Interferon-induced GTP-binding protein Mx

Overview
NameInterferon-induced GTP-binding protein Mx
Smed IDSMED30013661
Length (bp)3409
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Interferon-induced GTP-binding protein Mx (SMED30013661) t-SNE clustered cells

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx (SMED30013661) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Interferon-induced GTP-binding protein Mx (SMED30013661) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Interferon-induced GTP-binding protein Mx (SMED30013661) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013661

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013661SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig32248newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000077847.1 SMESG000057533.1 SMESG000027782.1 SMESG000026563.1 SMESG000004883.1 SMESG000002217.1 SMESG000002216.1 SMESG000002023.1 SMESG000002004.1 Contig18771uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000077847.1 SMESG000057533.1 SMESG000027782.1 SMESG000026563.1 SMESG000004883.1 SMESG000002217.1 SMESG000002216.1 SMESG000002023.1 SMESG000002004.1 Contig18771newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig9176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig9176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000068632.1 SMESG000002032.1 SMESG000002030.1 SMESG000002023.1 SMESG000002022.1 Contig47704newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30013661SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013661SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013661SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013661SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig10607uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013661SMESG000002217.1 SMESG000002216.1 SMESG000002032.1 SMESG000002023.1 SMESG000002004.1 Contig10607newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30013661SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013661SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30013661SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013661SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30013661SMESG000002216.1 SMESG000002124.1 SMESG000002025.1 SMESG000002023.1 SMESG000002011.1 SMESG000002004.1 SMESG000002219.1 SMESG000002211.1 SMESG000002032.1 SMESG000002033.1 dd_Smed_v6_884_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013661SMESG000066856.1 SMESG000002221.1 SMESG000002213.1 dd_Smed_v4_5708_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Match: MX2 (MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:HGNC:7533])

HSP 1 Score: 170.629 bits (431), Expect = 3.405e-43
Identity = 118/374 (31.55%), Postives = 194/374 (51.87%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK----STETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLS-------NFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKY-----ISDIIKDIEKKTKNMLVMENHEIRKYGGIKE-FLNETEILSS 2443
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K    +   RI  +      +D    E EI + Q     N   I+ + I++ I SPE   LTIIDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P N DI TT  +  A E +P+  R IG+LTK D +D      +  ++RN   P++KGY  ++      E+T++   +E  +   K++  +      R  L           E L+ EL++ I K+LP+L+  + +  +   E+L        S+E  K +     I    +DIEK  +   V+  +E R Y  I+E F N   IL++
Sbjct:  101 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYM-IVKCRGQQEITNRLSLAEATK---KEITFFQTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILAT 467          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 157.532 bits (397), Expect = 3.977e-39
Identity = 163/621 (26.25%), Postives = 296/621 (47.67%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNA---EDVKRFGLSN---FTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNET--------FLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRK----NRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDAL 3163
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY  ++      E+ D+   SE  +R  +K+   N     D+   G +      E L+ EL+  I K+LP+L    ++++K T++++        +EE+Q KY  DI +D   + + M  +    I K     +     +I + ++G ET        F  + HE     F+ ++ I ++ F          K L R I+K     R   +  F++ + F+ I+ + +   ++ A + + T + ++     +V     E   +     + +  +  + D + E E     L    R +F   ++    D+   G  A + +R           +  FG     S  D+   +  +IF+  L  Y  +A  R+++ IP  IQ  +   + + L  A+
Sbjct:   53 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYM-IVKCRGQQEIQDQLSLSEALQR--EKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLL----ENQIKETHQRI--------TEELQ-KYGVDIPED---ENEKMFFL----IDKVNAFNQ-----DITALMQGEETVGEEDIRLFTRLRHE-----FHKWSTIIENNFQEGH------KILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFN-----LHRTAKSKIEDIRAEQEREGEKLI---RLHFQMEQIVYCQDQVYRG--ALQKVREKELEEEKKKKSWDFGAFQSSSATDS---SMEEIFQH-LMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAM 616          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 157.532 bits (397), Expect = 3.977e-39
Identity = 163/621 (26.25%), Postives = 296/621 (47.67%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNA---EDVKRFGLSN---FTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNET--------FLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRK----NRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDAL 3163
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY  ++      E+ D+   SE  +R  +K+   N     D+   G +      E L+ EL+  I K+LP+L    ++++K T++++        +EE+Q KY  DI +D   + + M  +    I K     +     +I + ++G ET        F  + HE     F+ ++ I ++ F          K L R I+K     R   +  F++ + F+ I+ + +   ++ A + + T + ++     +V     E   +     + +  +  + D + E E     L    R +F   ++    D+   G  A + +R           +  FG     S  D+   +  +IF+  L  Y  +A  R+++ IP  IQ  +   + + L  A+
Sbjct:   53 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYM-IVKCRGQQEIQDQLSLSEALQR--EKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLL----ENQIKETHQRI--------TEELQ-KYGVDIPED---ENEKMFFL----IDKVNAFNQ-----DITALMQGEETVGEEDIRLFTRLRHE-----FHKWSTIIENNFQEGH------KILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFN-----LHRTAKSKIEDIRAEQEREGEKLI---RLHFQMEQIVYCQDQVYRG--ALQKVREKELEEEKKKKSWDFGAFQSSSATDS---SMEEIFQH-LMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAM 616          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Match: MX1 (MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:HGNC:7532])

HSP 1 Score: 157.532 bits (397), Expect = 3.977e-39
Identity = 163/621 (26.25%), Postives = 296/621 (47.67%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSEPFK--DISDTESEIKEIQTTAFNNE---ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNA---EDVKRFGLSN---FTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNET--------FLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRK----NRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDAL 3163
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K     + R ++ Y+    +  D S+ E EI + Q  A   E   I+ + IT+ I S +   LT+IDLPG+ +  V  Q  D+  K   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D+     + +++RN    ++KGY  ++      E+ D+   SE  +R  +K+   N     D+   G +      E L+ EL+  I K+LP+L    ++++K T++++        +EE+Q KY  DI +D   + + M  +    I K     +     +I + ++G ET        F  + HE     F+ ++ I ++ F          K L R I+K     R   +  F++ + F+ I+ + +   ++ A + + T + ++     +V     E   +     + +  +  + D + E E     L    R +F   ++    D+   G  A + +R           +  FG     S  D+   +  +IF+  L  Y  +A  R+++ IP  IQ  +   + + L  A+
Sbjct:   53 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKWRGKVSYQDYEIEISDASEVEKEINKAQN-AIAGEGMGISHELITLEISSRDVPDLTLIDLPGITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYM-IVKCRGQQEIQDQLSLSEALQR--EKIFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLL----ENQIKETHQRI--------TEELQ-KYGVDIPED---ENEKMFFL----IDKVNAFNQ-----DITALMQGEETVGEEDIRLFTRLRHE-----FHKWSTIIENNFQEGH------KILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMVRLAFTDVSIKNFEEFFN-----LHRTAKSKIEDIRAEQEREGEKLI---RLHFQMEQIVYCQDQVYRG--ALQKVREKELEEEKKKKSWDFGAFQSSSATDS---SMEEIFQH-LMAYHQEASKRISSHIPLIIQFFMLQTYGQQLQKAM 616          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Match: DNM2 (dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974])

HSP 1 Score: 155.221 bits (391), Expect = 7.214e-38
Identity = 149/550 (27.09%), Postives = 260/550 (47.27%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYG--------GIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI+    + T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    D       ER+       +      R G  +  + L+++L   I ++LP L+  +  +L S  +++E +          K +  D   D  +KTK +L M    ++++G        G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     I+        +F     F+ I+ + +++ K       E C K +  +I+ ++ T  +   KLS    L+   ++I    + +++   ++ +  L D E+SY ++     +++ F    +A +    LNK
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYR-HMADRMGTPHLQKTLNQQLTNHIRESLPALRSKLQSQLLSLEKEVEEY----------KNFRPD---DPTRKTKALLQM----VQQFGVDFEKRIEGSGDQVDTLELSGGARINRIF----HERFP-----FELVKMEF---------DEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLK-------EPCLKCVDLVIQELINTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINT-----NHEDFIGFANAQQRSTQLNK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 149.443 bits (376), Expect = 2.082e-36
Identity = 130/453 (28.70%), Postives = 211/453 (46.58%), Query Frame = 2
Query: 1370 IKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYR-DEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVE 2695
            I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   D     + ER+       +      R G S     L+++L   I  TLP L+ ++  K+ +  + +  +  Y  +             D  +KTK +L M          + +F    +I  S+EG+   L   +E+        N ++ + F     K   DEK + +     IR      + +F     F+ I  + + R K+ + +CV+
Sbjct:   12 IPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYR-HMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPN-------------DPGRKTKALLQM----------VTQF--NADIERSIEGSSAKLVSTNELSGGA--RINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVD 432          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Match: dyn-1 (Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055])

HSP 1 Score: 149.058 bits (375), Expect = 2.404e-36
Identity = 130/453 (28.70%), Postives = 211/453 (46.58%), Query Frame = 2
Query: 1370 IKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYR-DEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVE 2695
            I  IN + +  S+    V  + +LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+ +   E    +  +   F D      EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  V  Q  D+ ++  ++   F+ +E  LI+ V PAN D+ T+  +K A E +P   R IGVLTKLD +DE   T   EI+ N+   + +GY G++     DI+   D     + ER+       +      R G S     L+++L   I  TLP L+ ++  K+ +  + +  +  Y  +             D  +KTK +L M          + +F    +I  S+EG+   L   +E+        N ++ + F     K   DEK + +     IR      + +F     F+ I  + + R K+ + +CV+
Sbjct:   12 IPVINRVQDAFSQLGTSV--SFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEG--TDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHM-ADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPN-------------DPGRKTKALLQM----------VTQF--NADIERSIEGSSAKLVSTNELSGGA--RINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVD 432          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.931 bits (289), Expect = 3.735e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1427 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 2047
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.931 bits (289), Expect = 3.735e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1427 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 2047
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Match: drp-1 (Dynamin-related protein [Source:UniProtKB/TrEMBL;Acc:G5EDY8])

HSP 1 Score: 115.931 bits (289), Expect = 3.735e-26
Identity = 74/227 (32.60%), Postives = 125/227 (55.07%), Query Frame = 2
Query: 1427 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------RKSTETRIQIKYR------SEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 2047
            + ++LPQI+VVG QS+GKSS+L+ + G   LPRG   VTR P+++Q+           R+S  T +   +       S+ F D      EI++   + T  N  I+  PI++ I S   V+L+++DLPG+ K  V  Q  ++ E+  E+   ++   +S+I+ V PANQD  T+  IK A E +    R + VLTKLD +D+    +  +++  + +P++ G  G++
Sbjct:   23 DQIQLPQIVVVGSQSAGKSSVLENLVGRDFLPRGTGIVTRRPLILQLNHVALDDESKRRRSNGTLLTDDWAMFEHTGSKVFTDFDAVRKEIEDETDRVTGVNKGISLLPISLKIYSHRVVSLSLVDLPGITKIPVGDQPVNIEEQIREMILLYISNPSSIILAVTPANQDFATSEPIKLAREVDAGGQRTLAVLTKLDLMDQGTDAM--DVLMGKVIPVKLGIIGVV 247          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0333717)

HSP 1 Score: 148.673 bits (374), Expect = 4.308e-36
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1379 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYY-GSEEIQKKYISDIIKDIE 2347
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D ++    ER+  L   +  +  D  R G       L+++L   I  TLP L+  +  ++ +  +++E F  +  G   I+ K +  +I+ ++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQ 332          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074122)

HSP 1 Score: 148.288 bits (373), Expect = 4.641e-36
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1379 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYY-GSEEIQKKYISDIIKDIE 2347
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D ++    ER+  L   +  +  D  R G       L+++L   I  TLP L+  +  ++ +  +++E F  +  G   I+ K +  +I+ ++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQ 332          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074121)

HSP 1 Score: 148.288 bits (373), Expect = 4.641e-36
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1379 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYY-GSEEIQKKYISDIIKDIE 2347
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D ++    ER+  L   +  +  D  R G       L+++L   I  TLP L+  +  ++ +  +++E F  +  G   I+ K +  +I+ ++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQ 332          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0074119)

HSP 1 Score: 148.288 bits (373), Expect = 4.641e-36
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1379 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYY-GSEEIQKKYISDIIKDIE 2347
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D ++    ER+  L   +  +  D  R G       L+++L   I  TLP L+  +  ++ +  +++E F  +  G   I+ K +  +I+ ++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQ 332          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Match: shi (gene:FBgn0003392 transcript:FBtr0111037)

HSP 1 Score: 148.288 bits (373), Expect = 4.641e-36
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1379 INFIDEMRSKF-SADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYY-GSEEIQKKYISDIIKDIE 2347
            I  +++++  F S  V+  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+    TE    +  + + F    +   EI++   + T  N  I+  PI + + SP  + LT+IDLPGL K  +  Q  D+ ++  ++   F+ +E  LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D ++    ER+  L   +  +  D  R G       L+++L   I  TLP L+  +  ++ +  +++E F  +  G   I+ K +  +I+ ++
Sbjct:    5 ITIVNKLQDAFTSLGVHMQLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLINGVTEYGEFLHIKGKKFSSFDEIRKEIEDETDRVTGSNKGISNIPINLRVYSPHVLNLTLIDLPGLTKVAIGDQPVDIEQQIKQMIFQFIRKETCLILAVTPANTDLANSDALKLAKEVDPQGVRTIGVITKLDLMDEG--TDARDILENKLLPLRRGYIGVVNRSQKDIEGRKDIHQALAAERKFFLSHPSYRHMAD--RLGTPYLQRVLNQQLTNHIRDTLPGLRDKLQKQMLTLEKEVEEFKHFQPGDASIKTKAMLQMIQQLQ 332          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Match: mxe (myxovirus (influenza virus) resistance E [Source:NCBI gene;Acc:337663])

HSP 1 Score: 169.088 bits (427), Expect = 2.596e-43
Identity = 169/645 (26.20%), Postives = 299/645 (46.36%), Query Frame = 2
Query: 1277 MKRKSGIKGELKFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR-----IQIKYRSEPFKDISDTESEIKEIQTT--AFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRIL-KKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGK----YRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDAL 3163
            M      KGE   SS L+Q        +EK    I+ +D +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K T+ +     +    +    KD +  E  +   QT        I+ + IT+ IQS +   LT+IDLPG+ +     Q  D+ ++   +   F++++ ++ + V+PAN DI TT  +K A+  +P   R +G+LTK D +D      +   + N+ +P++KGY  +IV      DI +     E  E ERR   + ++  +  + ++  +    E L+KELV  I K LP L+  ++ KL+ T+  L              + + D +   + +  N L+M   +IR++  + E +   E    VE   T       +F  + + F   +K   D+   K     RDE  ++  ++  R + +  F++ + F+NI+ + +    + A + ++  + I+   +++++        SPL    +      L ++    E  +   F  E+  +S  ++    D+ T+   A  TLR              +G++      D  E+         L  YLT A  RLAN IP  +Q ++   +   L +A+
Sbjct:    1 MSPSGSTKGE---SSGLNQH------YEEKVRPCIDLVDSLRA---LGVEKDLNLPAIAVIGDQSSGKSSVLEALSGVALPRGTGIVTRCPLVLKLKKITKDKSWHGLLTYNDKIRELKDPAKIEKAVLNAQTALAGIGEGISHEMITLEIQSCDVPDLTLIDLPGIARVATGNQPEDIEKQIKSLIEKFIKRQETISLVVVPANIDIATTEALKMASTVDPTGQRTLGILTKPDLVDRGMEDTVVRTVNNEVIPLKKGY--MIVKCRGQQDINDKLGLVEALEKERRFFDENVHFRSLLEDRKATIPLLAERLTKELVEHIAKNLPQLQNQLEMKLEKTSADL--------------RGLGDGVPLDKNEKSNFLIM---KIRQFNDVLERVQMAE--EDVEKPNT------RVFSKIRSEF-VKWKRILDSKAIKTEETLRDE--VQEYVKTRRGKELPGFVNYRTFENIVKKHIAELHEPALKLLKDVTDIVHSSVDHIVNAHFS-SFSPLMRAAKDPTEDFLHEQFQRAEEKIHSQFRMEKIVYSQDDLYS--DQLTT---AKNTLR-------------GYGLQSPNVSADVREMA------YHLTSYLTIACERLANQIPLIVQYHMLNQYISQLQNAM 578          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Match: mxa (myxovirus (influenza) resistance A [Source:NCBI gene;Acc:360142])

HSP 1 Score: 168.703 bits (426), Expect = 3.803e-43
Identity = 140/480 (29.17%), Postives = 238/480 (49.58%), Query Frame = 2
Query: 1310 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNAEDVKRFG-LSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKII 2713
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M ++ +      RI  K   E F D ++ E +I++ Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++    NE +ETE    K    ++    + F  +    E L+ ELV  I K+LP L+  ++ KL  T ++LE +     SE   +  +S  I  +    ++ML +   E  K          T++L   E  + F   W  I     ++FN   +   D    KYR  +             +  FI+ K F+ ++ + +   ++ A + ++T S ++
Sbjct:    3 KLSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRTKDQDKWHGRISYKTYEEDFDDPAEVEKKIRQAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRKFVTRQETINLVVVPCNVDIATTEALQMAQAEDPDGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY--MIVRCRGQKEIMDQVTLNEATETESAFFKDHPHFSKLYEEGFATIPKLAEKLTIELVHHIQKSLPRLEEQIETKLAETQKELEAYGNGPPSEPAAR--LSFFIDKVTAFNQDMLNLTTGEDVKCT--------TDLLLFPELRQEF-AKWSHILDRSGDSFNKKIEKEVDNYEVKYRGRE-------------LPGFINYKTFEGLVRDQIKLLEEPALKTLKTVSDVV 447          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 165.236 bits (417), Expect = 5.960e-42
Identity = 113/337 (33.53%), Postives = 182/337 (54.01%), Query Frame = 2
Query: 1310 KFSSTLSQSKKRMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTE-----TRIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNAEDVKRFG-LSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            K S T SQ        +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M +S E      RI  +   E F D ++ E +I+E Q         I+++ I++ I S     LT+IDLPG+ +  V+GQ  ++ ++   + R F+ ++ ++ + V+P N DI TT  ++ A   +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I++    NE +ETE    K    +     + F  +    E L+ ELV  I ++LP L+  +  KL  T ++LE + 
Sbjct:    3 KMSYTFSQQ------YEEKIRPCIDTIDNLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVPLPRGSGIVTRCPLELKMIRSKEDEKWHGRISYQNHEEDFDDPAEVEKKIREAQDEMAGAGVGISEELISLQITSANVPDLTLIDLPGIARVAVKGQPENIGDQIKRLIRMFITKQETINLVVVPCNVDIATTEALQMAQAEDPEGERTLGILTKPDLVDKGTEGTVVDIVHNEVIHLTKGY--MIVRCRGQKEIMDQVTLNEATETESAFFKDHPHFRKLYEEGFATIPKLAEKLTIELVHHIQRSLPRLEEQIQTKLAETQKELEAYG 328          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Match: mxc (myxovirus (influenza virus) resistance C [Source:NCBI gene;Acc:360145])

HSP 1 Score: 162.54 bits (410), Expect = 4.000e-41
Identity = 164/620 (26.45%), Postives = 289/620 (46.61%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR-----IQIKYRSEPFKDISDTESEI--KEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA--EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIIN-------EALIRFKKDADECVETCSKIILFI----IENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLN-KPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDAL 3163
            I+ +D +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG+  VTRCP++++++K T  +     +  K ++E  K+ +  E+ +   +I        I+ + IT+ IQS +   LT+IDLPG+ +     Q  D+ ++  ++   F++++ ++ + V+PAN DI TT  +K A+  +P   R + +LTK D +D      +   + N+ + +EKGY  +IV      DI +  +  E  E ERR   +   +++  ED K   +    + L++ELV  I K +P L+  ++ KL+ T E+L+   +              +  D E +  N L+ +         +++F++  E +  VE  E  +     +F  +   F + +K   D+   K   +  L+  +R +R + +  F++   F  II        E  ++  ++A + V +    I  I      N+L    EP    L    Q    KI S             F  E++ +   ++  ++            L LL  K ++ FG  AS G         N EL +       L  YLT A  RLAN IP  +Q ++  +++  L +A+
Sbjct:   26 IDLVDTLRA---LGVEKDLNLPAIAVIGDQSSGKSSVLEALSGVALPRGIGIVTRCPLILKLKKITRDKNWSGLLTYKDQTEILKEPTGIENAVLKAQIALAGTGEGISHEMITLEIQSCDVPDLTLIDLPGIARVATGNQPEDIEKQIKDLIEKFIKRQETISLVVVPANIDIATTEALKMASTVDPTGQRTLCILTKPDLVDRGMEDTVVRTVNNEVIRLEKGY--MIVKCRGQQDINDKLNLVEALEKERRFFDEHPQFSSLLEDGK-ATIPLLGQRLTEELVEHIAKNVPRLQNQIEMKLQKTFERLKVLGE-------------SVPDDDEIELNNFLIKK---------LRQFMDALEEVKRVE--EEPVKSDTRVFSKIRQEFVS-WKHILDSKPIKMSTD--LQEYVRTHRGKELPGFLNYGTFAGIIRMHVEDLEEPALKLLRNAKDIVHSSVGSIANIHFNGYPNLLLAVKEPIEKCLHEQFQNAEEKIRSQ------------FKLEKTVYCQDDLYTNH------------LNLLRPKNTVRFGLEASLG---------NSELRETAFH---LTSYLTIACERLANQIPLIVQYHMMNEYNSQLQNAM 576          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Match: dnm1b (dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3])

HSP 1 Score: 159.458 bits (402), Expect = 1.914e-39
Identity = 157/577 (27.21%), Postives = 259/577 (44.89%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-RKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSP-LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKY 3067
            I  ++ M+  FSA   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q+    TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   EI+ N+ LP+ +GY G++     DI    D       ER+  L   +  +  D  R G     +AL+++L   I  TLP L+  +  +L S  +++E +  +                D  +KTK +L M       +    E   +      + G      ++HE F      F  +  +F         DEK L +     I+        +F     F+ I+   + + K+   +CV+    +I  ++  V     +    P L+  +++I  + + D++   +N +  L D E +Y     M  +++ F    +A +    +NK        A    E++  R   L + +  I K G ++Y
Sbjct:   10 IPLVNRMQDAFSAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLINCPTEYAEFLHCKGKKFTDFDEVRQEI-EAETDRITGQNKGISPVPINLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLMQFVTKENCLLLAVSPANSDLANSDALKIAKEVDPQGMRTIGVITKLDLMDEG--TDAREILENKLLPLRRGYIGVVNRSQKDIDGKKDITAAMSAERKFFLTHPSYRHLAD--RMGTPYLQKALNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVEEYKHFRPD-------------DPSRKTKALLQMVQQFAVDFEKCIEGSGDQVDTVELSGGARINRIFHERFP-----FELVKMEF---------DEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIAKIKEPCQKCVDL---VITELVNTVRQCTKKLAQYPMLREEMERIVTQHIRDRESRTKNQVMLLIDIELAY-----MNTNHEDFIGFANAQQRSSQMNK-----KKAAGNQDEIMVIRKGWLTINNIGIMKGGAKEY 541          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Match: rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:Xenbase;Acc:XB-GENE-986293])

HSP 1 Score: 161.77 bits (408), Expect = 2.655e-42
Identity = 115/342 (33.63%), Postives = 180/342 (52.63%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKEI--QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENH 2383
            I  ++ ++  FSA   N  + LPQI VVG QS+GKSS+L+ + G   LPRG   +TR P+V+Q+  S TE    +  +   + D S+   EI+E   + T  N  I+  PI++ I SP  + L++IDLPG+ K  V  Q  D+  +  ++  +F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   EI+ N+ LP+ +GY G++     DI    + N   + E+        +      R G S+  + L+++L   I +TLP L+  + D+L S   ++E +           K I+    D  +KTK +L M  H
Sbjct:   12 IPLVNRLQDAFSAIGQNYQVDLPQIAVVGGQSAGKSSVLENLVGRDFLPRGAGIITRRPLVLQLITSNTEYAEFLHCKGTKYTDFSEVRQEIEEETERATGLNKGISAIPISLRIYSPHVLNLSLIDLPGVTKVPVGDQPADIETQIRDMIMNFISRENCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TNAQEILENKLLPLRRGYVGVVNRSQKDIDGKKNINAALQAEQMFFLTHPAYR-HMADRMGTSHLQKMLNQQLTNHIRETLPDLRSKLQDQLLSLQHEVEVY-----------KSINP--DDPSRKTKALLHMVQH 337          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 143.665 bits (361), Expect = 3.957e-37
Identity = 82/233 (35.19%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKS---TETRIQIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 2035
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+   T    +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Match: krt17 (keratin 17 [Source:Xenbase;Acc:XB-GENE-490369])

HSP 1 Score: 142.51 bits (358), Expect = 7.068e-37
Identity = 82/233 (35.19%), Postives = 137/233 (58.80%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKS---TETRIQIKYRSEPFK--DISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGY 2035
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++++K+   T    +I YR    K    +D E E+K  Q         I+ + I++ + SP+   LT+IDLPG+ +  +  Q  D+ ++  ++ R +++++ ++ + V+P+N DI TT  ++ A E +P+  R +G+LTK D +D    T +  ++RN    + KGY
Sbjct:   10 EEKIRPCIDLIDSLRA---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVTLPRGSGIVTRCPLELKLKKAMKKTTWSGKISYRDHEIKIASAADVEEEVKRAQNLMAGSGKGISDELISLEVISPDVPDLTLIDLPGITRVALPDQPKDIEQQIKKMIRKYIQKQETINLVVVPSNVDIATTEALEMAREVDPNGERTLGILTKPDLVDRGAETDVISVVRNLVYSLNKGY 239          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 151.754 bits (382), Expect = 8.922e-37
Identity = 144/546 (26.37%), Postives = 256/546 (46.89%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYG--------GIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIE-PKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  +++++  FS+ + +A  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI+    + T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +++ LI+ V P N D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D       ER+       +     +R G  +  + L+++L   I +TLP L+  +  +L S  +++E +  +                D  +KTK +L M    ++++G        G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     I+        +F     F+ I+ + +++ K+   +CV+   + ++  +    A  +  PK   L+   ++I    + +++ + ++ +  L D E SY ++     +++ F    +A +    LNK
Sbjct:   10 IPLVNKLQDAFSS-IGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYR-HIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPD-------------DPTRKTKALLQM----VQQFGVDFEKRIEGSGDQVDTLELSGGARINRIF----HERFP-----FELVKMEF---------DEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPK---LREETERIVTTYIREREGKTKDQILLLIDIELSYINT-----NHEDFIGFANAQQRSSQLNK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Match: dcbld2 (discoidin, CUB and LCCL domain containing 2 [Source:Xenbase;Acc:XB-GENE-958816])

HSP 1 Score: 151.369 bits (381), Expect = 1.012e-36
Identity = 144/546 (26.37%), Postives = 256/546 (46.89%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYG--------GIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIE-PKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  +++++  FS+ + +A  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI+    + T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +++ LI+ V P N D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D       ER+       +     +R G  +  + L+++L   I +TLP L+  +  +L S  +++E +  +                D  +KTK +L M    ++++G        G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     I+        +F     F+ I+ + +++ K+   +CV+   + ++  +    A  +  PK   L+   ++I    + +++ + ++ +  L D E SY ++     +++ F    +A +    LNK
Sbjct:   10 IPLVNKLQDAFSS-IGQACNLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVWQEIEAETDRVTGTNKGISPVPINLRVYSPNVLNLTLIDLPGITKVPVGDQPHDIEYQIKDMILQFISRDSCLILAVTPGNTDLANSDALKMAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDIKAALGAERKFFLSHPGYR-HIAERMGTPHLQKTLNQQLTNHIRETLPALRNKLQSQLLSLEKEVEEYKNFRPD-------------DPTRKTKALLQM----VQQFGVDFEKRIEGSGDQVDTLELSGGARINRIF----HERFP-----FELVKMEF---------DEKDLRREISYAIKNIHGVRTGLFTPDMAFEAIVKKQVVKLKEPCLKCVDMVIQELINTVRQCTAKLLSYPK---LREETERIVTTYIREREGKTKDQILLLIDIELSYINT-----NHEDFIGFANAQQRSSQLNK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 161.384 bits (407), Expect = 1.526e-40
Identity = 135/463 (29.16%), Postives = 227/463 (49.03%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYR--SEPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA--EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVME-----NHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKII 2713
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI E     E  + E+   K+   +    ED K   +    E L+ EL+  I K+LP+L+  + +  +S +E+L+             KY  DI +D  +KT    ++E     N +I      +E + E E        + FL    EI K+    +  +Y + + A   +YR  +             +  F++ K F+NII   +   ++ A E + T ++I+
Sbjct:   46 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVLLEDGK-ATVPCLAERLTAELISHICKSLPLLENQIKESHQSASEELQ-------------KYGMDIPEDDSEKT--FFLIEKINAFNQDITALVQGEENVAEGECRLFTRLRKEFLSWSKEIEKNFAKGYAVLYNEVW-AFEKQYRGRE-------------LPGFVNYKTFENIIRRQIKTLEEPAIEMLHTVTEIV 473          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 153.68 bits (387), Expect = 1.785e-38
Identity = 112/346 (32.37%), Postives = 181/346 (52.31%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA--EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKT 2356
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI E     E  + E+   K+   +    ED K   +    E L+ EL+  I K+LP+L+  + +  +S +E+L+             KY  DI +D  +KT
Sbjct:   39 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVLLEDGKAT-VPCLAERLTAELISHICKSLPLLENQIKESHQSASEELQ-------------KYGMDIPEDDSEKT 365          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 156.762 bits (395), Expect = 1.918e-38
Identity = 149/550 (27.09%), Postives = 261/550 (47.45%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYG--------GIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI+    + T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    D       ER+       +      R G  +  + L+++L   I ++LP L+  +  +L S  +++E +          K +  D   D  +KTK +L M    ++++G        G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     I+        +F     F+ I+ + +++ K       E C K +  +I+ +++T  +   KLS    L+   ++I    + +++   ++ +  L D E+SY ++     +++ F    +A +    LNK
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYR-HMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEY----------KNFRPD---DPTRKTKALLQM----VQQFGVDFEKRIEGSGDQVDTLELSGGARINRIF----HERFP-----FELVKMEF---------DEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLK-------EPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINT-----NHEDFIGFANAQQRSTQLNK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Match: Dnm2 (dynamin 2 [Source:MGI Symbol;Acc:MGI:109547])

HSP 1 Score: 156.377 bits (394), Expect = 2.197e-38
Identity = 149/550 (27.09%), Postives = 261/550 (47.45%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEA--LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKS-TETRIQIKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYG--------GIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  +++++  FS+ + ++  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q+  S TE    +  +S+ F D  +   EI+    + T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  ++   F+ +E+SLI+ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +++ N+ LP+ +GY G++     DI    D       ER+       +      R G  +  + L+++L   I ++LP L+  +  +L S  +++E +          K +  D   D  +KTK +L M    ++++G        G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     I+        +F     F+ I+ + +++ K       E C K +  +I+ +++T  +   KLS    L+   ++I    + +++   ++ +  L D E+SY ++     +++ F    +A +    LNK
Sbjct:   10 IPLVNKLQDAFSS-IGQSCHLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLIFSKTEYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPPDIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG--TDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRAALAAERKFFLSHPAYR-HMADRMGTPHLQKTLNQQLTNHIRESLPTLRSKLQSQLLSLEKEVEEY----------KNFRPD---DPTRKTKALLQM----VQQFGVDFEKRIEGSGDQVDTLELSGGARINRIF----HERFP-----FELVKMEF---------DEKDLRREISYAIKNIHGVRTGLFTPDLAFEAIVKKQVVKLK-------EPCLKCVDLVIQELISTVRQCTSKLSSYPRLREETERIVTTYIREREGRTKDQILLLIDIEQSYINT-----NHEDFIGFANAQQRSTQLNK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Match: Mx2 (MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MGI:97244])

HSP 1 Score: 154.451 bits (389), Expect = 2.329e-38
Identity = 112/346 (32.37%), Postives = 181/346 (52.31%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA--EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKT 2356
            +EK    I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V+++RK     E R ++ Y        D S+ E  I + Q         I+   I++ + SP    LT+IDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P+N DI TT  +  A E +P+  R IG+LTK D +D      + +++RN    ++KGY  +IV      DI E     E  + E+   K+   +    ED K   +    E L+ EL+  I K+LP+L+  + +  +S +E+L+             KY  DI +D  +KT
Sbjct:   39 EEKVRPCIDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDRGTEDKVVDVVRNLVYHLKKGY--MIVKCRGQQDIQEQLSLTEALQNEQIFFKEHPHFRVLLEDGKAT-VPCLAERLTAELISHICKSLPLLENQIKESHQSASEELQ-------------KYGMDIPEDDSEKT 365          
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Match: sp|Q91196|MX2_ONCMY (Interferon-induced GTP-binding protein Mx2 OS=Oncorhynchus mykiss OX=8022 GN=mx2 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.578e-47
Identity = 114/318 (35.85%), Postives = 182/318 (57.23%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLE 2275
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  + R E  +D SD E++I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+E     E +E E+   K+  +L    D     +    E L+ ELV  I+K++P LK  +++KL+ T   LE
Sbjct:   10 EEKVRPSIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDREEEIEDPSDVENKIRKAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIQLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVQHIEKSMPRLKEQIEEKLEETRTALE 322          
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Match: sp|Q6PW23|MX_EPICO (Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides OX=94232 GN=mx PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 7.935e-47
Identity = 136/454 (29.96%), Postives = 232/454 (51.10%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILK-KMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDF------FDANRGKY--RDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDA 2680
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I YR   +  +D SD E++I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + EI+ N+ + ++KGY  +IV      +I E     E  E+E+   +  ++     +  +  +    E L+ ELV  I+++LP L+  ++DKL+ T  +LE +     S+  +K +   +I  +   T++ + +   E  K G                              D  N F+A+ ++F       D +  K+  R EK +E    K R   +  FI+ K F+ ++ E + + ++ A
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWYGKISYRGCEKELEDPSDVENKIREAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPEDIGKQIKGLIQRFITRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVEIVHNEVIHLKKGY--MIVRCRGQKEITEKVSLTEALESEKAFFRDHVHFHTLYNEGQATVPKLAEKLTLELVHHIERSLPRLEEQIEDKLEQTQAELERYGSGPPSDATEKLFF--LIDKVTAFTQDAISLTTGEDLKCG------------------------------DKLNVFSALRREFARWNAHLDLSGEKFNKRIEKEVENYEEKYRGRELPGFINYKTFEVMVKEQIKQLEEPA 432          
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Match: sp|Q91192|MX1_ONCMY (Interferon-induced GTP-binding protein Mx1 OS=Oncorhynchus mykiss OX=8022 GN=mx1 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.258e-46
Identity = 111/314 (35.35%), Postives = 178/314 (56.69%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+E     E +E E+   K+  +L    D     +    E L+ ELV  I+K+LP L+  ++ KL  T+ +LE + 
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETISLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYG 325          
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Match: sp|Q91197|MX3_ONCMY (Interferon-induced GTP-binding protein Mx3 OS=Oncorhynchus mykiss OX=8022 GN=mx3 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.399e-45
Identity = 110/314 (35.03%), Postives = 178/314 (56.69%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  ++ A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+E     E +E E+   K+  +L    D     +    E L+ ELV  I+K+LP L+  ++ KL  T+ +LE + 
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKREGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETINLVVVPCNVDIATTEALQMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYG 325          
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Match: sp|P20592|MX2_HUMAN (Interferon-induced GTP-binding protein Mx2 OS=Homo sapiens OX=9606 GN=MX2 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.635e-42
Identity = 118/374 (31.55%), Postives = 194/374 (51.87%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK----STETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLS-------NFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKY-----ISDIIKDIEKKTKNMLVMENHEIRKYGGIKE-FLNETEILSS 2443
            I+ ID +R+     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+V++++K    +   RI  +      +D    E EI + Q     N   I+ + I++ I SPE   LTIIDLPG+ +  V  Q  D+  +   + + +++++ ++ + V+P N DI TT  +  A E +P+  R IG+LTK D +D      +  ++RN   P++KGY  ++      E+T++   +E  +   K++  +      R  L           E L+ EL++ I K+LP+L+  + +  +   E+L        S+E  K +     I    +DIEK  +   V+  +E R Y  I+E F N   IL++
Sbjct:  101 IDLIDSLRA---LGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELELQDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRDIGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMDRGTEKSVMNVVRNLTYPLKKGYM-IVKCRGQQEITNRLSLAEATK---KEITFFQTHPYFRVLLEEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMFFLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILAT 467          
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Match: A0A060YH96 (Dynamin-type G domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00005088001 PE=3 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 1.998e-45
Identity = 109/310 (35.16%), Postives = 177/310 (57.10%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  +   E  +D SD E +I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  ++ A E +P+  R +G+LTK D +D+     + +I+ N+ + + KGY  +I  + I+E     E +E E+   K+  +L    D     +    E L+ ELV  I+K+LP L+  ++ KL  T+ +LE + 
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKREGEEWHGKISYQDHEEEIEDPSDVEKKIREAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFIMKQETINLVVVPCNVDIATTEALQMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIVHNEVIHLTKGY--MIGPEGIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVHHIEKSLPRLEEQIEAKLSETHAELERYG 321          
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Match: B5X1G2 (Interferon-induced GTP-binding protein Mx OS=Salmo salar OX=8030 GN=MX PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.208e-44
Identity = 111/311 (35.69%), Postives = 180/311 (57.88%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLE 2275
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I+ + R E  +D SD E +I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++ + V+P N DI TT  +K A E +P   R +G+LTK D +D+    ++ +I+ N+ + + KGY  +IV      +I+E     E +E E+   K+ ++L    D     +    E L+ ELV  I+K++P LK  +++KL+ T   LE
Sbjct:   17 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKIRYQDREEEIEDPSDVEKKIRKAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKNLIRKFITKQETINLVVVPCNVDIATTEALKMAQEVDPQGGRTLGILTKPDLVDKGTEEMVVDIVHNEVIHLTKGY--MIVKCRGQKEIMEQVSLTEATEREKAFFKEHLHLSTLYDEGHATIPKLAEKLTLELVQHIEKSMPRLKEQIEEKLEETRTTLE 322          
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Match: A0A4Y5LAJ9 (Interferon-induced GTP-binding protein Mx4 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.223e-44
Identity = 114/318 (35.85%), Postives = 181/318 (56.92%), Query Frame = 2
Query: 1358 KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTET-----RIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKK-MNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLE 2275
            +EK    I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I  + R E  +D SD E++I++ Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  ++ E+   + R F+ ++ ++   V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +I+ N+ + + KGY  +IV      +I+E     E +E E+   K+  +L    D     +    E L+ ELV  I+K++P LK  +++KL+ T   LE
Sbjct:   10 EEKVRPSIDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWHGKISYQDREEEIEDPSDVENKIRKAQDEMAGVGVGISDDLISLEIGSPDVPDLTLIDLPGIARVAVKGQPENIGEQIKRLIRKFITKQETINFVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVDIVHNEVIQLTKGY--MIVKCRGQKEIMERVSLTEATEREKAFFKEHAHLSTLYDEGHATIPKLAEKLTLELVQHIEKSMPRLKEQIEEKLEETRTALE 322          
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Match: Q0ZIJ2 (Interferon-induced Mx protein OS=Epinephelus coioides OX=94232 PE=2 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.564e-44
Identity = 134/457 (29.32%), Postives = 232/457 (50.77%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYRS--EPFKDISDTESEIKEIQT--TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWN-AEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKII 2713
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I Y++  E  +D +  E +I+  Q       + I+ D IT+ I SP+   LT+IDLPG+ +  V+GQ  ++ ++   + + F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + +++ N+ +P++KGY  +IV      +I E    NE  E E+   K    +    D     +    E L+ ELV  I ++LP L+  +  KL+ T  +LE +      +  ++  +  +I  +   T++ + +   E   +GG         I +S+         W EI +    NFN             +  EK + +  RK R   +  FIS K F+ ++ E + + +  A + ++  ++I+
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKREKEGEKWCGKISYQNFKEEIEDPAHVEKKIRAAQNKIAGKGSGISSDLITLDIASPDVPDLTLIDLPGIARVAVQGQPENIGDQIKALIQKFIRKQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEETVVKVVHNEVIPLKKGY--MIVRCRGQQEITEKVSLNEALEREKAFFKDNAYFQILYDEGHATVPELAERLTLELVHHIKRSLPQLEEQIAKKLEQTQAELERYGNGPPCDATER--LGYLIDRVSAFTQDAISLTTGEELHFGG------RVNIFASLRKE---FAAWKEIIERSGVNFN-------------WNIEKEVAQFERKYRGRELPGFISYKTFEGMVKEQIKQLEGPAIQKLKEVAEIV 443          
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Match: Q0ZIJ1 (Interferon-induced Mx protein OS=Epinephelus coioides OX=94232 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.288e-44
Identity = 136/454 (29.96%), Postives = 232/454 (51.10%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETR---IQIKYRS--EPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILK-KMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDF------FDANRGKY--RDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDA 2680
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I YR   +  +D SD E++I+E Q         I+ D I++ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+ ++ ++ + V+P N DI TT  +K A E +PD  R +G+LTK D +D+     + EI+ N+ + ++KGY  +IV      +I E     E  E+E+   +  ++     +  +  +    E L+ ELV  I+++LP L+  ++DKL+ T  +LE +     S+  +K +   +I  +   T++ + +   E  K G                              D  N F+A+ ++F       D +  K+  R EK +E    K R   +  FI+ K F+ ++ E + + ++ A
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRKKEGEEWYGKISYRGCEKELEDPSDVENKIREAQDEMAGVGVGISDDLISLEIASPDVPDLTLIDLPGIARVAVKGQPEDIGKQIKGLIQRFITRQETISLVVVPCNVDIATTEALKMAQEVDPDGERTLGILTKPDLVDKGTEDTVVEIVHNEVIHLKKGY--MIVRCRGQKEITEKVSLTEALESEKAFFRDHVHFHTLYNEGQATVPKLAEKLTLELVHHIERSLPRLEEQIEDKLEQTQAELERYGSGPPSDAAEKLFF--LIDKVTAFTQDAISLTTGEDLKCG------------------------------DKLNVFSALRREFARWNAHLDLSGEKFNKRIEKEVENYEEKYRGRELPGFINYKTFEVMVKEQIKQLEEPA 432          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Match: ENSAMXT00000057014.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19594915:19607580:1 gene:ENSAMXG00000040238.1 transcript:ENSAMXT00000057014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 3.102e-43
Identity = 108/307 (35.18%), Postives = 169/307 (55.05%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYY-----GLIVSDDILELTDKNERSETERRILKKMN----LWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKL 2251
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SPE   LT+IDLPG+ +  V+GQ  D+ ++   + R+F+E++ ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     + +I++NQ +P+ KGY      G    DD + L    E +  E+   K+      L N E   +  +      L+++LV  I K+LP+L   +  +L
Sbjct:    1 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKLKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPEVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRNFIEKDQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNVLDIVKNQVIPLSKGYIIVKCRGQKQIDDKVSLA---EATRVEKEFFKRHEYFRCLLNEE---KATIQCLATKLTQDLVDHIKKSLPLLSEQIKKQL 298          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Match: ENSAMXT00000030993.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19620289:19647832:1 gene:ENSAMXG00000043681.1 transcript:ENSAMXT00000030993.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.933 bits (424), Expect = 5.727e-43
Identity = 108/307 (35.18%), Postives = 169/307 (55.05%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYY-----GLIVSDDILELTDKNERSETERRILKKMN----LWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKL 2251
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S  E+ ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + + F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I ++++NQ +P+ KGY      G    DD + L    E +  E+   K+      L N E   +  +      L+++LV  I K+LP+L   +  +L
Sbjct:   34 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVETYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIQSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDVVKNQVIPLSKGYIIVKCRGQRQIDDKVSLA---EATRVEKEFFKRHEYFRCLLNEE---KATIQCLATKLTQDLVDHIKKSLPLLSEQIRKQL 331          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 167.162 bits (422), Expect = 1.123e-42
Identity = 106/314 (33.76%), Postives = 175/314 (55.73%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTE-----TRIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA-EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I++     E +E E+   +    ++   D  +  +    E L+ ELV  I+K+LP L+  ++ KL  T ++LE + 
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQDELEKYG 325          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Match: mxa (interferon-induced GTP-binding protein Mx1-like [Source:NCBI gene;Acc:103043862])

HSP 1 Score: 167.162 bits (422), Expect = 1.123e-42
Identity = 106/314 (33.76%), Postives = 175/314 (55.73%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTE-----TRIQIKYRSEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV----SDDILELTDKNERSETERRILKKMNLWNA-EDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            I+ ID +RS+    V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M++  E      +I      E   D ++ ES+I+E Q         I+ D I++ I S     LT+IDLPG+ +  V+GQ  D+ ++   + R F+ ++ ++ + V+P N DI TT  +K A   +P+  R +G+LTK D +D+     + EI+ N+ + + KGY  +IV      +I++     E +E E+   +    ++   D  +  +    E L+ ELV  I+K+LP L+  ++ KL  T ++LE + 
Sbjct:   17 IDLIDSLRSQ---GVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKRCREEDSWHGKISYDGYEEELDDPAEVESKIREAQDKIAGVGVGISDDLISLEITSSNVPDLTLIDLPGIARVAVKGQPEDIGDQIKRLIRKFITKQETINLVVVPCNVDIATTEALKMAQVEDPNGERTLGILTKPDLVDKGTEETVVEIVNNEIINLTKGY--MIVRCRGQKEIIDRVSLTEATEKEKAFFRDHPHFSVLYDDGKATVPKLAEKLTLELVHHIEKSLPRLEEQIEAKLAETQDELEKYG 325          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Match: ENSAMXT00000016255.2 (pep primary_assembly:Astyanax_mexicanus-2.0:12:19660250:19682854:1 gene:ENSAMXG00000015797.2 transcript:ENSAMXT00000016255.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.392 bits (420), Expect = 1.173e-42
Identity = 109/307 (35.50%), Postives = 167/307 (54.40%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRK---STETRIQIKYRSE--PFKDISDTESEIKEIQTTAFNNE--ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYY-----GLIVSDDILELTDKNERSETERRILKKMN----LWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKL 2251
            I+ ID +R      + E L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ +++RK     + R  I YR E   F D S   + ++E Q     +   I  D IT+ I SP+   LT+IDLPG+ +  V+GQ  D+ ++   + R F+E+E ++ + V+P N DI TT  ++ A E +P+  R + +LTK D +D+     I +I+ NQ +P+ KGY      G    DD + L    E +  E+   K+      L N E   +  +      L+++LV  I K+LP+L   +  +L
Sbjct:   30 IDLIDSLRQ---LGIEEDLALPSIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKLRKIKGGVQWRATISYRDEYIEFDDPSLVGTYVEEAQNELAGDGVGICDDLITLEIMSPDVCDLTLIDLPGIARVPVKGQPDDIGDQIKSLIRSFIEKEQTINLVVVPCNVDIATTEALRMAQEVDPEGKRTLAILTKPDLVDKGTEKNILDIVNNQVIPLSKGYIIVKCRGQRQIDDKVSLA---EATRVEKEFFKRHEYFRCLLNEE---KATVQCLATKLTQDLVDHIKKSLPLLSEQIRKQL 327          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Match: mxb (myxovirus (influenza) resistance B [Source:NCBI gene;Acc:360143])

HSP 1 Score: 151.369 bits (381), Expect = 3.970e-38
Identity = 127/463 (27.43%), Postives = 221/463 (47.73%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKST---ETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITIS-------IQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSD--DILELTDKNERSETERRILKKMNLW-NAEDVKRFGLSNFTEA-LSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRK---NRT-ENISMFISSKPFKNIINEALIRFKKDADECVE-TCSKI 2710
            I+ ID +R      V++ + LP + V+GDQSSGKSS+L+A+SG++LPRG   VTRCP+ ++++++      RI+ + +        DT   + +    A  +E+T D + +S       + S     LT+IDLPG+ +  + GQA D+  +  ++ RD + ++ ++ + V+P N DI TT  +K A   +P   R +GVLTK D +DE        I++NQ  P+ KGY  +      D+       E S  E    KK  ++ +  +  +   +    A L++ELV  I +TLP L++++ +KL+    +LE+          Q + I D     + + K   +  N  + +Y      L   E   ++  N     +  E F+    +       + +           L+ LIR+   NR+   +  F+S   F+N+    + R +K A   +  TCSK+
Sbjct:   31 IDLIDTLRY---LGVDQDVGLPAVAVIGDQSSGKSSVLEALSGVQLPRGSGIVTRCPLALKLKRAPGPWHGRIKYRVQGRTINTKLDTPESVGDAVLQA-QSELTGDDLGVSKSLIELEVTSDSVPDLTLIDLPGIARVALAGQAVDIETQIKDLIRDHIGRQETINLVVIPCNVDIATTEALKMAQAVDPTGVRTLGVLTKPDLMDEGTERNALRILQNQVFPLSKGYVLVKCRSQRDVEAHQTLAEASRVEAAFFKKHPVFCHVHNGGKLTTTTVLAAKLTEELVDNIKRTLPKLRKDLAEKLREACAELES----------QGESIPD-----DARAKQQFI--NARVMRYNDDVRGLARGEPSRNLPRNMMLYTLVREHFRTWLKDLKRAQDAWLEE----------LDNLIREYIDNRSGRELPGFVSYHAFENLARVHVQRLEKPALNVLAVTCSKL 462          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006976.1 (pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1 gene:ENSPMAG00000006300.1 transcript:ENSPMAT00000006976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 2.863e-29
Identity = 114/409 (27.87%), Postives = 184/409 (44.99%), Query Frame = 2
Query: 1514 LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEI----RKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVE 2695
            LPRG   VTR P+++Q M    E    +  + + F D  +  +EI E +T   T  N  I+  PI + + SP  + LT+IDLPG+ K  V  Q  D+  +  E+   F+ +EN LI+ V PAN D+  +  +K A E +P   R IGV+TKLD +D+   T   +I+ N+ LP+ +GY G++     DI    D N     ER+  L   +  +  D  R G     + L+++L   I  TLP L+  +  ++ S  +++E +  +                D  +KTK +L M         ++  G  + ++  E+      N  F    HE F      F  +  +F         DEK L R     IR        +F     F+ I+ + + + K+   +CV+
Sbjct:    4 LPRGSGIVTRRPLILQLMFCKAEYAEFLHCKGKKFTDFEEVRAEI-EAETDRLTGSNKGISPIPINLRVYSPHVLNLTLIDLPGMTKVPVGDQPVDIEYQIREMLMQFVTKENCLILAVSPANTDLANSDALKIAKEVDPQGLRTIGVITKLDLMDDG--TDARDILENKLLPLRRGYIGVVNRSQKDIDGRKDINAAMAAERKFFLSHPSYRHMAD--RMGTPYLQKTLNQQLTNHIRDTLPALRNKLQGQMLSMEKEVEEYKNFRPD-------------DPTRKTKALLQMVQQFAFDFEKRIEGSGDQIDTVELSGGARINRIF----HERFP-----FELVKMEF---------DEKELRREISYAIRNINGIRTGLFTPDLAFEAIVKKQIQKLKEPCLKCVD 376          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002816.1 (pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-1 gene:ENSPMAG00000002541.1 transcript:ENSPMAT00000002816.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.568e-27
Identity = 116/489 (23.72%), Postives = 215/489 (43.97%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----------------RKSTETRIQ-------------IKYRSEPFKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTL-PILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYK----DFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIEN 2731
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+++ G   LPRG   VTR P+V+Q+                   ST  R+              +  +++ + D ++   EI+    + T  N  I+ + I + I SP  + LT++DLPG+ K  V  Q  D+ ++  E+   F+   NS+I+ V  AN D+ T+  +K A E + D  R + V+TKLD +D     +  +I+  + +P++ G  G++    +    D N    T++ IL  M     +D + F    +    ++     + KTL  +L  ++ D L     ++   +  Y S       +      ++ K   +L +      +Y    E   +    S + G     Y++HE F     + + +      D   A              IR       ++F+    F+ ++   + R ++ +  CVE   + +  II++
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLESLVGRDFLPRGTGIVTRRPLVLQLVHVIPDERIRPGGEENGTASTAARLILFAGVEAEEWGKFLHTKNKVYSDFNEIRQEIENETERITGTNKGISSEAIHLKIFSPHVLNLTLVDLPGITKVPVGDQPVDIEQQIRELIIKFIGNPNSIILAVTAANTDLATSEALKIAREVDTDGRRTLAVITKLDLMDAGTDAM--DILTGRVIPVKLGIIGVVNRSQL----DIN----TKKTILDAM-----QDEQSFMQKKYPSLANRNGTKFLGKTLNRLLMHHIRDCLPELKTRVNVMAAQYQS------LLGGYGNPVDDKNATLLQLVTKFAAEYCNTIEGTAKHIETSELCGGARICYIFHETFGRTLESVDPLGGLTTLDVLTA--------------IRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQH 458          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 92.0485 bits (227), Expect = 4.662e-19
Identity = 62/230 (26.96%), Postives = 120/230 (52.17%), Query Frame = 2
Query: 1403 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DISD--TESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLIVS 2053
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++  
Sbjct:  208 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVVTG 436          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Match: opa1 (OPA1 mitochondrial dynamin like GTPase [Source:NCBI gene;Acc:492332])

HSP 1 Score: 91.6633 bits (226), Expect = 5.170e-19
Identity = 62/230 (26.96%), Postives = 120/230 (52.17%), Query Frame = 2
Query: 1403 SKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVN-TVTRCPVVMQMRKSTETRIQIKYRSEPFK-----DISD--TESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVT---LIPEIIRNQKLPIEK-GYYGLIVS 2053
            S + A+ N   +LP+++VVGDQSSGK+S+L+ I+  ++ PRG    +TR PV + + +        K  S  F      D++    E EI+  ++    + ++ + I++S++ P    + ++DLPG++     G A D  +    +++ +M+  N++I+C+   + D   +      +  +P   R I VLTK+D L EK +     I +I+  +  P++  GY+ ++  
Sbjct:  218 SDYDANYNTQDQLPRVVVVGDQSSGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHVAIFKDSSREFDLTKEDDLAALRKEIEIRMKKSVKEGHTVSAETISLSVKGPGLQRMVLVDLPGVISTMTSGMAPDTKDAIFAMSKGYMQNPNAIILCIQDGSVDAERSIVTDLVSNMDPQGKRTIFVLTKVD-LAEKNLASPNRIQQILDGKLFPMKALGYFAVVTG 446          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Yeast
Match: VPS1 (Dynamin-like GTPase required for vacuolar sorting; also involved in actin cytoskeleton organization, endocytosis, late Golgi-retention of some proteins, regulation of peroxisome biogenesis [Source:SGD;Acc:S000001709])

HSP 1 Score: 132.109 bits (331), Expect = 5.605e-32
Identity = 138/512 (26.95%), Postives = 233/512 (45.51%), Query Frame = 2
Query: 1361 EKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM-----RKSTETRIQI--------------KYRSEPFKDISDTESE---------------------------IKEI-QTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVE--GNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENI-SMFISSKPFKNIINEALIRFKKDA--------DECVETCSKII 2713
            E  I  IN + +  +         + LPQI VVG QSSGKSS+L+ I G   LPRG   VTR P+V+Q+     +KS   ++                K + E  K  ++ +SE                           +KE  + T  N+ I+  PI + I SP  +TLT++DLPGL K  V  Q  D+  +  ++   ++ + N++I+ V  AN D+  +  +K A E +P+ +R IGVLTK+D +D+   T + +I+  + +P+  GY  +I     DI       E  E ER+  +    ++++     G     + L+  L+  I +TLP +K  ++  LK          KY      Q + I+   + ++  +  +L M      +Y GI +   E + LSS E  G     Y++HE FK+  ++      D FD    + +D     R I  N + +  S+F+ ++ F+ ++ + + RF++ +        DE V    +II
Sbjct:    3 EHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSSVLENIVGRDFLPRGTGIVTRRPLVLQLINRRPKKSEHAKVNQTANELIDLNINDDDKKKDESGKHQNEGQSEDNKEEWGEFLHLPGKKFYNFDEIRKEIVKETDKVTGANSGISSVPINLRIYSPHVLTLTLVDLPGLTKVPVGDQPPDIERQIKDMLLKYISKPNAIILSVNAANTDLANSDGLKLAREVDPEGTRTIGVLTKVDLMDQG--TDVIDILAGRVIPLRYGYIPVINRGQKDIEHKKTIREALENERKFFENHPSYSSK-AHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIEATLK----------KY------QNELINLGPETMDSASSVVLSMITDFSNEYAGILD--GEAKELSSQELSGGARISYVFHETFKNGVDSL-----DPFD----QIKDSDI--RTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRFEEPSLRLVTLVFDELVRMLKQII 482          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Yeast
Match: DNM1 (Dynamin-related GTPase involved in mitochondrial organization; required for mitochondrial fission and inheritance; self assembles on the cytoplasmic face of mitochondrial tubules at sites where division will occur; participates in endocytosis and regulates peroxisome fission along with Vps1p; mutants in the human ortholog DNM1L, which mediates mitochondrial fission, peroxisomal division, autophagy, and mitophagy, are associated with slowly progressive infantile encephalopathy [Source:SGD;Acc:S000003924])

HSP 1 Score: 110.153 bits (274), Expect = 6.070e-25
Identity = 93/334 (27.84%), Postives = 156/334 (46.71%), Query Frame = 2
Query: 1427 EALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTE------------------TRIQ--------IKYRSEP-----------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI-VSDDILELTDKNERS-ETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFS 2284
            + L LP + VVG QSSGKSSIL+ + G   LPRG   VTR P+V+Q+   +                   T+I         ++YR +                  F D  D + EI+    +    +  I+K PI + + SP  + LT++DLPG+ K  +  Q  D+ ++   +  D++   N LI+ V PAN D+  + ++K A E +P   R IGV+TKLD +D     L  +I+  +  P++ G+ G++  S   ++L    E S + E    +K  ++     K  G     + L++ L+  I   LP +K  ++  +  T ++L  + 
Sbjct:   24 DTLDLPILAVVGSQSSGKSSILETLVGRDFLPRGTGIVTRRPLVLQLNNISPNSPLIEEDDNSVNPHDEVTKISGFEAGTKPLEYRGKERNHADEWGEFLHIPGKRFYDFDDIKREIENETARIAGKDKGISKIPINLKVFSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILDYIATPNCLILAVSPANVDLVNSESLKLAREVDPQGKRTIGVITKLDLMDSGTNAL--DILSGKMYPLKLGFVGVVNRSQQDIQLNKTVEESLDKEEDYFRKHPVYRTISTK-CGTRYLAKLLNQTLLSHIRDKLPDIKTKLNTLISQTEQELARYG 354          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Yeast
Match: MGM1 (Mitochondrial GTPase, present in complex with Ugo1p and Fzo1p; required for mitochondrial morphology, fusion, and genome maintenance; promotes membrane bending; exists as long and short form with different distributions; ratio of long to short forms is regulated by Psd1p; homolog of human OPA1 involved in autosomal dominant optic atrophy [Source:SGD;Acc:S000005737])

HSP 1 Score: 106.686 bits (265), Expect = 8.423e-24
Identity = 63/211 (29.86%), Postives = 119/211 (56.40%), Query Frame = 2
Query: 1433 LKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTET-RIQIKY---RSEPFKDISDTESEIKEIQTTAFNNE-ITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI 2047
            L LP I+V+G QSSGKSS+L++I G + LP+G N VTR P+ + +  +  +  +   +   R    KD  + +  + E+      +E ++++PI ++I+S     L+++DLPG ++ +   Q  ++  K  ++   ++   N +I+ +  A+ D+  ++ +K +   +P   R IGV+TKLD +D ++      I+ N+K P+  GY G+I
Sbjct:  208 LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNSNNVTADFPSMRLYNIKDFKEVKRMLMELNMAVPTSEAVSEEPIQLTIKSSRVPDLSLVDLPGYIQVEAADQPIELKTKIRDLCEKYLTAPN-IILAISAADVDLANSSALKASKAADPKGLRTIGVITKLDLVDPEKAR---SILNNKKYPLSMGYVGVI 414          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Nematostella
Match: EDO32191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT4])

HSP 1 Score: 150.599 bits (379), Expect = 1.853e-38
Identity = 125/456 (27.41%), Postives = 219/456 (48.03%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQMRKSTETRIQIKY-RSEPFKDISDTESEI--KEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERR-ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVM-----ENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLER----LIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVE 2695
            I  +++++  F++   +  + LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+++Q++ S     +  + R++ F D  + + EI  +  + T  N  I+  PI + + SP  ++LT++DLPG+ K  V  Q  D+  +   +  +F+ +EN LI+ V PAN D+  +  +K A E +P  +R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D       ER+  L   +  +  D  + G     + L+++L   I  TLP L+  + D L +  ++++ +  Y               +D+  +TK ++ M      + E +   G  + +N  E+    + N  F    HE F      +  +  +F         DEK L R     I+      + +F     F+ I+   + + +  A +CV+
Sbjct:   10 IPIVNKIQDAFASIGYSSMIDLPQIAVVGSQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLQPSKSEYAEFLHCRNKKFTDFGEVQKEIVAETDRVTGGNKGISNIPINLRVYSPSVLSLTLVDLPGMTKVPVGDQPADIEFQIRSMLLEFITKENCLILAVSPANSDLANSDALKIAREVDPQGARTIGVITKLDLMDEG--TDARDILENRVLPLRRGYIGIVNRSQADIDGRKDIRAALAAERKFFLSNPSYRHMAD--KMGTQYLQKVLNQQLTNHIKDTLPALRSKLQDNLLALEKEVKGYENYNP-------------RDLSVRTKALMQMMQTFSADFE-KAIEGSGDSINTVELSGGAKINRIF----HERFP-----YELVKMEF---------DEKQLRREIMFAIKNIHGIRVGLFTPDMAFEAIVKRQIDKLRSPAIKCVD 429          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Nematostella
Match: EDO34895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN34])

HSP 1 Score: 138.272 bits (347), Expect = 1.760e-33
Identity = 130/504 (25.79%), Postives = 230/504 (45.63%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQM----RKSTETRIQI---------KYRSEP-------------FKDISDTESEIKE--IQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLW--NAEDV-KRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQK-KYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAI----YKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLH 2779
            I  I++++  F+   +E+++LPQI+VVG QSSGKSS+L+ + G   LPRG   VTR P+++Q+     ++ E +I            + +EP             F+D +    EI+    + T  N  I+ +PI + I SP+ + LT++DLPG+ K  V  Q  D+ ++   +   ++   NS+I+ V PAN D+ T+  +K A E +PD  R + V TKLD +D     +  +++  + +P++ G  G++    +    D N R   E  +  + + +  N   V  R G     + L+K L+  I   LP LK  V+      +  L++    YG   + K  Y+  +I        +++    HEI           ET   S + G     Y++H+IF       +A+     +D   A              IR       ++F+    F+ ++   + R ++ +  C+E   + +  II++     +E K  P +LH
Sbjct:    5 IPVINKLQDVFNTVGSESIQLPQIVVVGAQSSGKSSVLENLVGRDFLPRGSGVVTRRPLILQLVHVPPRAKEKKINELPDKKEAAEDHDAEPAEWGKFLHLKEKIFRDFNGIREEIERETDRVTGSNKGISSEPINLKIYSPKVLNLTLVDLPGVTKVPVGDQPLDIEQQIRHLILQYISNPNSIILAVTPANIDLATSEALKIAREVDPDGHRTLAVCTKLDLMDHGTDAM--DVLYGRVIPVKLGIIGVVNRSQL----DINNRKSIENALRDEADFFARNYPTVASRNGTPYLAKTLNKLLMHHIRNCLPELKSRVNSMTSQYHHLLQS----YGEPVMDKGPYLLQMITRFAATYCSIIEGTAHEI-----------ET---SELCGGARICYIFHDIFGRTLTIMDAMEGLSTRDILTA--------------IRNATGPRPALFVPEISFELLVKRQIRRLEEPSLRCIELVHEEMQRIIQHSFDQVMEIKRFP-RLH 469          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Nematostella
Match: EDO40359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7A7])

HSP 1 Score: 93.2041 bits (230), Expect = 2.792e-19
Identity = 59/230 (25.65%), Postives = 119/230 (51.74%), Query Frame = 2
Query: 1394 EMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKL-PRGVNTV-TRCPVVMQMRKSTETRIQIKYRSEPF-----KDISDT--ESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEV--TLIPEIIRNQKLPIEK-GYYGLI 2047
            ++ +++    N    LP+++VVGDQS+GK+S+L+ I+  ++ PRG   + TR PV++ + +      Q K  S  F     K++ D   E E++  ++      ++ + I+++++ P    + ++DLPG++     G A        +I+R +ME  N++I+C+     D   +      +  +P   R I VLTK+D  ++ E   + I +I+     P++  GY+ ++
Sbjct:   14 DLLAEYDVSYNTTDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGQMMTRSPVMVTLSEGPNHIAQFKGNSRQFDLTQEKELKDLRHEVELRMKRSVKQGQTVSPEVISMTVKGPGLHRMVLVDLPGIIGTTTTGMAESTKSDILDISRRYMENPNAIILCIQDGAIDAERSNVTDLVSSMDPQGKRTIFVLTKVDLAEQNETSPSRIKQILEGNLFPMKALGYFAVV 243          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Match: mxb (interferon-induced GTP-binding protein Mx [Source:NCBI gene;Acc:101163162])

HSP 1 Score: 172.94 bits (437), Expect = 1.247e-44
Identity = 133/458 (29.04%), Postives = 232/458 (50.66%), Query Frame = 2
Query: 1379 INFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRI---QIKYR--SEPFKDISDTESEIKEIQ--TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKR-----------------FGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDA 2680
            I+ ID +RS     V + L LP I V+GDQSSGKSS+L+A+SG+ LPRG   VTRCP+ ++M+K T+ +    +I YR  +E  ++ ++ E  I + Q         I+ + I++ I SP    LT+IDLPG+ +  V+GQ  ++ E+  ++   F+ ++ ++ + V+P N DI TT  +K A E +P+  R +G+LTK D +D+     + +II N+ +P++KGY  +IV            R   ++ I KK++L  A + +R                   +    E L+ ELV  I K+LP L+  ++ KLK T  KL+       SE  +K  +  +I  +   T++ + +   E  + G       +++I S              + +  F ++N + +D        +  EK + +  RK R + +  FI+ K F+ ++ E + + ++ A
Sbjct:   16 IDLIDSLRS---LGVEKDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLELKMKKITKGQKWNGKIHYRDFAEEIQEPANVEQNICQAQDKMAGVGVGISDELISLEIASPNVPDLTLIDLPGITRVAVKGQPANIGEQIKKLIWKFIGKQETINLVVVPCNVDIATTEALKMAQEVDPEGERTLGILTKPDLVDKGTEETVVDIINNKAIPLKKGY--MIV------------RCRGQKEITKKVSLTTALEKERNFFQEHSHFQTLYYDGHASVPKLAEKLTLELVHHIQKSLPHLEEQIETKLKQTQSKLDNLGCGPPSEPSEK--LGFLIDKVTSFTQDAVYLSKGEDLRCG------YKSKIFS--------------VLRQRFASWNLLIED--SGTTFSWNIEKEVAQYDRKYRGKELPGFINYKTFEAMVQEQVKQLEEPA 432          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 162.54 bits (410), Expect = 2.058e-40
Identity = 158/577 (27.38%), Postives = 263/577 (45.58%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDE-KYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKY 3067
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q M   TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D N     ER+       +      R G     + L+++L   I  TLP L+  +  +L S  +++E +  +                D  +KTK +L M       +    E   +    + + G      ++HE F      F  +  +F   N  + R E  Y  + I   RT    +F     F+ I+   + + K       E C+K +  +I  +++T  +   KL+    L+  +++I  + + D++ + +  +  L D E SY     M  +++ F    +A + +  +NK        A    E++  R   L + +  I K G ++Y
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYR-HLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPD-------------DPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFP-----FELVKMEF---NEKELRKEISYAIKNIHGIRT---GLFTPDMAFETIVKRQIGKIK-------EPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSY-----MNTNHEDFIGFANAQQRINQINKKK-----AAGNQDEIMVIRKGWLTINNIGIMKGGAKEY 541          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 162.54 bits (410), Expect = 2.300e-40
Identity = 150/539 (27.83%), Postives = 249/539 (46.20%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDE-KYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q M   TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D N     ER+       +      R G     + L+++L   I  TLP L+  +  +L S  +++E +  +                D  +KTK +L M       +    E   +    + + G      ++HE F      F  +  +F   N  + R E  Y  + I   RT    +F     F+ I+   + + K       E C+K +  +I  +++T  +   KL+    L+  +++I  + + D++ + +  +  L D E SY     M  +++ F    +A + +  +NK
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYR-HLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPD-------------DPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFP-----FELVKMEF---NEKELRKEISYAIKNIHGIRT---GLFTPDMAFETIVKRQIGKIK-------EPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSY-----MNTNHEDFIGFANAQQRINQINK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 162.155 bits (409), Expect = 2.629e-40
Identity = 150/539 (27.83%), Postives = 249/539 (46.20%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDE-KYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q M   TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D N     ER+       +      R G     + L+++L   I  TLP L+  +  +L S  +++E +  +                D  +KTK +L M       +    E   +    + + G      ++HE F      F  +  +F   N  + R E  Y  + I   RT    +F     F+ I+   + + K       E C+K +  +I  +++T  +   KL+    L+  +++I  + + D++ + +  +  L D E SY     M  +++ F    +A + +  +NK
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYR-HLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPD-------------DPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFP-----FELVKMEF---NEKELRKEISYAIKNIHGIRT---GLFTPDMAFETIVKRQIGKIK-------EPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSY-----MNTNHEDFIGFANAQQRINQINK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Match: dnm1a (dynamin 1 [Source:NCBI gene;Acc:101157793])

HSP 1 Score: 162.155 bits (409), Expect = 2.661e-40
Identity = 150/539 (27.83%), Postives = 249/539 (46.20%), Query Frame = 2
Query: 1379 INFIDEMRSKFSA-DVNEALKLPQIIVVGDQSSGKSSILQAISGIK-LPRGVNTVTRCPVVMQ-MRKSTETRIQIKYRSEPFKDISDTESEIKEIQT---TAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLI--VSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDE-KYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLAT--EIEPKLSP---LQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK 2953
            I  ++ M+  F+A   N  L LPQI VVG QS+GKSS+L+   G   LPRG   VTR P+V+Q M   TE    +  + + F D  +   EI E +T   T  N  I+  PI + + SP  + LT++DLPG+ K  V  Q  D+  +  ++   F+ +EN L++ V PAN D+  +  +K A E +P   R IGV+TKLD +DE   T   +I+ N+ LP+ +GY G++     DI    D N     ER+       +      R G     + L+++L   I  TLP L+  +  +L S  +++E +  +                D  +KTK +L M       +    E   +    + + G      ++HE F      F  +  +F   N  + R E  Y  + I   RT    +F     F+ I+   + + K       E C+K +  +I  +++T  +   KL+    L+  +++I  + + D++ + +  +  L D E SY     M  +++ F    +A + +  +NK
Sbjct:   10 IPMVNRMQDAFTAIGQNANLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLVLQLMNSPTEHAEFLHCKGKKFTDFDEVRQEI-EAETDRVTGANKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPADIEAQIRDMLLQFVTKENCLMLAVSPANSDLANSDALKIAKEVDPQGLRTIGVITKLDLMDEG--TDAKDILENKLLPLRRGYIGVVNRSQKDIDGKKDINAAIAAERKFFLSHPAYR-HLADRMGTPYLQKVLNEQLTNHIRDTLPALRSKLQSQLLSIEKEVEEYKNFRPD-------------DPSRKTKVLLQMVQQFSVDFDKCIEGSGDKIDTAELSGGAKINRIFHERFP-----FELVKMEF---NEKELRKEISYAIKNIHGIRT---GLFTPDMAFETIVKRQIGKIK-------EPCTKCVDMVISELVSTVRQCTKKLAQYPLLREEMERIVTQHIRDRERDTKEQVLLLIDIELSY-----MNTNHEDFIGFANAQQRINQINK 508          
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Match: SMESG000002124.1 (SMESG000002124.1)

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 431/475 (90.74%), Postives = 452/475 (95.16%), Query Frame = 2
Query: 1343 RMTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSP 2767
            RM +AKE+WIKKI+ IDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEI+EIQ   F +EITKDPITI IQSPE VTLTIIDLPGLVKADVRGQA DMIEKTHEIARDFM  ENSLIICVLPANQDICTTTTI+EATECNP KSRIIGVLTKLDKLDEKEVTLI EIIRNQKLPIEKGYYGLIV+ +ILELTDK++RSETERRILK  NLWNAEDVKRFGLSNFTEALSKELV+LI+KTLPIL+RNVDDKLKST + LETFSKYYGSEEIQKKYIS+IIKDIEKKTKNMLVMENHEIRKYGGIKEFL ETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTEN+SMFISSKPFKNI+NE LIRFK  A+ECVETC +IILFII+NVLATEIEPKLSP
Sbjct:   46 RMYLAKEEWIKKIDLIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIREIQHNVFKDEITKDPITIRIQSPEVVTLTIIDLPGLVKADVRGQARDMIEKTHEIARDFMMLENSLIICVLPANQDICTTTTIREATECNPGKSRIIGVLTKLDKLDEKEVTLILEIIRNQKLPIEKGYYGLIVNTEILELTDKDDRSETERRILKAKNLWNAEDVKRFGLSNFTEALSKELVVLINKTLPILRRNVDDKLKSTTDNLETFSKYYGSEEIQKKYISEIIKDIEKKTKNMLVMENHEIRKYGGIKEFLKETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENMSMFISSKPFKNIVNEVLIRFKVKANECVETCCEIILFIIDNVLATEIEPKLSP 520          
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Match: SMESG000002124.1 (SMESG000002124.1)

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 430/474 (90.72%), Postives = 451/474 (95.15%), Query Frame = 2
Query: 1346 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSP 2767
            M +AKE+WIKKI+ IDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEI+EIQ   F +EITKDPITI IQSPE VTLTIIDLPGLVKADVRGQA DMIEKTHEIARDFM  ENSLIICVLPANQDICTTTTI+EATECNP KSRIIGVLTKLDKLDEKEVTLI EIIRNQKLPIEKGYYGLIV+ +ILELTDK++RSETERRILK  NLWNAEDVKRFGLSNFTEALSKELV+LI+KTLPIL+RNVDDKLKST + LETFSKYYGSEEIQKKYIS+IIKDIEKKTKNMLVMENHEIRKYGGIKEFL ETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTEN+SMFISSKPFKNI+NE LIRFK  A+ECVETC +IILFII+NVLATEIEPKLSP
Sbjct:    1 MYLAKEEWIKKIDLIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIREIQHNVFKDEITKDPITIRIQSPEVVTLTIIDLPGLVKADVRGQARDMIEKTHEIARDFMMLENSLIICVLPANQDICTTTTIREATECNPGKSRIIGVLTKLDKLDEKEVTLILEIIRNQKLPIEKGYYGLIVNTEILELTDKDDRSETERRILKAKNLWNAEDVKRFGLSNFTEALSKELVVLINKTLPILRRNVDDKLKSTTDNLETFSKYYGSEEIQKKYISEIIKDIEKKTKNMLVMENHEIRKYGGIKEFLKETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENMSMFISSKPFKNIVNEVLIRFKVKANECVETCCEIILFIIDNVLATEIEPKLSP 474          
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Match: SMESG000002216.1 (SMESG000002216.1)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 452/652 (69.33%), Postives = 532/652 (81.60%), Query Frame = 2
Query: 1346 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDALEWDILYPQKSLTYFSLTAXXXXXXXXXXXTRKSLNQYSKQLNDFHC 3301
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV+DDIL+LT+K+E  +TE++ILK+  LW+ ED+KRFGLSNFT+AL  EL  LIDKTLPIL+ NVD  L  TN KLETFSKY+GSEEIQKKY+S+ IK+IE KTK +LV   HEI+ Y  IK +L +  ILSS+  +ETF+Y+W  +F +LF  F +IY++ F    GKY  ++YLE + +KNRTENI +FISS  FK I+NEAL+ FKK  DECV  C  II FIIE +L  +IE KLSPL++ IQKI R++LS+KK+EIE  LTFLF SE +YF+   +          IDA    +L  +P+LV G  A    E +++RN       G+I K+ L+ YL  A+ +L +VIP+FI+++LFIDFSKSL +ALE +ILY + SL+YFSLT +E+ E+E LR+T+  L +YS +LND+HC
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILQLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYYSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDECVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIV----------IDAGVVPQL--QPALVTGQNAPQSTENLQTRN-------GRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKVEIERLRQTKLMLEEYSSKLNDYHC 633          
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Match: SMESG000002004.1 (SMESG000002004.1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 451/652 (69.17%), Postives = 531/652 (81.44%), Query Frame = 2
Query: 1346 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDALEWDILYPQKSLTYFSLTAXXXXXXXXXXXTRKSLNQYSKQLNDFHC 3301
            M +AKE+WIKKI+FIDEMRSKFSA+VNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVT+CPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV+DDIL+LT+K+E  +TE++ILK+  LW+ ED+KRFGLSNFT AL  EL  LIDKTLPIL+ NVD  L  TN KLETFSKY+GSEEIQKKY+S+ IK+IE KTK +LV   HEI+ Y  IK +L +  ILSS+  +ETF+Y+W  +F +LF  F +IY++ F    GKY  ++YLE + +KNRTENI +FISS  FK I+NEAL+ FKK  D+CV  C  II FIIE +L  +IE KLSPL++ IQKI R++LS+KK+EIE  LTFLF SE +YF+   +          IDA    +L  +P+LV G  A    E +++RN       G+I K+ L+ YL  A+ +L +VIP+FI+++LFIDFSKSL +ALE +ILY + SL+YFSLT +E+ E+E LR+T+  L +YS +LND+HC
Sbjct:    1 MYLAKEEWIKKIDFIDEMRSKFSAEVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTKCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILKLTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTYALVDELGWLIDKTLPILRENVDKLLAKTNGKLETFSKYHGSEEIQKKYMSEKIKEIENKTKYLLVNGKHEIQNYTKIKNYLEKKRILSSIHEHETFIYLWDTVFSNLFKEFFSIYQELFADYSGKYHSDQYLEDINKKNRTENIPVFISSTLFKKIVNEALLNFKKKVDKCVNVCCHIISFIIEEILIMDIEDKLSPLKMDIQKISRRVLSEKKLEIEKYLTFLFQSEHTYFTQAIV----------IDAGVVPQL--QPALVTGQNAPQPTENLQTRN-------GRILKDCLKNYLINAVRKLGDVIPSFIKQSLFIDFSKSLIEALETEILYSKMSLSYFSLTDQEKGEIERLRQTKLMLEEYSSKLNDYHC 633          
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Match: SMESG000002025.1 (SMESG000002025.1)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 431/657 (65.60%), Postives = 522/657 (79.45%), Query Frame = 2
Query: 1346 MTVAKEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQTTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTHEIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERRILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKSTNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGIKEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYRDEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSKIILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDSERSYFSSYEMAKSYDKFTSGIDAAETLRLLNK-------PSLVFGTTASFGVELVKSRNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTDALEWDILYPQKSLTYFSLTAXXXXXXXXXXXTRKSLNQYSKQLNDF 3295
            M ++KE+WIKKI+FIDEMRS+FS   NE LKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKS+ T+ QI+YRSEPFKDISDTESEI EIQ  AFNNE+TKDPITISIQSPESVTLTIIDLPGLVKADV+GQA+DMIEKTHEIARDFM QENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIV+DDILELT+K+E  +TE++ILK+  LW+ ED+KRFGLSNFT+AL  EL  LIDKTLP+L+ NVD+ LK TN KL++FSKY G +E+QKK+IS+ IKDIE KTKN+LV   HEI  Y   K FL +  IL S++ +ETFLYMWH +F  L+  FN ++++ F+   GKYR E +LE + +KNRTE+I ++ISS+ FK I+ EAL++F++  DECV+ C +II FII++VL  + E KL PL+  IQKI R++L +K++EIEN LTFLF SER+YF+   + +     T+  +   T    NK        S++FGT  S          +N +  +GKI K  L KYL  AI +L +VIP FI+++LF+DFS SLT ALE ++LY  KSL+YF+LT E++ ELE LRE+RKSL +YSK+LNDF
Sbjct:    1 MYLSKEEWIKKIDFIDEMRSRFSVAENEMLKLPQIIVVGDQSSGKSSILQAISGIKLPRGVNTVTRCPVVMQMRKSSVTKTQIRYRSEPFKDISDTESEINEIQRNAFNNEVTKDPITISIQSPESVTLTIIDLPGLVKADVQGQASDMIEKTHEIARDFMMQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKLDKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVNDDILELTNKDEIKKTEKKILKEKKLWSLEDIKRFGLSNFTDALVDELGWLIDKTLPVLRSNVDNLLKITNGKLDSFSKYQGGDEVQKKFISEKIKDIENKTKNLLVKGKHEIFGYDNFKCFLEKNGILDSIKEHETFLYMWHNVFNGLYGKFNCVFEELFNDGYGKYRKENHLENINKKNRTEDIPIYISSRLFKKIVEEALLKFREKTDECVKLCCRIISFIIQDVLVKDFEVKLLPLKKDIQKISRRVLKEKEVEIENYLTFLFKSERTYFTQDTIIEGQAVLTAQ-NLVPTSNAGNKLFSNQQSNSILFGTNIS---------PENFQTENGKILKHCLTKYLKNAIRKLGDVIPCFIKQSLFVDFSASLTAALEMEVLYSNKSLSYFALTDEDRNELERLRESRKSLKEYSKRLNDF 647          
The following BLAST results are available for this feature:
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MX23.405e-4331.55MX dynamin like GTPase 2 [Source:HGNC Symbol;Acc:H... [more]
MX13.977e-3926.25MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
MX13.977e-3926.25MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
MX13.977e-3926.25MX dynamin like GTPase 1 [Source:HGNC Symbol;Acc:H... [more]
DNM27.214e-3827.09dynamin 2 [Source:HGNC Symbol;Acc:HGNC:2974][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dyn-12.082e-3628.70Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
dyn-12.404e-3628.70Dynamin [Source:UniProtKB/Swiss-Prot;Acc:P39055][more]
drp-13.735e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.735e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
drp-13.735e-2632.60Dynamin-related protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shi4.308e-3631.63gene:FBgn0003392 transcript:FBtr0333717[more]
shi4.641e-3631.63gene:FBgn0003392 transcript:FBtr0074122[more]
shi4.641e-3631.63gene:FBgn0003392 transcript:FBtr0074121[more]
shi4.641e-3631.63gene:FBgn0003392 transcript:FBtr0074119[more]
shi4.641e-3631.63gene:FBgn0003392 transcript:FBtr0111037[more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxe2.596e-4326.20myxovirus (influenza virus) resistance E [Source:N... [more]
mxa3.803e-4329.17myxovirus (influenza) resistance A [Source:NCBI ge... [more]
mxb5.960e-4233.53myxovirus (influenza) resistance B [Source:NCBI ge... [more]
mxc4.000e-4126.45myxovirus (influenza virus) resistance C [Source:N... [more]
dnm1b1.914e-3927.21dynamin 1b [Source:ZFIN;Acc:ZDB-GENE-100920-3][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnpepl12.655e-4233.63arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
krt173.957e-3735.19keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
krt177.068e-3735.19keratin 17 [Source:Xenbase;Acc:XB-GENE-490369][more]
dcbld28.922e-3726.37discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
dcbld21.012e-3626.37discoidin, CUB and LCCL domain containing 2 [Sourc... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mx21.526e-4029.16MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
Mx21.785e-3832.37MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
Dnm21.918e-3827.09dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
Dnm22.197e-3827.09dynamin 2 [Source:MGI Symbol;Acc:MGI:109547][more]
Mx22.329e-3832.37MX dynamin-like GTPase 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91196|MX2_ONCMY2.578e-4735.85Interferon-induced GTP-binding protein Mx2 OS=Onco... [more]
sp|Q6PW23|MX_EPICO7.935e-4729.96Interferon-induced GTP-binding protein Mx OS=Epine... [more]
sp|Q91192|MX1_ONCMY3.258e-4635.35Interferon-induced GTP-binding protein Mx1 OS=Onco... [more]
sp|Q91197|MX3_ONCMY1.399e-4535.03Interferon-induced GTP-binding protein Mx3 OS=Onco... [more]
sp|P20592|MX2_HUMAN1.635e-4231.55Interferon-induced GTP-binding protein Mx2 OS=Homo... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A060YH961.998e-4535.16Dynamin-type G domain-containing protein OS=Oncorh... [more]
B5X1G21.208e-4435.69Interferon-induced GTP-binding protein Mx OS=Salmo... [more]
A0A4Y5LAJ91.223e-4435.85Interferon-induced GTP-binding protein Mx4 OS=Onco... [more]
Q0ZIJ21.564e-4429.32Interferon-induced Mx protein OS=Epinephelus coioi... [more]
Q0ZIJ12.288e-4429.96Interferon-induced Mx protein OS=Epinephelus coioi... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057014.13.102e-4335.18pep primary_assembly:Astyanax_mexicanus-2.0:12:195... [more]
ENSAMXT00000030993.15.727e-4335.18pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
mxa1.123e-4233.76interferon-induced GTP-binding protein Mx1-like [S... [more]
mxa1.123e-4233.76interferon-induced GTP-binding protein Mx1-like [S... [more]
ENSAMXT00000016255.21.173e-4235.50pep primary_assembly:Astyanax_mexicanus-2.0:12:196... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb3.970e-3827.43myxovirus (influenza) resistance B [Source:NCBI ge... [more]
ENSPMAT00000006976.12.863e-2927.87pep scaffold:Pmarinus_7.0:GL476397:441685:463496:1... [more]
ENSPMAT00000002816.11.568e-2723.72pep scaffold:Pmarinus_7.0:GL477440:180226:202414:-... [more]
opa14.662e-1926.96OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
opa15.170e-1926.96OPA1 mitochondrial dynamin like GTPase [Source:NCB... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
VPS15.605e-3226.95Dynamin-like GTPase required for vacuolar sorting;... [more]
DNM16.070e-2527.84Dynamin-related GTPase involved in mitochondrial o... [more]
MGM18.423e-2429.86Mitochondrial GTPase, present in complex with Ugo1... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO321911.853e-3827.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348951.760e-3325.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403592.792e-1925.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxb1.247e-4429.04interferon-induced GTP-binding protein Mx [Source:... [more]
dnm1a2.058e-4027.38dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a2.300e-4027.83dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a2.629e-4027.83dynamin 1 [Source:NCBI gene;Acc:101157793][more]
dnm1a2.661e-4027.83dynamin 1 [Source:NCBI gene;Acc:101157793][more]
back to top
BLAST of Interferon-induced GTP-binding protein Mx vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002124.10.000e+090.74SMESG000002124.1[more]
SMESG000002124.10.000e+090.72SMESG000002124.1[more]
SMESG000002216.10.000e+069.33SMESG000002216.1[more]
SMESG000002004.10.000e+069.17SMESG000002004.1[more]
SMESG000002025.10.000e+065.60SMESG000002025.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013661 ID=SMED30013661|Name=Interferon-induced GTP-binding protein Mx|organism=Schmidtea mediterranea sexual|type=transcript|length=3409bp
TGGGAATTTATCAATTCAATTTACTTTACTTTAAGCTTTAATATATGATA
AATGATAAATATTTTTTAAACTCTTTAAAATAAATTATTTACTTTTTAAA
TGTTAATTTAAATATGTTGACTGTTATTTTAATTACACTCGATTTTTATG
TATTTTTATGATGTCATTATTAATAACTTATTTAGAAGTATTTAAGATTT
TTATATTTTCCATTACTCTATGTTCAAATCTATCAATCGATCGAACTGAT
AAATTCCCAATTCACGTTAATTCTTCATTCCACATCCTATTCAAAACGGT
CAAAACATATTCACCGTTTTTGTTGGTAAAATTACAAATCGTTCGTCGAT
CTGAAATCGAAGAAACAGCTTTTATTAATCCTGGAATTGAGAACAATTTG
GAAAATAAAATCAGCAATAAATATATGTCAGTAATCAATTGGCATAAGAA
CACGTACAGAGCAATCGAAATGATAATTCAATTTCATCCTCCAGCAAATG
GATTGATTTTTGAAATTTTATATTTTGACTCTGAAACTGCGAACGATCGA
TATAATGCTTTCAGAAATCCTTCGGTTATGAATCGGATTTTCTCGGAACA
AATTCAACTAAAAATCGATGCGATTTTGGATTTTTATATCGCCACGCGAG
ATGGCCGAACCGATGGAGTGAACAGCGAGGAAATGGCCGTAATATCGTGC
GAATCCAAGAACGGAGTTCCTCCAGGCCGGCCGATATTGAAATATATCGA
TCAGTTGGATGTGAAAAACCGGAAATTTCACGAGGCCGACAACAGAATCG
TTGTTCATGCGTTCCTGAGGAAATCCGACCACAACAAATACGTGAAATGC
ATGTCGACCGGCGTCACCGAATATCGCTACATAAAGATCTTTCACCACCC
TACAGCGCTCCAGTTGCGGCCCAATTATGCCGGAACCATGCCGAATGGAT
CCTCGGTCCTATGCACAGCTGCTGATGGCTACCCGCCACCGACAATCAAC
TGGGAGTTCATTAGTGGGCCTCCCAATGCCTCACAGTTCTACTCGATCAC
TGCCGGCAACAATCTGACCATCCTTCCGCATTGCCCGCTTCATACTCAAT
GGACGTTCAATTGCACCGCCTTGAACAGCATTCCTAAATCCTATGACCTC
GGCACGACTCGCTCCTTCACTTTCACTGTTTCCCAGGATATGAACGTGAT
TTCTTTTCTTTTCTCCGGAATCGTAATCAAATGTTTTGCTAGCTTTTTTG
GTTTGCTCATCATTATATGCATTGCAATGAAAAGGAAATCTGGTATCAAG
GGTGAATTGAAGTTTTCGAGTACATTGAGCCAATCTAAGAAACGAATGAC
TGTAGCGAAAGAAAAATGGATCAAAAAAATAAATTTCATTGACGAAATGA
GATCAAAGTTTTCAGCCGACGTTAATGAAGCTCTGAAGCTTCCACAAATA
ATTGTCGTAGGAGACCAAAGCTCGGGCAAAAGCTCAATTTTGCAAGCGAT
CTCCGGGATAAAGTTACCGAGAGGAGTAAATACCGTCACAAGGTGCCCAG
TCGTAATGCAAATGCGCAAATCAACTGAAACAAGAATCCAAATCAAATAC
AGATCGGAGCCATTTAAAGATATTTCTGACACTGAAAGCGAAATAAAGGA
AATACAAACGACTGCTTTCAATAATGAAATAACAAAGGACCCGATTACAA
TCAGCATTCAGTCCCCTGAATCTGTGACATTGACAATCATTGACTTGCCT
GGCTTGGTCAAGGCAGATGTTCGAGGACAAGCAACAGACATGATAGAGAA
AACACATGAAATAGCAAGGGACTTCATGGAGCAAGAGAACTCATTAATAA
TTTGCGTGCTGCCAGCAAATCAGGACATCTGTACAACGACAACTATTAAG
GAGGCAACTGAATGCAATCCGGACAAATCAAGAATAATCGGAGTGCTTAC
AAAACTGGACAAACTCGACGAGAAGGAAGTGACACTCATCCCAGAGATCA
TCAGGAATCAAAAGTTGCCAATAGAGAAAGGATATTACGGTTTAATTGTC
AGTGATGACATTCTGGAGCTCACTGATAAAAATGAACGGTCAGAAACTGA
AAGAAGAATTTTAAAGAAAATGAATTTGTGGAACGCCGAGGACGTCAAAC
GTTTCGGACTTTCTAATTTCACAGAAGCTCTTAGTAAAGAATTGGTCCTC
TTGATTGATAAAACTCTTCCGATTTTGAAGAGAAATGTTGATGATAAACT
CAAAAGCACTAACGAAAAATTAGAAACTTTCTCAAAATATTACGGGAGTG
AAGAGATTCAAAAGAAATATATTAGCGATATAATAAAAGATATTGAAAAG
AAAACAAAGAATATGCTTGTAATGGAAAATCACGAAATTCGTAAATACGG
TGGTATAAAAGAGTTTTTGAACGAAACAGAAATTTTAAGTTCAGTTGAAG
GAAATGAAACATTTCTTTACATGTGGCATGAGATTTTCAAAGATCTCTTT
AATAACTTTAATGCCATCTATAAAGATTTCTTTGATGCAAATCGTGGAAA
ATATCGAGATGAAAAATATCTTGAGCGACTTATCAGAAAGAACCGAACGG
AAAACATTTCAATGTTTATCAGTTCAAAGCCATTTAAAAATATTATCAAT
GAAGCTTTGATTAGGTTCAAAAAAGATGCTGATGAATGCGTCGAGACCTG
TAGCAAGATAATTTTATTCATCATTGAAAACGTTCTGGCTACAGAAATAG
AACCTAAACTTTCTCCCCTACAATTACATATTCAGAAAATTGGTCGCAAA
ATCCTCAGTGACAAAAAAATAGAAATTGAAAATAATTTAACATTTCTTTT
CGATAGCGAGCGCTCGTATTTCTCCTCGTACGAAATGGCTAAATCATACG
ATAAATTCACGTCTGGTATAGATGCTGCAGAAACACTTAGATTGCTAAAT
AAACCAAGTTTAGTATTCGGTACAACTGCATCCTTTGGCGTTGAACTAGT
GAAATCAAGAAATGATAATTTAGAGCTAACTGATGGGAAGATATTCAAAG
AGGGCTTGGAAAAATATTTAACTAAAGCTATCAGTAGATTAGCTAATGTC
ATTCCTAACTTCATCCAGCGGAATTTATTCATAGATTTCAGCAAATCCCT
CACAGATGCGCTGGAATGGGACATTTTATATCCACAAAAGTCTCTGACAT
ATTTCAGTTTAACTGCTGAAGAACAACGCGAATTAGAAGAATTACGGGAG
ACTCGAAAGAGCTTGAACCAGTACAGCAAGCAGCTGAATGATTTTCATTG
TTGATCTGATCTATACAGTTATATATTAATTAGTTTTTATTTATATTTGA
TGTGCTTATTGTTTTTGCTAAGTGTAATATATTTGTTTGAATGTATTATT
TGCCTTTAT
back to top

protein sequence of SMED30013661-orf-1

>SMED30013661-orf-1 ID=SMED30013661-orf-1|Name=SMED30013661-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1049bp
MMSLLITYLEVFKIFIFSITLCSNLSIDRTDKFPIHVNSSFHILFKTVKT
YSPFLLVKLQIVRRSEIEETAFINPGIENNLENKISNKYMSVINWHKNTY
RAIEMIIQFHPPANGLIFEILYFDSETANDRYNAFRNPSVMNRIFSEQIQ
LKIDAILDFYIATRDGRTDGVNSEEMAVISCESKNGVPPGRPILKYIDQL
DVKNRKFHEADNRIVVHAFLRKSDHNKYVKCMSTGVTEYRYIKIFHHPTA
LQLRPNYAGTMPNGSSVLCTAADGYPPPTINWEFISGPPNASQFYSITAG
NNLTILPHCPLHTQWTFNCTALNSIPKSYDLGTTRSFTFTVSQDMNVISF
LFSGIVIKCFASFFGLLIIICIAMKRKSGIKGELKFSSTLSQSKKRMTVA
KEKWIKKINFIDEMRSKFSADVNEALKLPQIIVVGDQSSGKSSILQAISG
IKLPRGVNTVTRCPVVMQMRKSTETRIQIKYRSEPFKDISDTESEIKEIQ
TTAFNNEITKDPITISIQSPESVTLTIIDLPGLVKADVRGQATDMIEKTH
EIARDFMEQENSLIICVLPANQDICTTTTIKEATECNPDKSRIIGVLTKL
DKLDEKEVTLIPEIIRNQKLPIEKGYYGLIVSDDILELTDKNERSETERR
ILKKMNLWNAEDVKRFGLSNFTEALSKELVLLIDKTLPILKRNVDDKLKS
TNEKLETFSKYYGSEEIQKKYISDIIKDIEKKTKNMLVMENHEIRKYGGI
KEFLNETEILSSVEGNETFLYMWHEIFKDLFNNFNAIYKDFFDANRGKYR
DEKYLERLIRKNRTENISMFISSKPFKNIINEALIRFKKDADECVETCSK
IILFIIENVLATEIEPKLSPLQLHIQKIGRKILSDKKIEIENNLTFLFDS
ERSYFSSYEMAKSYDKFTSGIDAAETLRLLNKPSLVFGTTASFGVELVKS
RNDNLELTDGKIFKEGLEKYLTKAISRLANVIPNFIQRNLFIDFSKSLTD
ALEWDILYPQKSLTYFSLTAEEQRELEELRETRKSLNQYSKQLNDFHC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR022812Dynamin_SF
IPR001401Dynamin_GTPase
IPR000375Dynamin_central
IPR027417P-loop_NTPase
IPR007110Ig-like_dom
IPR030381G_DYNAMIN_dom
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0005515protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0051607defense response to virus