWFQNRRMKKKRLVMRE 266          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Match: sp|Q90471|HXDCA_DANRE (Homeobox protein Hox-D12a OS=Danio rerio OX=7955 GN=hoxd12a PE=2 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 2.613e-18
Identity = 41/67 (61.19%), Postives = 54/67 (80.60%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            +++RSRKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  190 SQVRSRKKRKPYTKPQLTELENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRLMMRE 256          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Match: sp|P31275|HXC12_HUMAN (Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 3.730e-18
Identity = 40/64 (62.50%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            RSRKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  213 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 276          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Match: sp|Q8K5B8|HXC12_MOUSE (Homeobox protein Hox-C12 OS=Mus musculus OX=10090 GN=Hoxc12 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.040e-18
Identity = 40/64 (62.50%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            RSRKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  211 RSRKKRKPYSKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 274          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Match: Q9BLF8 (Hox class homeodomain protein DjAbd-Bb OS=Dugesia japonica OX=6161 GN=DjAbd-Bb PE=2 SV=1)

HSP 1 Score: 695.271 bits (1793), Expect = 0.000e+0
Identity = 373/407 (91.65%), Postives = 387/407 (95.09%), Query Frame = 3
Query:  264 MDQVVVGTAASNLVRSGPNRLFAPTNCSLYSNVFTHSYLQQNIPNGSSNHPLGINHTQTAVSLPELDSFKIDAATALPGMALYXXXXXXXXXXXXXHQTNFDSGSINEFSGSNQYCGGSRHLGFSYPAWYNSNIRIDACDESNGMTTTEQPHWSCSPYSTAVSDARNSLVFGMDCLANPSRTTIKQSSSPPSKVNFPIPDCMTSPPSPIRQESSPIHPPNLNHMSSFHSLSDRAIQLYQQAASNPVDSLYGGQQPQLNPNYYQSTPNNASYPTIPYMSGTPAYNPMYXXXXXXXXXXXXXXXXXXXXHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTVHENNIQE 1484
            MDQVVVGTAASNLVRSGPNRLF PTNCSLYSNVFTHSYLQQNIPNGSSNH L IN +Q  VSLPEL+SFKIDAA+ALPGMALYSASSNSLSN N+ +    ++GSIN+F GS QYCGGSRHLGFSYPAWYNSNIRIDAC+ESNGMTT+EQPHWSCSPYSTAVSDARNSLVFGMDCLANP+RTTIKQSSSPPSKVNFPIPDCMTSP SPIRQE+SPIHP NLNHMSSFHSLSDRAIQLYQQAASNPVDSLYG QQPQLN NYYQSTPNNASYPTIPYMSGTPAYNPMYAAASFAASNSLFSSDFFSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGS+DDQ+KS VHE NIQE
Sbjct:    1 MDQVVVGTAASNLVRSGPNRLFPPTNCSLYSNVFTHSYLQQNIPNGSSNHSLAINASQPPVSLPELESFKIDAASALPGMALYSASSNSLSNNNHQNNF--ENGSINDFPGSGQYCGGSRHLGFSYPAWYNSNIRIDACEESNGMTTSEQPHWSCSPYSTAVSDARNSLVFGMDCLANPTRTTIKQSSSPPSKVNFPIPDCMTSPSSPIRQENSPIHPTNLNHMSSFHSLSDRAIQLYQQAASNPVDSLYGSQQPQLNANYYQSTPNNASYPTIPYMSGTPAYNPMYAAASFAASNSLFSSDFFSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSSDDQIKSNVHE-NIQE 404          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Match: A0A4E0S0C4 (Homeobox protein Hox-D10 OS=Fasciola hepatica OX=6192 GN=D915_003749 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.431e-30
Identity = 62/71 (87.32%), Postives = 65/71 (91.55%), Query Frame = 3
Query: 1218 LTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKP 1430
            L   E RSRKKRKPYTRYQTMVLE+EF GNAYITRQKRWEISCKLHL+ERQVKVWFQNRRMKKKKLQ+R P
Sbjct:  591 LNNGETRSRKKRKPYTRYQTMVLENEFIGNAYITRQKRWEISCKLHLTERQVKVWFQNRRMKKKKLQSRNP 661          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Match: A0A504YXH1 (Homeobox protein Hox-D10 OS=Fasciola gigantica OX=46835 GN=FGIG_01387 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.662e-30
Identity = 61/68 (89.71%), Postives = 64/68 (94.12%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKP 1430
             E RSRKKRKPYTRYQTMVLE+EF GNAYITRQKRWEISCKLHL+ERQVKVWFQNRRMKKKKLQ+R P
Sbjct:  594 GETRSRKKRKPYTRYQTMVLENEFIGNAYITRQKRWEISCKLHLTERQVKVWFQNRRMKKKKLQSRNP 661          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Match: A0A5K4F336 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.326e-30
Identity = 63/77 (81.82%), Postives = 67/77 (87.01%), Query Frame = 3
Query: 1194 DMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTR 1424
            D  L S   +   MRSRKKRKPYTRYQTMVLE+EF GNAYITRQKRWEISCKLHL+ERQVKVWFQNRRMKKKKLQ+R
Sbjct:  686 DEYLPSDCRSSGGMRSRKKRKPYTRYQTMVLENEFMGNAYITRQKRWEISCKLHLTERQVKVWFQNRRMKKKKLQSR 762          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Match: Q9U9T2 (Post2 homeobox protein (Fragment) OS=Alitta virens OX=880429 GN=Post2 PE=4 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 6.637e-30
Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTR 1424
            R RKKRKPYTRYQTMVLE+EF GN+YITRQKRWEISCKLHLSERQVKVWFQNRRMK+KKL  R
Sbjct:    5 RQRKKRKPYTRYQTMVLENEFMGNSYITRQKRWEISCKLHLSERQVKVWFQNRRMKRKKLNER 67          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 88.5817 bits (218), Expect = 3.044e-19
Identity = 42/70 (60.00%), Postives = 55/70 (78.57%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQ 1448
            +RKKR PYT+YQT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK+  R+ GS D Q
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMN-RERGSKDPQ 263          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Match: hoxd9a (homeobox protein Hox-D9a [Source:NCBI gene;Acc:103033248])

HSP 1 Score: 88.5817 bits (218), Expect = 3.044e-19
Identity = 42/70 (60.00%), Postives = 55/70 (78.57%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQ 1448
            +RKKR PYT+YQT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK+  R+ GS D Q
Sbjct:  195 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMN-RERGSKDPQ 263          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Match: hoxd12a (homeobox protein Hox-D12a-like [Source:NCBI gene;Acc:103047027])

HSP 1 Score: 87.8113 bits (216), Expect = 5.860e-19
Identity = 40/66 (60.61%), Postives = 54/66 (81.82%), Query Frame = 3
Query: 1230 EMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            ++R+RKKRKPYT+ Q   LE+EF  N +I RQKR E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  190 QLRARKKRKPYTKPQLAELENEFMINEFINRQKRKELSDRLNLSDQQVKIWFQNRRMKKKRLLIRE 255          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Match: hoxc12a (homeobox protein Hox-C12a-like [Source:NCBI gene;Acc:103031159])

HSP 1 Score: 87.8113 bits (216), Expect = 6.653e-19
Identity = 43/82 (52.44%), Postives = 58/82 (70.73%), Query Frame = 3
Query: 1185 HTEDMLLDSGS-LTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            HT +M    G+       R+RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  190 HTSNMSTGGGAPWYPMHTRTRKKRKPYSKLQLAELEGEFMMNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLRE 271          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Match: ENSAMXT00000043089.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000050.1:1458192:1460142:1 gene:ENSAMXG00000035583.1 transcript:ENSAMXT00000043089.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 3.719e-18
Identity = 38/58 (65.52%), Postives = 48/58 (82.76%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            RKKR PYT+YQT+ LE EF  N Y+TR++R EIS  +HL++RQVK+WFQNRRMK KK+
Sbjct:  262 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKM 319          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011221.1 (pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 gene:ENSPMAG00000010194.1 transcript:ENSPMAT00000011221.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 5.132e-20
Identity = 38/58 (65.52%), Postives = 48/58 (82.76%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            RKKR PYT+YQT+ LE EF  N Y+TR++R EIS  ++L++RQVK+WFQNRRMK KKL
Sbjct:    2 RKKRCPYTKYQTLELEKEFLFNMYLTRERRLEISRGVNLTDRQVKIWFQNRRMKLKKL 59          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.151e-18
Identity = 35/59 (59.32%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQ 1418
            RKKR PY++ QT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK++
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011060.1 (pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gene:ENSPMAG00000010033.1 transcript:ENSPMAT00000011060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 1.151e-18
Identity = 35/59 (59.32%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQ 1418
            RKKR PY++ QT+ LE EF  N Y+TR +R+E++  L+L+ERQVK+WFQNRRMK KK++
Sbjct:    2 RKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011449.1 (pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gene:ENSPMAG00000010422.1 transcript:ENSPMAT00000011449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 8.573e-18
Identity = 36/59 (61.02%), Postives = 48/59 (81.36%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            +RKKR PYT++QT+ LE EF  + Y+TR++R EIS  L L++RQVK+WFQNRRMK KK+
Sbjct:    1 TRKKRCPYTKHQTLELEKEFLFSMYLTRERRLEISHLLSLTDRQVKIWFQNRRMKLKKM 59          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010946.1 (pep scaffold:Pmarinus_7.0:GL477014:179916:180095:-1 gene:ENSPMAG00000009919.1 transcript:ENSPMAT00000010946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 4.587e-17
Identity = 36/58 (62.07%), Postives = 47/58 (81.03%), Query Frame = 3
Query: 1242 RKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKL 1415
            RKKR PYT++QT  LE EF  + YI ++KR +IS  L+L++RQVK+WFQNRRMK+KKL
Sbjct:    2 RKKRCPYTKFQTRELEREFFFSVYINKEKRLQISRLLNLTDRQVKIWFQNRRMKEKKL 59          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 47.3654 bits (111), Expect = 4.493e-6
Identity = 20/65 (30.77%), Postives = 44/65 (67.69%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRR--MKKKKLQTRK 1427
            +R+KR+  +  +  +L++EF      +++KR E++   H++E+ V++WFQN+R  +K++++ T K
Sbjct:  176 ARRKRRRTSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKRQRIATSK 240          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Match: MOXC (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR27])

HSP 1 Score: 75.8702 bits (185), Expect = 4.512e-17
Identity = 35/63 (55.56%), Postives = 46/63 (73.02%), Query Frame = 3
Query: 1224 EAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            +A+ R RK+R  +++YQ   LE EF  N Y+TR +R+EI+  L L ERQVKVWFQNRRMK K+
Sbjct:    9 DAKSRKRKERTVFSKYQLTELEREFCRNNYLTRLRRYEIAVSLDLGERQVKVWFQNRRMKWKR 71          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 76.2554 bits (186), Expect = 5.668e-17
Identity = 34/65 (52.31%), Postives = 50/65 (76.92%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKP 1430
            + RK+R  +T++Q   LE+EF  N Y+TR +R+EI+  L L+ERQVKVWFQNRRMK K+++ ++P
Sbjct:   15 KKRKERTAFTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVKGKRP 79          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Match: EDO42196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S291])

HSP 1 Score: 66.2402 bits (160), Expect = 6.787e-14
Identity = 32/63 (50.79%), Postives = 46/63 (73.02%), Query Frame = 3
Query: 1230 EMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQ 1418
            E + R++R  +T  QT+ LE EF  N YITR +R+E++  L+L+E QVK+WFQNRR K K+L+
Sbjct:    6 ENKPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKIWFQNRRAKDKRLE 68          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Match: HOX2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS10])

HSP 1 Score: 68.5514 bits (166), Expect = 3.164e-13
Identity = 31/59 (52.54%), Postives = 43/59 (72.88%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            RS++ R  YT  Q + LE EF+ N Y++R +R +I+  L LSE+QVK+WFQNRR+K KK
Sbjct:  122 RSKRIRTAYTSMQLLELEKEFSQNRYLSRLRRIQIAALLDLSEKQVKIWFQNRRVKWKK 180          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Match: EDO33847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR26])

HSP 1 Score: 63.5438 bits (153), Expect = 5.547e-13
Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 3
Query: 1269 YQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQ-TRKP 1430
            +Q   LE+EF  N Y+TR +R+EI+  L L+ERQVKVWFQNRRMK K+++  +KP
Sbjct:    1 HQLQELENEFIRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRVKGGKKP 55          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Match: hoxd12a (homeobox D12 [Source:NCBI gene;Acc:101162794])

HSP 1 Score: 87.4261 bits (215), Expect = 6.072e-19
Identity = 41/67 (61.19%), Postives = 54/67 (80.60%), Query Frame = 3
Query: 1227 AEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            +++RSRKKRKPY++ Q   LE+EF  N +I RQKR E+S KL LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  183 SQVRSRKKRKPYSKPQLAELENEFLMNEFINRQKRKELSDKLDLSDQQVKIWFQNRRMKKKRLMMRE 249          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Match: hoxc12a (homeobox protein Hox-C12a [Source:NCBI gene;Acc:101173058])

HSP 1 Score: 87.4261 bits (215), Expect = 9.552e-19
Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 3
Query: 1236 RSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            R+RKKRKPY++ Q   LE EF  N +ITRQ+R E+S +L+LS++QVK+WFQNRRMKKK+L  R+
Sbjct:  203 RTRKKRKPYSKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLMLRE 266          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Match: hoxd9 (homeobox D10 [Source:NCBI gene;Acc:101163860])

HSP 1 Score: 87.0409 bits (214), Expect = 1.102e-18
Identity = 42/71 (59.15%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQL 1451
            +RKKR PYT+YQT+ LE EF  N Y+TR +R+E++  L L+ERQVK+WFQNRRMK KK+   K G   DQL
Sbjct:  203 TRKKRCPYTKYQTLELEKEFLYNMYLTRDRRFEVARILSLTERQVKIWFQNRRMKMKKMNREKGGK--DQL 271          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Match: ENSORLT00000001667.2 (homeobox protein Hox-D9b [Source:NCBI gene;Acc:101175260])

HSP 1 Score: 86.2705 bits (212), Expect = 3.725e-18
Identity = 38/63 (60.32%), Postives = 50/63 (79.37%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRK 1427
            +RKKR PYT++QT+ LE EF  N Y+TR +R E++  L+L+ERQVK+WFQNRRMK KKL  R+
Sbjct:  247 TRKKRCPYTKHQTLELEKEFLYNMYLTRDRRLEVAGLLNLTERQVKIWFQNRRMKMKKLMIRE 309          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Match: hoxb9a (homeobox B9 [Source:NCBI gene;Acc:100049206])

HSP 1 Score: 84.7297 bits (208), Expect = 7.388e-18
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 3
Query: 1239 SRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            SRKKR PYT+YQT+ LE EF  N Y+TR +R E++  L+L+ERQVK+WFQNRRMK KK
Sbjct:  217 SRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARALNLTERQVKIWFQNRRMKMKK 274          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Match: SMESG000033048.1 (SMESG000033048.1)

HSP 1 Score: 769.229 bits (1985), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 3
Query:  264 MDQVVVGTAASNLVRSGPNRLFAPTNCSLYSNVFTHSYLQQNIPNGSSNHPLGINHTQTAVSLPELDSFKIDAATALPGMALYXXXXXXXXXXXXXHQTNFDSGSINEFSGSNQYCGGSRHLGFSYPAWYNSNIRIDACDESNGMTTTEQPHWSCSPYSTAVSDARNSLVFGMDCLANPSRTTIKQSSSPPSKVNFPIPDCMTSPPSPIRQESSPIHPPNLNHMSSFHSLSDRAIQLYQQAASNPVDSLYGGQQPQLNPNYYQSTPNNASYPTIPYMSGTPAYNPMYXXXXXXXXXXXXXXXXXXXXHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTVHENNIQE 1484
            MDQVVVGTAASNLVRSGPNRLFAPTNCSLYSNVFTHSYLQQNIPNGSSNHPLGINHTQTAVSLPELDSFKIDAATALPGMALYSASSNSLSNTNNSHQTNFDSGSINEFSGSNQYCGGSRHLGFSYPAWYNSNIRIDACDESNGMTTTEQPHWSCSPYSTAVSDARNSLVFGMDCLANPSRTTIKQSSSPPSKVNFPIPDCMTSPPSPIRQESSPIHPPNLNHMSSFHSLSDRAIQLYQQAASNPVDSLYGGQQPQLNPNYYQSTPNNASYPTIPYMSGTPAYNPMYAAASFAASNSLFSSDFFSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTVHENNIQE
Sbjct:    1 MDQVVVGTAASNLVRSGPNRLFAPTNCSLYSNVFTHSYLQQNIPNGSSNHPLGINHTQTAVSLPELDSFKIDAATALPGMALYSASSNSLSNTNNSHQTNFDSGSINEFSGSNQYCGGSRHLGFSYPAWYNSNIRIDACDESNGMTTTEQPHWSCSPYSTAVSDARNSLVFGMDCLANPSRTTIKQSSSPPSKVNFPIPDCMTSPPSPIRQESSPIHPPNLNHMSSFHSLSDRAIQLYQQAASNPVDSLYGGQQPQLNPNYYQSTPNNASYPTIPYMSGTPAYNPMYAAASFAASNSLFSSDFFSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTVHENNIQE 407          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Match: SMESG000054107.1 (SMESG000054107.1)

HSP 1 Score: 109.383 bits (272), Expect = 3.540e-26
Identity = 56/79 (70.89%), Postives = 67/79 (84.81%), Query Frame = 3
Query: 1200 LLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGS 1436
            +++   + E + R RKKRKPYTRYQ +VLESEF  N+YITRQKRWEISCKL+LSERQ+KVWFQNRRMKKKKLQ +KP +
Sbjct:  228 MMEQEYVPEMDHRCRKKRKPYTRYQNLVLESEFNSNSYITRQKRWEISCKLNLSERQIKVWFQNRRMKKKKLQIKKPST 306          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Match: SMESG000022668.1 (SMESG000022668.1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.775e-24
Identity = 42/63 (66.67%), Postives = 53/63 (84.13%), Query Frame = 3
Query: 1224 EAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            E + + R KR+PY+RYQ MVLESE+    YI+RQKRW+I+CKL+LSERQ+K+WFQNRRMK KK
Sbjct:   97 EKDQKERTKRRPYSRYQLMVLESEYINTEYISRQKRWDIACKLNLSERQIKIWFQNRRMKHKK 159          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.375e-15
Identity = 35/64 (54.69%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 1221 TEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            +E+    ++ R+ YTRYQT+ LE EF  N Y+TR++R EI+  L L+ERQ+K+WFQNRRMK KK
Sbjct:  207 SESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 270          
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.590e-15
Identity = 35/64 (54.69%), Postives = 48/64 (75.00%), Query Frame = 3
Query: 1221 TEAEMRSRKKRKPYTRYQTMVLESEFTGNAYITRQKRWEISCKLHLSERQVKVWFQNRRMKKKK 1412
            +E+    ++ R+ YTRYQT+ LE EF  N Y+TR++R EI+  L L+ERQ+K+WFQNRRMK KK
Sbjct:  210 SESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 273          
The following BLAST results are available for this feature:
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXC127.767e-1962.50homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124][more]
HOXD122.513e-1859.70homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135][more]
HOXA103.474e-1862.71homeobox A10 [Source:HGNC Symbol;Acc:HGNC:5100][more]
HOXB97.352e-1866.10homeobox B9 [Source:HGNC Symbol;Acc:HGNC:5120][more]
AC004080.38.045e-1861.02HOXA10-HOXA9 readthrough[more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
php-34.209e-2257.50Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-34.209e-2257.50Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
mab-51.575e-1750.62Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
nob-12.055e-1553.85KNOB-like posterior (NO Backside) [Source:UniProt... [more]
nob-12.442e-1553.85KNOB-like posterior (NO Backside) [Source:UniProt... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abd-B3.531e-2061.29gene:FBgn0000015 transcript:FBtr0346764[more]
Abd-B4.048e-2061.29gene:FBgn0000015 transcript:FBtr0083381[more]
Abd-B4.048e-2061.29gene:FBgn0000015 transcript:FBtr0083382[more]
Abd-B4.048e-2061.29gene:FBgn0000015 transcript:FBtr0415465[more]
Abd-B4.048e-2061.29gene:FBgn0000015 transcript:FBtr0083385[more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd12a3.029e-1961.19homeobox D12a [Source:NCBI gene;Acc:100006598][more]
hoxd12a3.462e-1961.19homeobox D12a [Source:NCBI gene;Acc:100006598][more]
hoxc12a1.827e-1860.94homeobox C12a [Source:ZFIN;Acc:ZDB-GENE-000822-6][more]
hoxb9a3.265e-1860.94homeobox B9a [Source:NCBI gene;Acc:30344][more]
hoxd9a4.795e-1862.71homeobox D9a [Source:NCBI gene;Acc:30350][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt81.245e-1862.50synaptotagmin 8 [Source:Xenbase;Acc:XB-GENE-978920... [more]
ENSXETT00000012547.11.425e-1865.52pep primary_assembly:Xenopus_tropicalis_v9.1:6:328... [more]
ache2.791e-1867.80acetylcholinesterase (Cartwright blood group) [Sou... [more]
ENSXETT00000012532.12.766e-1761.02pep primary_assembly:Xenopus_tropicalis_v9.1:6:329... [more]
tollip1.242e-1662.07toll interacting protein [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxc125.775e-1962.50homeobox C12 [Source:MGI Symbol;Acc:MGI:96194][more]
Hoxa101.781e-1862.71homeobox A10 [Source:MGI Symbol;Acc:MGI:96171][more]
Hoxd122.341e-1859.70homeobox D12 [Source:MGI Symbol;Acc:MGI:96204][more]
Hoxb94.379e-1866.10homeobox B9 [Source:MGI Symbol;Acc:MGI:96190][more]
Hoxa101.274e-1762.71homeobox A10 [Source:MGI Symbol;Acc:MGI:96171][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09087|ABDB_DROME9.382e-1961.29Homeobox protein abdominal-B OS=Drosophila melanog... [more]
sp|Q9IA16|HXD12_HETFR1.580e-1860.61Homeobox protein Hox-D12 OS=Heterodontus francisci... [more]
sp|Q90471|HXDCA_DANRE2.613e-1861.19Homeobox protein Hox-D12a OS=Danio rerio OX=7955 G... [more]
sp|P31275|HXC12_HUMAN3.730e-1862.50Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 G... [more]
sp|Q8K5B8|HXC12_MOUSE4.040e-1862.50Homeobox protein Hox-C12 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q9BLF80.000e+091.65Hox class homeodomain protein DjAbd-Bb OS=Dugesia ... [more]
A0A4E0S0C41.431e-3087.32Homeobox protein Hox-D10 OS=Fasciola hepatica OX=6... [more]
A0A504YXH13.662e-3089.71Homeobox protein Hox-D10 OS=Fasciola gigantica OX=... [more]
A0A5K4F3364.326e-3081.82Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
Q9U9T26.637e-3088.89Post2 homeobox protein (Fragment) OS=Alitta virens... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd9a3.044e-1960.00homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
hoxd9a3.044e-1960.00homeobox protein Hox-D9a [Source:NCBI gene;Acc:103... [more]
hoxd12a5.860e-1960.61homeobox protein Hox-D12a-like [Source:NCBI gene;A... [more]
hoxc12a6.653e-1952.44homeobox protein Hox-C12a-like [Source:NCBI gene;A... [more]
ENSAMXT00000043089.13.719e-1865.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011221.15.132e-2065.52pep scaffold:Pmarinus_7.0:GL477881:55654:55833:1 g... [more]
ENSPMAT00000011242.11.151e-1859.32pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
ENSPMAT00000011060.11.151e-1859.32pep scaffold:Pmarinus_7.0:GL482503:5543:5722:1 gen... [more]
ENSPMAT00000011449.18.573e-1861.02pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gen... [more]
ENSPMAT00000010946.14.587e-1762.07pep scaffold:Pmarinus_7.0:GL477014:179916:180095:-... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX14.493e-630.77Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MOXC4.512e-1755.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
MOXB5.668e-1752.31MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO421966.787e-1450.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX23.164e-1352.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338475.547e-1356.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd12a6.072e-1961.19homeobox D12 [Source:NCBI gene;Acc:101162794][more]
hoxc12a9.552e-1960.94homeobox protein Hox-C12a [Source:NCBI gene;Acc:10... [more]
hoxd91.102e-1859.15homeobox D10 [Source:NCBI gene;Acc:101163860][more]
ENSORLT00000001667.23.725e-1860.32homeobox protein Hox-D9b [Source:NCBI gene;Acc:101... [more]
hoxb9a7.388e-1865.52homeobox B9 [Source:NCBI gene;Acc:100049206][more]
back to top
BLAST of Hox class homeodomain protein DjAbd-Bb vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033048.10.000e+0100.00SMESG000033048.1[more]
SMESG000054107.13.540e-2670.89SMESG000054107.1[more]
SMESG000022668.16.775e-2466.67SMESG000022668.1[more]
SMESG000079807.11.375e-1554.69SMESG000079807.1[more]
SMESG000079807.11.590e-1554.69SMESG000079807.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013674 ID=SMED30013674|Name=Hox class homeodomain protein DjAbd-Bb|organism=Schmidtea mediterranea sexual|type=transcript|length=1766bp
TCTTCCGATCTGCTGGTAGTAATTCAGTAGCAATAAAATCACTGGCTGGT
CACAAAAAAAAGCGATCATTGCCTTATTTACTGTATAGAGACTGAATCGG
TGAACAAATAAAATCGACCGTCGACCACATTGGCCTCTAGAAATACAATC
CAATCTTGGTTTTATTGCGTACTCAACCAGACATTATTTAGCCATCTCAG
CTACCATAAGACTTCTTTTATTGCAGTCAAAACAGATAAATACGACTGGA
CGCATCCTCGAAAATGGACCAAGTAGTTGTTGGTACTGCTGCTTCAAACC
TCGTCCGTTCTGGACCCAATCGACTATTCGCTCCAACAAATTGTTCACTT
TATTCCAATGTATTTACTCACTCATATTTACAACAAAATATTCCAAATGG
ATCCTCAAACCATCCGCTCGGTATCAATCATACTCAAACAGCTGTAAGCT
TACCGGAGCTAGATTCGTTCAAAATTGATGCCGCCACAGCGTTGCCAGGG
ATGGCACTTTACAGTGCCAGTTCAAATTCATTATCCAATACCAACAATAG
CCATCAAACCAATTTCGACAGTGGGTCAATTAACGAATTCTCCGGATCAA
ACCAATACTGTGGAGGGTCCCGTCATTTAGGATTCTCTTACCCAGCTTGG
TATAATTCAAATATTCGAATTGACGCTTGCGACGAATCTAATGGAATGAC
AACAACTGAACAGCCACATTGGTCATGCAGTCCATATTCTACTGCAGTTT
CCGATGCGCGTAATAGCTTGGTGTTTGGAATGGATTGTCTGGCCAATCCA
TCAAGAACTACAATAAAACAGTCTTCTTCTCCTCCATCAAAAGTCAATTT
CCCTATTCCCGATTGTATGACTTCACCACCAAGCCCGATTCGGCAAGAAA
GCAGTCCAATTCATCCTCCTAATCTTAATCACATGTCTTCGTTTCATTCT
TTATCCGACAGAGCGATTCAGTTATATCAGCAAGCGGCTTCGAATCCCGT
TGACAGTTTATACGGAGGCCAACAACCTCAATTAAATCCCAACTATTACC
AATCAACCCCTAACAATGCATCTTATCCAACAATTCCATACATGTCGGGC
ACTCCGGCTTACAATCCCATGTATGCGGCAGCGAGTTTTGCCGCTAGCAA
TTCTTTATTTTCCAGTGATTTCTTTTCACGTTTCCACACCGAAGACATGC
TCCTTGACTCGGGATCCTTAACTGAAGCCGAAATGCGATCTAGAAAAAAA
CGAAAACCATACACTCGCTATCAGACAATGGTGCTGGAAAGCGAATTCAC
TGGAAACGCGTATATTACCCGACAAAAACGATGGGAAATTTCTTGCAAAT
TGCATTTATCGGAAAGACAGGTAAAAGTTTGGTTTCAAAATCGACGAATG
AAAAAAAAGAAACTTCAAACTAGAAAGCCCGGTAGCACAGATGATCAGCT
CAAGTCTACAGTCCATGAAAATAATATTCAGGAATCAATTCAGAGATTTT
AAAAACGTTTCTAAATCATTCGAATCCGATCTCAGAAATCGACTTGTAAA
CAAAAATACTGTGGCGATTTTTCATTCCATCTCCCCCCTCTCTCTCTTTC
TATTGCTCTCCTTCTCTTGTTTCAATCTTTCTCGCTCTTTTTAAATACGA
ATTTACAATGATATGCACCCAACTGAAGTTGTGTTGATAATAATGATAAT
AGATGTAGTTAATTTATTATTTTATTTTGATATTTGTCTTAGTTGCCAGG
ACTCATTGATTCCCCC
back to top

protein sequence of SMED30013674-orf-1

>SMED30013674-orf-1 ID=SMED30013674-orf-1|Name=SMED30013674-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MDQVVVGTAASNLVRSGPNRLFAPTNCSLYSNVFTHSYLQQNIPNGSSNH
PLGINHTQTAVSLPELDSFKIDAATALPGMALYSASSNSLSNTNNSHQTN
FDSGSINEFSGSNQYCGGSRHLGFSYPAWYNSNIRIDACDESNGMTTTEQ
PHWSCSPYSTAVSDARNSLVFGMDCLANPSRTTIKQSSSPPSKVNFPIPD
CMTSPPSPIRQESSPIHPPNLNHMSSFHSLSDRAIQLYQQAASNPVDSLY
GGQQPQLNPNYYQSTPNNASYPTIPYMSGTPAYNPMYAAASFAASNSLFS
SDFFSRFHTEDMLLDSGSLTEAEMRSRKKRKPYTRYQTMVLESEFTGNAY
ITRQKRWEISCKLHLSERQVKVWFQNRRMKKKKLQTRKPGSTDDQLKSTV
HENNIQESIQRF*
back to top
Aliases
The feature 'Hox class homeodomain protein DjAbd-Bb' has the following synonyms
Synonym
abdBb
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000103central nervous system
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 373..382
score: 79.96
coord: 348..359
score: 36.61
coord: 363..373
score: 60.9
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 326..388
e-value: 1.1E-22
score: 91.3
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 327..383
e-value: 4.5E-20
score: 71.2
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 324..384
score: 19.548
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 327..385
e-value: 1.36254E-21
score: 85.3728
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 318..388
e-value: 1.4E-23
score: 84.4
NoneNo IPR availablePANTHERPTHR45874FAMILY NOT NAMEDcoord: 175..405
NoneNo IPR availablePANTHERPTHR45874:SF4HOMEOBOX PROTEIN ABDOMINAL-Bcoord: 175..405
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 359..382
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 314..385