Protein lifeguard 4

Overview
NameProtein lifeguard 4
Smed IDSMED30013653
Length (bp)906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein lifeguard 4 (SMED30013653) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein lifeguard 4 (SMED30013653) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein lifeguard 4 (SMED30013653) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein lifeguard 4 (SMED30013653) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013653

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013653SMESG000027408.1 dd_Smed_v4_1521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013653SMESG000027408.1 dd_Smed_v4_1521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013653SMESG000027408.1 dd_Smed_v4_1521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013653SMESG000027408.1 dd_Smed_v4_1521_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013653SMESG000027408.1 dd_Smed_v4_1521_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein lifeguard 4 vs. Ensembl Human
Match: TMBIM4 (transmembrane BAX inhibitor motif containing 4 [Source:HGNC Symbol;Acc:HGNC:24257])

HSP 1 Score: 162.155 bits (409), Expect = 3.894e-48
Identity = 103/221 (46.61%), Postives = 148/221 (66.97%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG++VA + V IR+ FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAGLFA L ILC  G ++ F  S  +E++LA  GA LF   IIYDT   +H+LS EEY+LA I LYLDIINLFLH+LR + A
Sbjct:   15 DDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEA 234          
BLAST of Protein lifeguard 4 vs. Ensembl Human
Match: TMBIM4 (transmembrane BAX inhibitor motif containing 4 [Source:HGNC Symbol;Acc:HGNC:24257])

HSP 1 Score: 141.354 bits (355), Expect = 1.490e-39
Identity = 99/226 (43.81%), Postives = 140/226 (61.95%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
             SG +  F  G T           FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAGLFA L ILC  G ++ F  S  +E++LA  GA LF   IIYDT   +H+LS EEY+LA I LYLDIINLFLH+LR + A
Sbjct:   68 RSGMVNIFYKGPT-----------FLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEA 281          
BLAST of Protein lifeguard 4 vs. Ensembl Human
Match: TMBIM4 (transmembrane BAX inhibitor motif containing 4 [Source:HGNC Symbol;Acc:HGNC:24257])

HSP 1 Score: 112.849 bits (281), Expect = 1.876e-29
Identity = 82/196 (41.84%), Postives = 126/196 (64.29%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEE 710
            +DF YG++VA + V IR+ FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAGLFA L IL    I+++F  S  +E++LA  GA LF   IIYDT   +H+LS + 
Sbjct:   15 DDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILPV-RILEVFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPKS 208          
BLAST of Protein lifeguard 4 vs. Ensembl Human
Match: TMBIM4 (transmembrane BAX inhibitor motif containing 4 [Source:HGNC Symbol;Acc:HGNC:24257])

HSP 1 Score: 95.1301 bits (235), Expect = 2.591e-23
Identity = 59/144 (40.97%), Postives = 94/144 (65.28%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLF 554
            +DF YG++VA + V IR+ FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAG F
Sbjct:   15 DDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGFF 157          
BLAST of Protein lifeguard 4 vs. Ensembl Human
Match: TMBIM4 (transmembrane BAX inhibitor motif containing 4 [Source:HGNC Symbol;Acc:HGNC:24257])

HSP 1 Score: 93.5893 bits (231), Expect = 8.906e-23
Identity = 58/143 (40.56%), Postives = 94/143 (65.73%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGL 551
            +DF YG++VA + V IR+ FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAG+
Sbjct:   15 DDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGI 156          
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Match: tmbi-4 (Transmembrane BAX inhibitor motif-containing protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q11080])

HSP 1 Score: 127.102 bits (318), Expect = 1.308e-34
Identity = 83/230 (36.09%), Postives = 137/230 (59.57%), Query Frame = 3
Query:  108 ESGNIE-DFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            E+G ++ D +    V +++  IR+ FLRKV GI+  QL  T  I C  +    +    L+ +AWI+F  L+ +I ++I + V  +  P N++ L  FT ++++T+G ++  ++   VL + V+T LV  SL  YT Q KRDFS   A + + L +L + GI Q+F  S  +  ++ + GA LF +L++ D  M ++R S E+YI AC+ LY+DI+NLF+ IL+IV  +  
Sbjct:   48 EAGIVDADGILPGCVGKANRMIRIAFLRKVLGIVGFQLLFTIGI-CAAIYNIPNSNQLLQKHAWIVFPNLLGSIALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAYTLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMIMYRFSPEDYICACVSLYMDILNLFIRILQIVAEANK 276          
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Match: tag-120 (pep chromosome:WBcel235:V:9706603:9709814:-1 gene:WBGene00006470.1 transcript:F40F9.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-120)

HSP 1 Score: 80.4925 bits (197), Expect = 1.597e-17
Identity = 70/241 (29.05%), Postives = 126/241 (52.28%), Query Frame = 3
Query:  135 YGATVAQ-----------SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDF-STWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIY---DTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            YGAT AQ           S  ++R  F+RKV+ ++++   +T    C++ M  E  + ++K+N W+ F+ +I+ +VV I +     LR+  P N + L +FTL  ++   F+   Y V +VLI L +T + S S+ I++ +TK D  S  G      +V+  FG    +F  +   + + ++       +++ Y   D  + +    + LS E+YI A ++++LDI+N+FL +L I G  R
Sbjct:    5 YGATTAQDDPDGKYNLHFSSQTVRAAFVRKVFMLVTIMFAITAAF-CVIPMVSEPFQDWVKNNFWVYFIAIIVFLVVAIALSCCGNLRRQFPVNIILLTIFTLSAAVMTMFVTACYNVQSVLICLCITTVCSGSVIIFSMKTKSDLTSKMGIAFMLSMVLFSFGIFALIFTLAFNWQFLYSVYSGLAALLMMFYLAIDVQLLMGGRKYELSPEDYIFAAMEIFLDILNIFLMLLNIFGRGR 244          
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Match: tag-120 (pep chromosome:WBcel235:V:9707771:9709877:-1 gene:WBGene00006470.1 transcript:F40F9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-120)

HSP 1 Score: 80.4925 bits (197), Expect = 1.597e-17
Identity = 70/241 (29.05%), Postives = 126/241 (52.28%), Query Frame = 3
Query:  135 YGATVAQ-----------SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDF-STWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIY---DTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            YGAT AQ           S  ++R  F+RKV+ ++++   +T    C++ M  E  + ++K+N W+ F+ +I+ +VV I +     LR+  P N + L +FTL  ++   F+   Y V +VLI L +T + S S+ I++ +TK D  S  G      +V+  FG    +F  +   + + ++       +++ Y   D  + +    + LS E+YI A ++++LDI+N+FL +L I G  R
Sbjct:    5 YGATTAQDDPDGKYNLHFSSQTVRAAFVRKVFMLVTIMFAITAAF-CVIPMVSEPFQDWVKNNFWVYFIAIIVFLVVAIALSCCGNLRRQFPVNIILLTIFTLSAAVMTMFVTACYNVQSVLICLCITTVCSGSVIIFSMKTKSDLTSKMGIAFMLSMVLFSFGIFALIFTLAFNWQFLYSVYSGLAALLMMFYLAIDVQLLMGGRKYELSPEDYIFAAMEIFLDILNIFLMLLNIFGRGR 244          
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Match: Y42H9AR.2 (pep chromosome:WBcel235:IV:8099918:8101424:1 gene:WBGene00021537.1 transcript:Y42H9AR.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42H9AR.2)

HSP 1 Score: 56.9954 bits (136), Expect = 2.757e-9
Identity = 68/242 (28.10%), Postives = 115/242 (47.52%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFL--KDNAWILFLCLILNIVVLITMFVL---RKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDF-STWGAGLFAGLVILCFG---GIIQLFVKSSGLEIILAIGGAFL--FSMLIIYDTWMAIHR--LSAEEYILACIDLYLDIINLFLHILRIVGAS 788
            D E G  +D            SIR  F+ KV+ +++V   +T     + + + +  + +   +D+ W +++ + +  +  IT+      R+  P N   L  FT   +    FI   Y   AVLISL++T   S S+ ++   TK+D  S  G     G+ ++ FG    I  +F+    L I+ A+ GA L  F + I     M   R  +S EEYI A   +++DI+ +FL+IL +VG +
Sbjct:   19 DNEEGPKDDI--AVQFGFDDRSIRAAFVAKVFALVTVMFAITAAFSAVPI-YNKDFKKWCNQEDHWWCVYVAMGVFFIFYITLMCCGRARRCFPCNLFILTCFTFSAATMTMFITATYSADAVLISLLITTGCSASIILFAATTKKDLTSCLGVAFILGICLMLFGLMACIFCIFLNWQFLYIVYAVLGALLCMFYLAIDIQLIMGGRRVEISPEEYIFAATHVFVDILGMFLNILGVVGNA 257          
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Match: xbx-6 (X-BoX promoter element regulated [Source:UniProtKB/TrEMBL;Acc:Q8MQ56])

HSP 1 Score: 53.5286 bits (127), Expect = 5.482e-8
Identity = 54/221 (24.43%), Postives = 111/221 (50.23%), Query Frame = 3
Query:  156 SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWIL--FLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFST-WGAGLFAGLVILCFGGII---QLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGAS 788
            S  ++R  F+RKV+ ++ + L +   +  I  +  +++R   +++A  L  ++   +  + L+    +R+  P N +   +FTL  S+    I   +    VL++L + +  + S+ I   QTK D +   G  L   +  + FG ++    +F K   L ++ A+GGA +  + +  D  M +    + +S EEYI A + +++DI+ +F  +L + G+S
Sbjct:   75 SDKTVRAAFVRKVFSLVFIMLCIVAAVTVIPWVHDDTMRMVRRNSALYLGSYVIFFVTYLSLVCCEGVRRKFPVNLIVTGIFTLATSVMTMVISAHHDANVVLLALAICIGCTFSIVIVASQTKFDLTAHMGYILIISMCFMFFGLVVVICSMFFKIKFLMMVYALGGALIMMLYLFLDVQMLMGGKKYEISPEEYIFASVQIFIDIVQMFWFLLSLFGSS 295          
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089876)

HSP 1 Score: 125.176 bits (313), Expect = 1.801e-33
Identity = 85/218 (38.99%), Postives = 135/218 (61.93%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR GF+RKVY IL  QL + T     + ++ E  ++F ++N W+ ++ L + +V +++M     +R+ TP NF+ L LFT  +S  +G    +Y    VL+++ +T  V ++LTI+  QTK DF+  G  L A +V+    GI+ +FVK   + ++ A  GA LFS+ +IYDT + +     + +S EEYI A ++LYLDIIN+F++IL I+GASR 
Sbjct:   97 SIRRGFIRKVYLILMGQL-IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 313          
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0309295)

HSP 1 Score: 125.176 bits (313), Expect = 1.801e-33
Identity = 85/218 (38.99%), Postives = 135/218 (61.93%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR GF+RKVY IL  QL + T     + ++ E  ++F ++N W+ ++ L + +V +++M     +R+ TP NF+ L LFT  +S  +G    +Y    VL+++ +T  V ++LTI+  QTK DF+  G  L A +V+    GI+ +FVK   + ++ A  GA LFS+ +IYDT + +     + +S EEYI A ++LYLDIIN+F++IL I+GASR 
Sbjct:   97 SIRRGFIRKVYLILMGQL-IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 313          
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0309294)

HSP 1 Score: 125.176 bits (313), Expect = 1.801e-33
Identity = 85/218 (38.99%), Postives = 135/218 (61.93%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR GF+RKVY IL  QL + T     + ++ E  ++F ++N W+ ++ L + +V +++M     +R+ TP NF+ L LFT  +S  +G    +Y    VL+++ +T  V ++LTI+  QTK DF+  G  L A +V+    GI+ +FVK   + ++ A  GA LFS+ +IYDT + +     + +S EEYI A ++LYLDIIN+F++IL I+GASR 
Sbjct:   97 SIRRGFIRKVYLILMGQL-IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 313          
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0089874)

HSP 1 Score: 125.176 bits (313), Expect = 1.801e-33
Identity = 85/218 (38.99%), Postives = 135/218 (61.93%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR GF+RKVY IL  QL + T     + ++ E  ++F ++N W+ ++ L + +V +++M     +R+ TP NF+ L LFT  +S  +G    +Y    VL+++ +T  V ++LTI+  QTK DF+  G  L A +V+    GI+ +FVK   + ++ A  GA LFS+ +IYDT + +     + +S EEYI A ++LYLDIIN+F++IL I+GASR 
Sbjct:   97 SIRRGFIRKVYLILMGQL-IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 313          
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Match: Nmda1 (gene:FBgn0013305 transcript:FBtr0332883)

HSP 1 Score: 125.176 bits (313), Expect = 1.977e-33
Identity = 85/218 (38.99%), Postives = 135/218 (61.93%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR GF+RKVY IL  QL + T     + ++ E  ++F ++N W+ ++ L + +V +++M     +R+ TP NF+ L LFT  +S  +G    +Y    VL+++ +T  V ++LTI+  QTK DF+  G  L A +V+    GI+ +FVK   + ++ A  GA LFS+ +IYDT + +     + +S EEYI A ++LYLDIIN+F++IL I+GASR 
Sbjct:  100 SIRRGFIRKVYLILMGQL-IVTFGAVALFVYHEGTKTFARNNMWLFWVALGVMLVTMLSMACCESVRRQTPTNFIFLGLFTAAQSFLMGVSATKYAPKEVLMAVGITAAVCLALTIFALQTKYDFTMMGGILIACMVVFLIFGIVAIFVKGKIITLVYASIGALLFSVYLIYDTQLMMGGEHKYSISPEEYIFAALNLYLDIINIFMYILTIIGASRD 316          
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Match: tmbim4 (transmembrane BAX inhibitor motif containing 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2152])

HSP 1 Score: 163.31 bits (412), Expect = 9.084e-49
Identity = 96/225 (42.67%), Postives = 146/225 (64.89%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            +DF YG  VA + V IR+ FLRKVY ILS+Q+ +TT +  + M+    +++F+ ++  ++ +  I ++++L+ +   R   P N   LF FTL+ES++V   +  Y+   VL + VLT  V + LT YTFQ+KRDFS  GA LFAGL IL     ++ F  +  +E++ A  GA LF   II+DT + +H+LS EE++LA I+LYLDI+NLFL+ILRI+ A + +
Sbjct:   13 DDFNYGTNVATASVHIRMDFLRKVYTILSLQIIITTAVSALFML-CNPIKNFVHESPSLVLISAIGSLILLLALAFYRHQHPVNLYLLFGFTLLESLSVATAVSFYEYTIVLQAFVLTSAVFLGLTAYTFQSKRDFSKLGASLFAGLWILIIASFLRFFFYNDTMELVFAGAGALLFCGFIIFDTHLLMHKLSPEEHVLASINLYLDIVNLFLYILRILDAMKKH 236          
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Match: grinab (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1b (glutamate binding) [Source:ZFIN;Acc:ZDB-GENE-040426-1367])

HSP 1 Score: 99.7525 bits (247), Expect = 1.223e-23
Identity = 79/218 (36.24%), Postives = 125/218 (57.34%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAW---ILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDF-STWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
             IR  F+RKV+ +LS+QL +TT    I   F+  V+ F+  N+W   + +L  ++   V++     R+  P N +CL + TL  S  VG I   Y    V++++ +T++V  ++ I++ QTK DF S +G     G+V+  FG I+ +   S  +++I +  GA LF+  +  DT + +      LS EEYI A ++LYLDII +FL ILRI+G SRS
Sbjct:  122 EIRRVFIRKVFSVLSLQLAITTAFVAIFT-FEPHVKLFVMQNSWTYWVGYLVFLVPYFVILCCGEFRRKHPWNLICLSVLTLAMSYMVGVISSFYDTDIVIMAIGITVVVCFTVIIFSMQTKYDFTSCYGVLFVCGIVLFVFG-ILCIIFYSKIMDLIYSTLGALLFTCFLAVDTQLLLGNKNLSLSPEEYIFASLNLYLDIIQIFLFILRILGRSRS 337          
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Match: grinab (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1b (glutamate binding) [Source:ZFIN;Acc:ZDB-GENE-040426-1367])

HSP 1 Score: 99.3673 bits (246), Expect = 1.325e-23
Identity = 79/218 (36.24%), Postives = 125/218 (57.34%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAW---ILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDF-STWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
             IR  F+RKV+ +LS+QL +TT    I   F+  V+ F+  N+W   + +L  ++   V++     R+  P N +CL + TL  S  VG I   Y    V++++ +T++V  ++ I++ QTK DF S +G     G+V+  FG I+ +   S  +++I +  GA LF+  +  DT + +      LS EEYI A ++LYLDII +FL ILRI+G SRS
Sbjct:  122 EIRRVFIRKVFSVLSLQLAITTAFVAIFT-FEPHVKLFVMQNSWTYWVGYLVFLVPYFVILCCGEFRRKHPWNLICLSVLTLAMSYMVGVISSFYDTDIVIMAIGITVVVCFTVIIFSMQTKYDFTSCYGVLFVCGIVLFVFG-ILCIIFYSKIMDLIYSTLGALLFTCFLAVDTQLLLGNKNLSLSPEEYIFASLNLYLDIIQIFLFILRILGRSRS 337          
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 89.3521 bits (220), Expect = 1.716e-20
Identity = 69/220 (31.36%), Postives = 127/220 (57.73%), Query Frame = 3
Query:  156 SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILN---IVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            S  +IR GF+RKVY  L +QL +T  I C   ++ E++  ++KD  W  +  + +    ++VL+    +R+  P NF+ L LFT+ E   +G +++ Y   AVL ++  T LVS+++++++ Q+K DF+     ++A    L    ++   ++S  L I  A  G  +FS+ ++ DT + +     + +S EEYI A ++LY+DI+ +FL +L+++G  R
Sbjct:   38 SDAAIRRGFIRKVYLTLMIQLLITVGIIC-AFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLLLQLIGFCR 256          
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Match: zgc:110410 (zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465])

HSP 1 Score: 89.3521 bits (220), Expect = 1.716e-20
Identity = 69/220 (31.36%), Postives = 127/220 (57.73%), Query Frame = 3
Query:  156 SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILN---IVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            S  +IR GF+RKVY  L +QL +T  I C   ++ E++  ++KD  W  +  + +    ++VL+    +R+  P NF+ L LFT+ E   +G +++ Y   AVL ++  T LVS+++++++ Q+K DF+     ++A    L    ++   ++S  L I  A  G  +FS+ ++ DT + +     + +S EEYI A ++LY+DI+ +FL +L+++G  R
Sbjct:   38 SDAAIRRGFIRKVYLTLMIQLLITVGIIC-AFLYWETLSDWVKDTYWFTYTMMGVTFALVIVLVCCVDIRRKVPLNFIFLGLFTIAEGCLLGSVVVYYSAEAVLWAVGATALVSLAMSLFSLQSKWDFTAASGCIWAMSWTLFSFALLCAILRSQYLYIFYASLGTLIFSVYLVIDTQLILGGKHKYSISPEEYIFAALNLYIDIVTIFLLLLQLIGFCR 256          
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Match: rwdd1 (RWD domain containing 1 [Source:Xenbase;Acc:XB-GENE-1006384])

HSP 1 Score: 145.206 bits (365), Expect = 1.074e-41
Identity = 97/221 (43.89%), Postives = 148/221 (66.97%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG  VA + + IR+ FL+KVY IL+ Q+ +TT+    + ++ +S+++F+ ++  +L + +I ++  +I + + R+  P N   L  FT  E++TV   +  Y VA VL + +LT  V + LT +TFQ+KRDFS +GAGLF GL IL F   ++LF  S  +E+++A  GA LF   II+DT + +H+LS EEYILA ++LYLDIINLFLH+LRI+ A
Sbjct:   12 DDFNYGTNVASASIQIRMDFLKKVYSILTTQILLTTLTAA-LFLYSKSIQTFVHESPALLLISVIGSLGTVIALTIYRQQHPVNLYLLLAFTAFEAVTVATAVTFYDVAVVLQAFILTTAVFLGLTAFTFQSKRDFSKFGAGLFTGLWILIFASFLRLFFYSETVELLIAAAGALLFCGFIIFDTHLLMHKLSPEEYILASVNLYLDIINLFLHLLRILQA 231          
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Match: rwdd1 (RWD domain containing 1 [Source:Xenbase;Acc:XB-GENE-1006384])

HSP 1 Score: 111.694 bits (278), Expect = 4.656e-29
Identity = 87/221 (39.37%), Postives = 135/221 (61.09%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG  VA + + IR+ FL+KVY IL+ Q+ +TT+    + ++ +S+++F+ ++  +L + +I ++  +I + + R+  P N   L          + F+I  Y VA VL + +LT  V + LT +TFQ+KRDFS +GAG               LF  S  +E+++A  GA LF   II+DT + +H+LS EEYILA ++LYLDIINLFLH+LRI+ A
Sbjct:   12 DDFNYGTNVASASIQIRMDFLKKVYSILTTQILLTTLTAA-LFLYSKSIQTFVHESPALLLISVIGSLGTVIALTIYRQQHPVNLYLL----------LAFVITFYDVAVVLQAFILTTAVFLGLTAFTFQSKRDFSKFGAGYI-------------LFFYSETVELLIAAAGALLFCGFIIFDTHLLMHKLSPEEYILASVNLYLDIINLFLHLLRILQA 208          
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Match: grina (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) [Source:NCBI gene;Acc:100145094])

HSP 1 Score: 99.7525 bits (247), Expect = 9.251e-24
Identity = 87/242 (35.95%), Postives = 144/242 (59.50%), Query Frame = 3
Query:  102 DKESGNIEDFMYG--ATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILF-LC--LILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI---HR--LSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            D E+G  E + +G   +   S  +IR  F+RKVY  L++QL +T  + C M +F + +++++++  +I++ LC  +I+  +VL     +R+  P+NF+ L LFT +E   +G I   +   AV+ +   T++V++ LTI+  QTK DF+    GL   L++L   GI+   ++S  L I+ A  G F+F M ++ DT + +   HR  +S EEYI A +++YLDIINLFL +L+I G   SN
Sbjct:   73 DAEAGPPE-YTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLIC-MFIFWKRLKNWVQEYPYIVYALCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMYLNIVYASIGTFIFGMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIFGICGSN 312          
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Match: grina (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) [Source:NCBI gene;Acc:100145094])

HSP 1 Score: 99.7525 bits (247), Expect = 9.251e-24
Identity = 87/242 (35.95%), Postives = 144/242 (59.50%), Query Frame = 3
Query:  102 DKESGNIEDFMYG--ATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILF-LC--LILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI---HR--LSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            D E+G  E + +G   +   S  +IR  F+RKVY  L++QL +T  + C M +F + +++++++  +I++ LC  +I+  +VL     +R+  P+NF+ L LFT +E   +G I   +   AV+ +   T++V++ LTI+  QTK DF+    GL   L++L   GI+   ++S  L I+ A  G F+F M ++ DT + +   HR  +S EEYI A +++YLDIINLFL +L+I G   SN
Sbjct:   73 DAEAGPPE-YTFGVVGSSPFSESAIRRAFIRKVYLTLAMQLALTVGLIC-MFIFWKRLKNWVQEYPYIVYALCPAIIILALVLACCQQVRRKVPYNFIFLGLFTAVEGCMLGTIAALFDADAVMWAGGATIVVTLGLTIFALQTKWDFTMLSGGLCVALLVLLCFGILCGILRSMYLNIVYASIGTFIFGMYLVVDTQLIVGGKHRYAVSPEEYIFAALNIYLDIINLFLMLLQIFGICGSN 312          
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Match: tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:NCBI gene;Acc:595060])

HSP 1 Score: 81.2629 bits (199), Expect = 6.674e-17
Identity = 78/240 (32.50%), Postives = 130/240 (54.17%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLC---LILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFA--GLVILCFG---GIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            D E  N  D   G   +    ++R  F+R+VY I++VQL +T  I  I   + E V SF++    + +       +  +VL+     R+  P N + L +FTL  +   G I   Y   AVLIS+ +T +V++ +TI+ FQTK DF++  AGLFA  G+V+   G    I+  F     L ++ A  GA +F++ + +DT + I    H ++ EEY+   + +Y DI+ +FL++L+I+G+
Sbjct:  114 DGEMYNTNDGEGGNFGSWDDKAVRHAFIRRVYAIIAVQLLLTVGIIAIFT-YVEPVTSFIRRTPGVYYASYAVFFVTYIVLVCCEGPRRRFPWNIILLAIFTLAMAFMAGTIASFYSSKAVLISMGITAIVTIIVTIFCFQTKVDFTSC-AGLFAVLGIVMFVTGIVTAIVLAFKYVYWLHMLYAALGAIVFTLFLAFDTQLVIGNRKHTINPEEYVYGALKIYTDIVYIFLNLLQIIGS 351          
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Match: Tmbim4 (transmembrane BAX inhibitor motif containing 4 [Source:MGI Symbol;Acc:MGI:1915462])

HSP 1 Score: 174.481 bits (441), Expect = 4.238e-53
Identity = 101/221 (45.70%), Postives = 148/221 (66.97%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG+ VA + V IR+ FLRKVY ILS+Q+ +TTV   + + FQ ++R+F+ ++  ++ +  + ++ ++  + + R T P N   LF FTL ES+ V  ++  Y V  VL + ++T  V + LT YT Q+KRDF+ +GAGLFAGL ILC  G ++LF  S  +E++LA  GA LF   IIYDT   +HRLS EEY++A I LY+DIINLFLH+L+ + A
Sbjct:   15 DDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFQ-ALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYDVYLVLQAFIMTTAVFLGLTAYTLQSKRDFTKFGAGLFAGLWILCLAGFLKLFFYSETMELVLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDIINLFLHLLKFLEA 234          
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Match: Tmbim7 (transmembrane BAX inhibitor motif containing 7 [Source:MGI Symbol;Acc:MGI:1922305])

HSP 1 Score: 88.9669 bits (219), Expect = 5.263e-20
Identity = 77/230 (33.48%), Postives = 129/230 (56.09%), Query Frame = 3
Query:  138 GATVAQS----HVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVL------RKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVG 782
              TV QS    + SIR  F+ KV+ +LS+QL +T VI  I + F E VR ++    W L+  L     V+I +FVL      R+  P N++ L  FT++E + +G + + Y+   +L +   T +V++ LT++  QTK DF+     +F    +L   GII L ++S  L ++ +  G  LFS+ ++ D  M +     + ++ EEYI A +++Y+DII+LF+ IL ++G
Sbjct:   76 NETVNQSIPFENTSIRNDFIMKVFVVLSIQLFITAVIIGIFV-FCEPVRKWVIAKPWFLYALLP---AVMILIFVLACCRDIRRQVPANYILLAFFTILEGLLLGSLSVFYRAEEILWAAGATTMVTLVLTLFALQTKWDFTLLNGVMFVFTSVLLIYGIIALVIRSYWLHLVYSALGTLLFSIYLVMDVQMMVGGRYHYEINPEEYIFAALNIYVDIISLFIFILDLIG 301          
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Match: Tmbim7 (transmembrane BAX inhibitor motif containing 7 [Source:MGI Symbol;Acc:MGI:1922305])

HSP 1 Score: 83.5741 bits (205), Expect = 1.478e-18
Identity = 72/232 (31.03%), Postives = 124/232 (53.45%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVG 782
            D E     +F  G      H +    F+ KV+ +LS+QL +T VI  I + F E VR ++    W  FL  +L+I         R+  P N++ L  FT++E + +G + + Y+   +L +   T +V++ LT++  QTK DF+     +F    +L   GII L ++S  L ++ +  G  LFS+ ++ D  M +     + ++ EEYI A +++Y+DII+LF+ IL ++G
Sbjct:    4 DLEVSEPVNFSSGDHQHLVHTAAIKDFIMKVFVVLSIQLFITAVIIGIFV-FCEPVRKWVIAKPW--FLYALLDI---------RRQVPANYILLAFFTILEGLLLGSLSVFYRAEEILWAAGATTMVTLVLTLFALQTKWDFTLLNGVMFVFTSVLLIYGIIALVIRSYWLHLVYSALGTLLFSIYLVMDVQMMVGGRYHYEINPEEYIFAALNIYVDIISLFIFILDLIG 223          
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Match: Grina (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1 (glutamate binding) [Source:MGI Symbol;Acc:MGI:1913418])

HSP 1 Score: 83.5741 bits (205), Expect = 7.204e-18
Identity = 70/217 (32.26%), Postives = 123/217 (56.68%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLC---LILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            +IR  F+RKV+ +L++QL +T     I     E V+ F+++N W  ++      ++++VL      R+  P N + L + T+  S  VG I   Y   AV++++ +T  V  ++ I++ QT+ DF++    L   +V+L    I+ +F+++  LEI+ A  GA LF+  +  DT + +      LS EEY+ A ++LY DIIN+FL+IL I+G ++ 
Sbjct:  130 NIRQAFIRKVFLVLTLQLSVTLSTVAIFTFVGE-VKGFVRENVWTYYVSYAIFFISLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSVVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTIIGRAKE 345          
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Match: Tmbim1 (transmembrane BAX inhibitor motif containing 1 [Source:MGI Symbol;Acc:MGI:1916910])

HSP 1 Score: 77.7962 bits (190), Expect = 4.922e-16
Identity = 72/219 (32.88%), Postives = 125/219 (57.08%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFA--GLVILCFG---GIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
             +R  F++KVY I+SVQL +T  I  I   F E V  ++++N  + ++   + +V  +T+      R+  P N + L +FTL      G I   Y+  AV+I++++T +VS+S+TI+ FQTK DF++   GLF   G+V++  G    I+ +F     L ++ A  GA  F++ + YDT + +    H +S E+YI   + +Y DI+ +F  +L++VG+
Sbjct:   91 KVRHSFIQKVYCIISVQLLITVAIIAIFT-FVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNIILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSC-TGLFCVLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPEDYITGALQIYTDIVYIFTFVLQLVGS 307          
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Match: sp|Q9DA39|LFG4_MOUSE (Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tmbim4 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.965e-52
Identity = 101/221 (45.70%), Postives = 148/221 (66.97%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG+ VA + V IR+ FLRKVY ILS+Q+ +TTV   + + FQ ++R+F+ ++  ++ +  + ++ ++  + + R T P N   LF FTL ES+ V  ++  Y V  VL + ++T  V + LT YT Q+KRDF+ +GAGLFAGL ILC  G ++LF  S  +E++LA  GA LF   IIYDT   +HRLS EEY++A I LY+DIINLFLH+L+ + A
Sbjct:   15 DDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFQ-ALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYDVYLVLQAFIMTTAVFLGLTAYTLQSKRDFTKFGAGLFAGLWILCLAGFLKLFFYSETMELVLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDIINLFLHLLKFLEA 234          
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Match: sp|Q9HC24|LFG4_HUMAN (Protein lifeguard 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=1 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 1.870e-47
Identity = 103/221 (46.61%), Postives = 148/221 (66.97%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            +DF YG++VA + V IR+ FLRKVY ILS+Q+ +TTV   + + F ESVR+F+ ++  ++ L  + ++ ++  + + R   P N   LF FTL+E++TV  ++  Y V  +L + +LT  V   LT+YT Q+K+DFS +GAGLFA L ILC  G ++ F  S  +E++LA  GA LF   IIYDT   +H+LS EEY+LA I LYLDIINLFLH+LR + A
Sbjct:   15 DDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYF-ESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEA 234          
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Match: sp|Q49P94|GAAP_VACCL (Golgi anti-apoptotic protein OS=Vaccinia virus (strain Lister) OX=10252 GN=L6 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.147e-41
Identity = 88/210 (41.90%), Postives = 135/210 (64.29%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIIN 752
            +DF YG++VA + V IR+ FLRKVYGIL +Q  +TT    + + F + +R+F++ +  ++   +  +I ++  + + R   P N   L  FTL ES+T+  ++  Y V  V+ + +LT    ++LT YT Q+KRDFS  GAGLFA L IL   G++ +FV++  ++++L+  GA +F   IIYDT   IH+LS EEY+LA I+LYLDIIN
Sbjct:   14 DDFNYGSSVASASVHIRMAFLRKVYGILCLQFLLTTATTAVFLYF-DCMRTFIQGSPVLILASMFGSIGLIFALTLHRHKHPLNLYLLCGFTLSESLTLASVVTFYDVHVVMQAFMLTTAAFLALTTYTLQSKRDFSKLGAGLFAALWILILSGLLGIFVQNETVKLVLSAFGALVFCGFIIYDTHSLIHKLSPEEYVLASINLYLDIIN 222          
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Match: sp|Q11080|TMBI4_CAEEL (Transmembrane BAX inhibitor motif-containing protein 4 OS=Caenorhabditis elegans OX=6239 GN=tmbi-4 PE=3 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.664e-33
Identity = 83/230 (36.09%), Postives = 137/230 (59.57%), Query Frame = 3
Query:  108 ESGNIE-DFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            E+G ++ D +    V +++  IR+ FLRKV GI+  QL  T  I C  +    +    L+ +AWI+F  L+ +I ++I + V  +  P N++ L  FT ++++T+G ++  ++   VL + V+T LV  SL  YT Q KRDFS   A + + L +L + GI Q+F  S  +  ++ + GA LF +L++ D  M ++R S E+YI AC+ LY+DI+NLF+ IL+IV  +  
Sbjct:   48 EAGIVDADGILPGCVGKANRMIRIAFLRKVLGIVGFQLLFTIGI-CAAIYNIPNSNQLLQKHAWIVFPNLLGSIALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAYTLQNKRDFSVGYASMGSLLCVLLWAGIFQMFFMSPAVNFVINVFGAGLFCVLLVIDLDMIMYRFSPEDYICACVSLYMDILNLFIRILQIVAEANK 276          
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Match: sp|O74888|BXI1_SCHPO (Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bxi1 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 6.459e-33
Identity = 85/234 (36.32%), Postives = 139/234 (59.40%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSG-LEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN*NE 806
            E+  ++ F     VA+   SIR+ FLRKVY IL+ QL +T++ G I  +   +   +++ + W L L   +++VVL  + +   + P N++ LFLFT +E +T+G  I  +    +L ++ +TL V V+LT +TFQ+K DFS  G  L+  L  L    +I  FV S+  +++  A  G  +F   I++DT+  +HR S EE+I++ + LYLD INLF+ IL+I+G  ++N N 
Sbjct:   34 ENPAVDQFKNTTPVAECAKSIRMAFLRKVYAILTAQLFVTSLFGGIFYL-HPAFSFWVQMHPWFLILNFFISLVVLFGLIMKPYSYPRNYIFLFLFTALEGLTLGTAITFFSARIILEAVFITLGVFVALTAFTFQSKWDFSRLGGFLYVSLWSLILTPLIFFFVPSTPFIDMAFAGFGTLVFCGYILFDTYNILHRYSPEEFIMSSLMLYLDFINLFIRILQILGMLQNNDNN 266          
BLAST of Protein lifeguard 4 vs. TrEMBL
Match: A0A293M4S4 (Uncharacterized protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 5.927e-66
Identity = 120/232 (51.72%), Postives = 170/232 (73.28%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
              +S  ++DF Y   V+++HV +RLGFLRKVYGILSVQL +T +   I M F   V+ ++ +N W+L +  + +I++L+ + + R+ TP N++ L  FTL ++ +VG ++  Y   AVL + VLTL V+V LTIYTFQ+KRDFSTWGAGLFA L +L  GG +++F+ S+ LEI+L++GGA LFS  II+DT M +HR+S EEYI+A I+LY+DIINLFLHILRIVG +R +
Sbjct:   12 SDKSSIMDDFCYNNNVSKAHVYVRLGFLRKVYGILSVQLLLTAICASIAM-FTPVVKFYVNENPWMLTVAFLASIILLVCLMIKRRETPINYILLTGFTLAQAYSVGVVVTFYDQLAVLQAFVLTLGVTVGLTIYTFQSKRDFSTWGAGLFAFLWVLVLGGFLRMFIPSTNLEIVLSMGGAALFSFFIIFDTHMIMHRVSPEEYIMATIELYMDIINLFLHILRIVGEARRH 242          
BLAST of Protein lifeguard 4 vs. TrEMBL
Match: A0A023FGJ5 (Putative golgi antiapoptotic protein OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 7.205e-66
Identity = 117/230 (50.87%), Postives = 166/230 (72.17%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            +S  ++DF Y   V++++V +RLGFLRKVYGILS QL  TTVI    M F  +V+ ++  N W++    I+++V+L+ + V R+ TP N++ L  FT +++ TV  ++  Y   AVL + +LT+ V+  LT+YTFQ+KRDFSTWGAGL+A L++L  G ++Q F+ SS LE +L++GGA LFS  II+DT M +HR+S EEYILA I+LYLDIINLFLHILRI+G +R N
Sbjct:   14 QSSILDDFCYNNNVSKANVYVRLGFLRKVYGILSAQLLATTVIAAFGM-FTPAVKLYISQNQWMVMGAFIMSMVLLLALMVKRRETPTNYVLLTAFTFVQAFTVAVVVSFYDQMAVLQAFLLTMGVTGGLTLYTFQSKRDFSTWGAGLYAFLMVLLMGSLLQFFLTSSHLEFVLSLGGAVLFSFFIIFDTHMLMHRVSPEEYILATIELYLDIINLFLHILRIIGEARRN 242          
BLAST of Protein lifeguard 4 vs. TrEMBL
Match: A0A1E1XGI6 (Putative golgi antiapoptotic protein OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 9.148e-66
Identity = 118/230 (51.30%), Postives = 165/230 (71.74%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            +S  ++DF Y   V++++V +RLGFLRKVYGILS QL  TTVI    M F  +V+ ++  N W++    IL++V+L+ + V R+ TP N+  L  FT +++ TV  ++  Y   AVL + +LT+ V+  LT+YTFQ+KRDFSTWGAGL+A L++L  G ++Q F+ SS LE +L++GGA LFS  II+DT M +HR+S EEYILA I+LYLDIINLFLHILRI+G +R N
Sbjct:   14 QSSILDDFCYNNNVSKANVYVRLGFLRKVYGILSAQLLATTVIAAFGM-FTPAVKLYISQNQWMVMGAFILSMVLLLALMVKRRETPTNYFLLTAFTFVQAFTVAVVVSFYDQMAVLQAFLLTMGVTGGLTLYTFQSKRDFSTWGAGLYAFLMVLFMGSLLQFFLTSSHLEFVLSLGGAVLFSFFIIFDTHMLMHRVSPEEYILATIELYLDIINLFLHILRIIGEARRN 242          
BLAST of Protein lifeguard 4 vs. TrEMBL
Match: A0A023FVL9 (Putative golgi antiapoptotic protein OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.161e-65
Identity = 117/230 (50.87%), Postives = 165/230 (71.74%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            +S  ++DF Y   V++++V +RLGFLRKVYGILS QL  TTVI    M F  +V+ ++  N W++    I+++V+L+ + V R+ TP N+  L  FT +++ TV  ++  Y   AVL + +LT+ V+  LT+YTFQ+KRDFSTWGAGL+A L++L  G ++Q F+ SS LE +L++GGA LFS  II+DT M +HR+S EEYILA I+LYLDIINLFLHILRI+G +R N
Sbjct:   14 QSSILDDFCYNNNVSKANVYVRLGFLRKVYGILSAQLLATTVIAAFGM-FTPAVKLYISQNQWMVMGAFIMSMVLLLALMVKRRETPTNYFLLTAFTFVQAFTVAVVVSFYDQMAVLQAFLLTMGVTGGLTLYTFQSKRDFSTWGAGLYAFLMVLLMGSLLQFFLTSSHLEFVLSLGGAVLFSFFIIFDTHMLMHRVSPEEYILATIELYLDIINLFLHILRIIGEARRN 242          
BLAST of Protein lifeguard 4 vs. TrEMBL
Match: A0A2R5LAQ2 (Putative golgi antiapoptotic protein OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.064e-65
Identity = 118/232 (50.86%), Postives = 170/232 (73.28%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
              +S  ++DF Y   V+++HV +RLGFLRKVYGILSVQL +T V   I M F   V+ ++ +N W++ +  + +I++LI + + R+ TP N++ L  FTL ++ TVG ++  Y   AVL + ++TL V+V LT+YTFQ+KRDFSTWGAGLFA L +L  GG +++F+ S+ LE++L++GGA LFS  II+DT M +HR+S EEYI+A I+LY+DIINLFLHILRIVG +R +
Sbjct:   12 SDKSSIMDDFCYNNNVSKAHVYVRLGFLRKVYGILSVQLLVTAVCASIAM-FTPVVKFYINENPWMVTVAFLASIILLIGLMIKRRQTPINYVLLGGFTLAQAYTVGVVVTFYDQLAVLQAFIITLGVTVGLTVYTFQSKRDFSTWGAGLFAFLWVLVLGGFLRMFIPSTHLELVLSMGGAALFSFFIIFDTHMIMHRVSPEEYIMATIELYMDIINLFLHILRIVGEARRH 242          
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Match: tmbim4 (transmembrane BAX inhibitor motif containing 4 [Source:NCBI gene;Acc:103029557])

HSP 1 Score: 176.407 bits (446), Expect = 7.319e-54
Identity = 100/225 (44.44%), Postives = 149/225 (66.22%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            +DF YG  VA + V IR+ FLRKVY ILS+Q+ +TT +   + MF E +++F+  +  ++ +  I ++V+L+ + + R   P N   LF FTL+E+++V   +  Y+ + VL + +LT  V   LT YTFQ+KRDFS  GAGLFA L IL     ++LF ++  +E++ A  GA LF   IIYDT + +H+LS EE++LA I+LYLDI+NLFLHILRI+ + + N
Sbjct:   13 DDFNYGTNVATASVQIRMDFLRKVYTILSLQIIVTTAVSA-LFMFCEPIKNFVHSSPSVVLVSAIGSLVLLLALAIYRHQHPLNLYLLFGFTLLEAVSVATAVTFYEYSVVLQACILTSAVFACLTTYTFQSKRDFSKLGAGLFAALWILIIASFMRLFFQNDTMELVFAGSGALLFCGFIIYDTHLLMHKLSPEEHVLASINLYLDIVNLFLHILRILDSLKKN 236          
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Match: grinab (protein lifeguard 1-like [Source:NCBI gene;Acc:103028312])

HSP 1 Score: 97.8265 bits (242), Expect = 5.601e-23
Identity = 69/217 (31.80%), Postives = 129/217 (59.45%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            ++R  F+RKV+ +L+ QL + T     +  F++++++F++ N W  ++   + I+ LI +      R+  P N + L + TL  S   G I   Y    V++++ +T++V  ++ I++ Q+K DF++    LF  +++L   GI+ +F+++  L+I+ A  GA +F+  +  DT + +      LS EEY+   ++LYLDIIN+FL+IL+IVG SR+
Sbjct:  128 AVRRAFIRKVFLVLTAQL-VVTFSFVALFTFEKNIKTFVQQNVWTYYVSYAVFIIPLIAISCCGEFRRKHPWNLVALSILTLSMSYMTGMIASFYDTDTVVMAVGITVVVCFTVVIFSMQSKYDFTSCMGVLFVCVIVLFVFGILCIFIRNKILDIVYASLGALVFTCFLAVDTQLLLGNKKLSLSPEEYVFGALNLYLDIINIFLYILQIVGRSRN 343          
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Match: grinab (protein lifeguard 1-like [Source:NCBI gene;Acc:103028312])

HSP 1 Score: 97.4413 bits (241), Expect = 1.184e-22
Identity = 69/217 (31.80%), Postives = 129/217 (59.45%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            ++R  F+RKV+ +L+ QL + T     +  F++++++F++ N W  ++   + I+ LI +      R+  P N + L + TL  S   G I   Y    V++++ +T++V  ++ I++ Q+K DF++    LF  +++L   GI+ +F+++  L+I+ A  GA +F+  +  DT + +      LS EEY+   ++LYLDIIN+FL+IL+IVG SR+
Sbjct:  166 AVRRAFIRKVFLVLTAQL-VVTFSFVALFTFEKNIKTFVQQNVWTYYVSYAVFIIPLIAISCCGEFRRKHPWNLVALSILTLSMSYMTGMIASFYDTDTVVMAVGITVVVCFTVVIFSMQSKYDFTSCMGVLFVCVIVLFVFGILCIFIRNKILDIVYASLGALVFTCFLAVDTQLLLGNKKLSLSPEEYVFGALNLYLDIINIFLYILQIVGRSRN 381          
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Match: grinaa (glutamate ionotropic receptor NMDA type subunit associated protein 1 [Source:NCBI gene;Acc:103028129])

HSP 1 Score: 94.3597 bits (233), Expect = 9.375e-22
Identity = 76/217 (35.02%), Postives = 120/217 (55.30%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            SIR  F+RKV+ +L+VQL M T     +  F   V+ F++ N W  ++  ++  V LI +      R+  P N + L + TL  S  VG I   Y   +V+I++ +T +V  S+ I++ Q+K DF++    LF  L++L     + + ++   L I+ A  GA LF+  +  DT + +      LS EEYI A ++LY DIIN+F++IL IVG SR 
Sbjct:  140 SIRQAFIRKVFMVLTVQL-MVTFSFVAVFTFSNDVKLFVRQNRWTYYVSYVVFFVSLIALSCCGEFRRKHPWNLVALSILTLSLSYMVGMIASFYNTDSVIIAVGITSVVCFSVVIFSLQSKYDFTSCRGVLFVCLIVLILFSFLCMVIRHKILHIVYASLGALLFTCFLAVDTQLLLGNKKLALSPEEYIFAALNLYTDIINIFMYILAIVGRSRE 355          
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Match: zgc:110410 (protein lifeguard 1-like [Source:NCBI gene;Acc:111193442])

HSP 1 Score: 91.6633 bits (226), Expect = 6.623e-21
Identity = 72/220 (32.73%), Postives = 125/220 (56.82%), Query Frame = 3
Query:  156 SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            S   IR  F+RKVY  L VQL +T  I C   ++ +++R + +   W  +  +   +V+++ +     +R+  P NF+ L LFT+ E + +G + + Y   AVL ++  T LVS +L+++  Q+K DF+     ++A    L   G++   ++S  L I+ A  G  +FS+ ++ DT + +     + +S EEYI A ++LYLDII +FL IL+++G SR
Sbjct:  103 SEAVIRRAFVRKVYLTLVVQLLITVGIIC-AFIYWDTLRKWARGTPWFTYAMMAATLVLIVVLSCCGDVRRKVPLNFIFLGLFTITEGLLLGSVTVFYSAEAVLWAVGATALVSFALSLFAMQSKWDFTAASGSIWAICWTLVSFGLLCAILRSQYLYIVYASLGTLVFSIYLVMDTQLILGGKHKYSISPEEYIFAALNLYLDIITIFLMILQLIGLSR 321          
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Match: grinaa (glutamate receptor, ionotropic, N-methyl D-aspartate-associated protein 1a (glutamate binding) [Source:ZFIN;Acc:ZDB-GENE-060616-231])

HSP 1 Score: 82.8037 bits (203), Expect = 8.348e-19
Identity = 76/235 (32.34%), Postives = 123/235 (52.34%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTW--MAIHR--LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            D E  NI D+        +  ++R  F+RKVY +L+ QL            + +S       +  + F+CLI     L      R+  P N + L + TL  S  VG I   Y+  AV++++ +T+ V V++ +++ QTK DF++    L   LV+L    I+ + +++  L I+    GA LF++ +  DT   M  H+  LS EEYI A ++LY D+IN+FL+IL I+G SR+
Sbjct:   54 DNEDFNISDW--------TDKTVRRAFIRKVYLVLTAQLPT----------YVKSTPGLYYASYAVFFVCLI----ALSCCGEFRRKHPWNIITLSILTLCMSYMVGMIATFYEADAVVMAMGITVAVCVAVILFSMQTKYDFTSCNGVLLVMLVVLMLFSILCIILRNHILNIVYGALGALLFTVFLAVDTQLLMGNHKYALSPEEYIFAALNLYTDVINIFLYILMIIGNSRN 266          
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 72.0182 bits (175), Expect = 3.635e-15
Identity = 64/218 (29.36%), Postives = 116/218 (53.21%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNA---WILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSG----LEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            ++R  F+RKVY IL +QL +T  I  +   F ESV  F++      W  +    +  +VLI     R+  P N++ L +FTL  +   G +   Y   +VL+ L +T +V  ++T++ FQTK DF++    +F   + L   G++ +F    G    ++ + A  GA +F++ + +DT + +    H +S EE++   + LY+DI+ +F  +L++ G 
Sbjct:    8 NVRRVFVRKVYTILMLQLLVTFGIVAVFT-FNESVERFVRRTPAIYWTSYGVFFVTYLVLICCTKARRMFPLNYILLSVFTLAMAYMTGMLASYYSTKSVLMCLGITAMVCAAVTLFCFQTKFDFTSCHGLMFVLSMALLLTGLVAVFTVPFGYIPWIQTVYAGLGAVVFTLFLAFDTQLLLGNRRHSISPEEHVYGALSLYMDIVYIFTFMLQLFGT 224          
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 72.4034 bits (176), Expect = 7.698e-15
Identity = 75/236 (31.78%), Postives = 121/236 (51.27%), Query Frame = 3
Query:  111 SGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNA---WILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSG----LEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGA 785
            S NI D     T    +  +R  F+RKVY IL +QL +T  I  I  +  E V  ++K N    W  +   ++  +VL      R+  P N + L +FTL  S   G +   Y   +V++   +T LV  S+TI+ FQTK DF+T    LF  L+ L   G++       G    L ++    GA +F++ + YDT + I    + +S EE+I A ++LY+D++ +F+ +L+I G+
Sbjct:   72 SSNIGDSFSSNTWEDKN--LRRVFIRKVYAILMLQLLVTFGIVAIFTL-CEPVGYYVKRNPILYWSSYAVFLVTYLVLACCKEPRRRFPLNIILLSIFTLAMSYMTGTLASFYSTRSVMLCFGITALVCFSVTIFCFQTKFDFTTCHGLLFVLLMALVLTGLVAAIAVPFGYMPWLHVVYGGLGAVVFTLFLAYDTQLLIGNRRYAISPEEHIFASLNLYMDLVYIFMFLLQIFGS 304          
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007086.1 (pep scaffold:Pmarinus_7.0:GL482243:1328:8907:1 gene:ENSPMAG00000006407.1 transcript:ENSPMAT00000007086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 6.767e-10
Identity = 33/101 (32.67%), Postives = 56/101 (55.45%), Query Frame = 3
Query:  504 YTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            ++ QTK DF+     L   +  L F  I+ +  ++  + ++    GA +FS+ +  D  + I    ++LS EEYI A + LYLD++ +FL+IL  +G SR 
Sbjct:    9 FSMQTKYDFTCCVWLLLPLVTCLFFSAILAIVYRNDIMFVVWGSLGAVVFSLFLAVDVQLIIGNKQYKLSPEEYIYAALCLYLDVVKIFLYILMAIGGSRE 109          
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Match: faim2a (Fas apoptotic inhibitory molecule 2a [Source:ZFIN;Acc:ZDB-GENE-050320-88])

HSP 1 Score: 54.299 bits (129), Expect = 1.902e-9
Identity = 46/155 (29.68%), Postives = 85/155 (54.84%), Query Frame = 3
Query:  351 LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSG----LEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            LR+  P NF+ L + TL  S   G +   Y   +VL+ + +T  V  ++T++ FQTK DF++    +FA  ++L   G+I  F    G    ++ + A  GA +F++ +  DT + +    + +S EE+I   + LY+DI+ +F  +L+++G+  
Sbjct:    6 LRRLFPLNFILLAVLTLAMSYLTGMLASFYNTNSVLMCIGVTAAVCGAVTLFCFQTKVDFTSCPGVMFALSMVLLLTGLIAAFTVPFGYIPWIQTVYAGLGAVIFTVFLAVDTQLLLGNRRNSISPEEHINGALRLYMDIVYIFTFLLQLIGSRN 160          
BLAST of Protein lifeguard 4 vs. Ensembl Yeast
Match: BXI1 (Protein involved in apoptosis; variously described as containing a BCL-2 homology (BH3) domain or as a member of the BAX inhibitor family; reported to promote apoptosis under some conditions and to inhibit it in others; localizes to ER and vacuole; may link the unfolded protein response to apoptosis via regulation of calcium-mediated signaling; translocates to mitochondria under apoptosis-inducing conditions in a process involving Mir1p and Cor1p [Source:SGD;Acc:S000005249])

HSP 1 Score: 54.299 bits (129), Expect = 5.553e-9
Identity = 70/281 (24.91%), Postives = 120/281 (42.70%), Query Frame = 3
Query:  102 DKESGN---IEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRK------TTPHNFLC---------------------------LFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXX----XXXXXXYTFQTKRDFST-------WGAGLF--AGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
              + GN    EDF Y   V      IR  F+ KVY +LS QL + ++  C       S+++F+  +  + ++C+++++V  I + V  +      + P   L                            L +FTL E+  +  + + Y    VL +L++T +V    S++     F+   + +T       WG  +    GL  L FG        SS   ++    GA LF+  +  DT +   ++  +E +   + LYLDI+NLFL ILRI+  S  +
Sbjct:   21 SSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSCQL-LASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFG----WNTHSSKFNLLYGWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDD 296          
BLAST of Protein lifeguard 4 vs. Ensembl Nematostella
Match: EDO48159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF0])

HSP 1 Score: 190.274 bits (482), Expect = 7.739e-60
Identity = 100/225 (44.44%), Postives = 156/225 (69.33%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            EDF YG TVAQ+++++RLGFLRKVYGILS QLG+T ++  + M    +++ F++    +LF+  IL+   LI +   R+ +P N   LF FTL+E+ T+G ++  +    VL +  +T   +++LT+YT Q+KRD+S+WGAGLF  L I  + G++Q+F +S  LE+  A+ GA LFS  I++DT M ++++S EEYILA I+LY+DIINLF+ IL+I+ + + +
Sbjct:    6 EDFTYGVTVAQTNINVRLGFLRKVYGILSAQLGLTILVSALFMS-TPAIKDFVQSRPEVLFVAFILSFGFLIALMFKRRESPMNMYLLFGFTLVEAYTLGTLVTFFDRMIVLEAFGMTAATTIALTMYTLQSKRDYSSWGAGLFTMLWIFIWAGLLQMFFQSDILELAYAVLGALLFSAFIVFDTHMLMNKMSPEEYILASINLYMDIINLFIQILKILESMKKH 229          
BLAST of Protein lifeguard 4 vs. Ensembl Nematostella
Match: EDO37574 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG5])

HSP 1 Score: 114.39 bits (285), Expect = 2.303e-30
Identity = 88/240 (36.67%), Postives = 142/240 (59.17%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVIL-CFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWM-----AIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            D E    +D     ++A S +SIR GF+RKVY IL  QL +T    C   ++ E VR +   +  I +  L +  V +I M     +R+  P N L L LFTL E   +G +   Y+   VL+++ +T +V +++TI+ FQTK DF+  G  LF  L++L CF G + +F  +  ++I+ A  GA LF++ ++YDT +      ++ +S EEYI A ++LYLDI+N+FL+IL+++ A+R+
Sbjct:   10 DAEKYGADDPFADNSMAFSDISIRAGFIRKVYSILLCQLAVTISFIC-FFLYCEPVRLYAVSHPGIFYGALAVTFVTMIAMACCEGVRRKFPTNLLFLTLFTLCEGYLLGAVSSVYKADEVLMAVGITAVVVLAITIFAFQTKYDFTMMGGFLFVALIVLICF-GFLAIFFHNRVVQIVYASLGALLFALYLVYDTQIMMGGGKMYSISPEEYIFAALNLYLDIVNMFLYILQLISAARN 247          
BLAST of Protein lifeguard 4 vs. Ensembl Nematostella
Match: EDO49375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG77])

HSP 1 Score: 89.7373 bits (221), Expect = 1.137e-20
Identity = 86/246 (34.96%), Postives = 130/246 (52.85%), Query Frame = 3
Query:  114 GNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFL--KDNAWILFLCLILNIVVLITMFV--------------LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGI---IQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVG 782
            G+  D  YG  V+ S  SIR+GF+R+VY IL +QL +T    C + +F + VR+F+  K  A         N VV ++ FV              +R+  P N +CL +FTL  S  VG I   +    VLI + +T LV +S+ I++ QTK DF+TWG  LF   + + F  I   + L + ++  +I+L    A +F   + YDT + +    + LS EEYI   + LY+DII +FL +L + G
Sbjct:   81 GDGYDVEYGGAVSFSDKSIRMGFIRRVYFILMIQLSVTVATIC-LFLFYKPVRNFVHGKHGAG--------NTVVYVSAFVVFFVLYFVIACCESVRRKYPVNLICLAIFTLALSYLVGTISSYHDTNIVLIMMGVTTLVCLSVMIFSCQTKYDFTTWGGVLFCAALAIFFLSIFTPVWLLLNTTAGKIVLGGVLALVFVAFLAYDTQLIMGGKKYELSPEEYIFGALTLYMDIIRIFLLLLALFG 317          
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Match: grinab (protein lifeguard 1 [Source:NCBI gene;Acc:101161330])

HSP 1 Score: 103.605 bits (257), Expect = 3.218e-25
Identity = 84/232 (36.21%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  123 EDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVG-ASRS 794
            +DFM G      + SIR  F+RKV+ +L+ QL M T     +  F + V++F+K N W   +  ++ IV L+ +     LR+  P N + L + TL  S  VG I   +   +V++++ +T +V  ++ I++ QTK DF++    LF  L++L   G + +F+++  LEI+ A  GA LF+  +  DT + +      LS EEY+ A ++LYLDIIN+FL+IL IVG AS S
Sbjct:  113 QDFMIGL----DNKSIRRAFVRKVFLVLTAQL-MVTFAFVAIFTFVKEVKAFVKVNIWTYIVSYVIFIVALLAISCCGNLRRKHPWNLVALSILTLSMSYMVGMIASFHDTDSVIMAVGITAVVCFTVVIFSLQTKYDFTSCYGVLFVCLIVLIIFGFLCIFIQNKILEIVYAGLGALLFTCFLAVDTQLLLGNKELSLSPEEYVFAALNLYLDIINIFLYILAIVGRASNS 339          
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Match: grinaa (protein lifeguard 1 [Source:NCBI gene;Acc:101164659])

HSP 1 Score: 96.2857 bits (238), Expect = 1.645e-22
Identity = 76/234 (32.48%), Postives = 128/234 (54.70%), Query Frame = 3
Query:  114 GNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGASRS 794
            G+ ++F  G    ++   +R  F+RKV+ +L+VQL + T     +  F +  + F++ N W+ +      +V LI +      R+  P NF+ L + TL  S  VG I   Y    V+I++ +T  V  ++ +++ QTK DF++    LF  L++L    I+ +F+++  + ++ A  GA LF+  +  DT + +      LS EEYI A ++LY DIIN+FL+IL IVG SR 
Sbjct:  115 GDNDEFKIGGLEDKT---VRRAFIRKVFLVLTVQL-VVTFSFVAIFTFSDDAKIFVRRNPWVYYTSYASFLVCLIALSCCGDFRRKYPGNFIALGILTLSLSYMVGMIASFYDTETVIIAVGITAGVCFTVVLFSLQTKYDFTSCRGVLFVCLIVLMIFSILCIFIRNKIMHLVYASLGALLFTCFLAVDTQLLLGNKNLALSPEEYIFAALNLYTDIINIFLYILAIVGRSRE 344          
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Match: tmbim1a (transmembrane BAX inhibitor motif containing 1 [Source:NCBI gene;Acc:101159382])

HSP 1 Score: 91.2781 bits (225), Expect = 9.282e-21
Identity = 80/220 (36.36%), Postives = 125/220 (56.82%), Query Frame = 3
Query:  168 IRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNA---WILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCF-GGIIQLFVKSSG----LEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVGASR 791
            +R  F+RKVY IL+ QL +TT I  I   F   V++F++DN    W  +   I+  +VL+     R+  P N + L +FTL  S   G I   Y   +V ++L +T +V +++T++ FQTK DF T   GLF  L I+ F  GII   V S      L ++ A  GA +F++ + Y T + I    + +S EEY+ A + +Y+DI+ +FL +L+I+GAS+
Sbjct:  118 VRHSFIRKVYLILASQLLLTTAIVAIFT-FVHPVKTFVRDNPAVYWASYAIYIITHIVLVCCKGPRRKYPWNLILLLIFTLALSYMTGTISSFYDTKSVFLALGITAVVCIAVTVFCFQTKVDF-TKCQGLFCVLGIVVFVTGIIAAIVLSFKYILWLHMLYAAIGAIVFTLFLAYHTQLLIGNRKYSISEEEYVFAALSIYVDIVQIFLFLLQIIGASK 335          
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Match: zgc:110410 (protein lifeguard 1 [Source:NCBI gene;Acc:101167569])

HSP 1 Score: 78.1814 bits (191), Expect = 3.128e-16
Identity = 66/224 (29.46%), Postives = 125/224 (55.80%), Query Frame = 3
Query:  156 SHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFA------GLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI---HR---LSAEEYILACIDLYLDIINLFLHILRIVG 782
            S  +IR GF++KVY  L  QL +T  I C   ++ + ++ ++ +N +  +  + +  V+L+ M +   L +  P N+L L LFT+ E + +G + + ++  AV+ ++  T  V++ +T++  Q+K DF+   A ++        L ILC        ++S  L I+ A   + +FS+ +++DT + +   HR   +S EEY+ A + LY+DI++LFL IL+ + 
Sbjct:   86 SDKAIRKGFIKKVYLTLMTQLLITVGIIC-GFIYWDKLKMWVVENNYFTYSMIAVGSVLLVIMSIFGKLHRQAPLNYLALSLFTITEGVMLGSVTVYFKAEAVMWAVGATAFVTLGITLFASQSKFDFTPAAASMWTLAWSLFSLCILCAA------IQSQYLYIVYAFLASLVFSLFLVFDTMLILGGKHRRYEISPEEYVFAALTLYVDIVSLFLIILQFIN 302          
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Match: tmbim1b (protein lifeguard 3-like [Source:NCBI gene;Acc:101175308])

HSP 1 Score: 75.8702 bits (185), Expect = 2.351e-15
Identity = 79/239 (33.05%), Postives = 129/239 (53.97%), Query Frame = 3
Query:  108 ESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMT-TVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVV---LITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKS----SGLEIILAIGGAFLFSMLIIYDTWMAIHR----LSAEEYILACIDLYLDIINLFLHILRIVGAS 788
             +G++E F           S+R  F+RKVY IL+VQL  T TV+   +  F + VR F+     I +  L +  VV   LI +   R+  P N L L +FTL  S   G I   Y+  AV I++ +T++V V++T++ FQTK D ++    L    V+L   GI+   V S      L ++ A  GA ++++ ++Y+T + I      +S EEY+   + LY+DI+++FL IL++ G++
Sbjct:   78 HTGDMEAFFRNQ---WESTSVRHAFIRKVYLILAVQLAFTFTVVA--VFTFVDPVRLFVIRYPGIYWASLAVYFVVYCVLICLKEPRRRFPWNLLLLGIFTLALSYMAGTISSYYETKAVFIAMGITVVVCVAVTVFCFQTKVDLTSCSGLLCIAGVLLMIIGIVTAVVLSFQYVHWLHMLYAAIGAVVYTLFLVYNTQLLIGNRELAISPEEYVFGALSLYVDIVHIFLFILQVSGSA 311          
BLAST of Protein lifeguard 4 vs. Planmine SMEST
Match: SMESG000027408.1 (SMESG000027408.1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.184e-150
Identity = 232/232 (100.00%), Postives = 232/232 (100.00%), Query Frame = 3
Query:  102 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 797
            DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQVAAVLISLVLTLLVSVSLTIYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN
Sbjct:    3 DKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLFTLIESITVGFIIIQYQVAAVLISLVLTLLVSVSLTIYTFQTKRDFSTWGAGLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHRLSAEEYILACIDLYLDIINLFLHILRIVGASRSN 234          
BLAST of Protein lifeguard 4 vs. Planmine SMEST
Match: SMESG000014373.1 (SMESG000014373.1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.354e-20
Identity = 75/218 (34.40%), Postives = 125/218 (57.34%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCI-MMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVL---RKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFA-GLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGAS 788
            SIRL F+RKVY ILS+Q  M   IG + +M+F E ++ +++ N ++  + + + IV+++ +      R+  P N + L  FTL ES  +G I I      V  + V+TL + V++TI+ FQTK DF+    GL    +V L F GI  L +++  + +I    G  +FS+ ++ DT + +     + +S E+YI A ++LY+DI+ +FL +L I   S
Sbjct:  126 SIRLAFIRKVYAILSLQ--MVITIGLMALMLFVEPIKLWVQRNKYLYIVAIAIVIVLMVVLGCFTGPRRKFPLNIILLLAFTLAESFMLGVISISKDTRYVAYATVITLAIVVAITIFAFQTKIDFTYLSGGLLILSIVFLAF-GIFALIMRNRLVNLIYCCIGVLIFSIFLLVDTQLMLGGNHSYSISPEDYIFAALNLYVDIVQIFLMVLGIFSNS 340          
BLAST of Protein lifeguard 4 vs. Planmine SMEST
Match: SMESG000014373.1 (SMESG000014373.1)

HSP 1 Score: 88.1965 bits (217), Expect = 8.504e-20
Identity = 75/218 (34.40%), Postives = 125/218 (57.34%), Query Frame = 3
Query:  165 SIRLGFLRKVYGILSVQLGMTTVIGCI-MMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVL---RKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLFA-GLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI-----HRLSAEEYILACIDLYLDIINLFLHILRIVGAS 788
            SIRL F+RKVY ILS+Q  M   IG + +M+F E ++ +++ N ++  + + + IV+++ +      R+  P N + L  FTL ES  +G I I      V  + V+TL + V++TI+ FQTK DF+    GL    +V L F GI  L +++  + +I    G  +FS+ ++ DT + +     + +S E+YI A ++LY+DI+ +FL +L I   S
Sbjct:  124 SIRLAFIRKVYAILSLQ--MVITIGLMALMLFVEPIKLWVQRNKYLYIVAIAIVIVLMVVLGCFTGPRRKFPLNIILLLAFTLAESFMLGVISISKDTRYVAYATVITLAIVVAITIFAFQTKIDFTYLSGGLLILSIVFLAF-GIFALIMRNRLVNLIYCCIGVLIFSIFLLVDTQLMLGGNHSYSISPEDYIFAALNLYVDIVQIFLMVLGIFSNS 338          
BLAST of Protein lifeguard 4 vs. Planmine SMEST
Match: SMESG000057144.1 (SMESG000057144.1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.110e-16
Identity = 79/239 (33.05%), Postives = 121/239 (50.63%), Query Frame = 3
Query:  132 MYGAT--VAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCIMMMFQESVRSFLKDNAWILFLCLILNIVVLITMFV---LRKTTPHNFLCLFLFTLIESITVGFIIIQYQXXXXXXXXXXXXXXXXXXXXYTFQTKRDFSTWGAGLF-------------AGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAI----HRLSAEEYILACIDLYLDIINLFLHILRIVG 782
            MYG     A S  S+R GF+RKVY I++ QL + T +   +  F E ++ ++K N W  +L   + IV  I +     +R+  P NF  L +FTL  S     I   Y+  AVL++  +T +V +S+TI+  QTK DF T  +G+               G++    G    +    +GL I++       F + +IYDT + I    + LS E+YI   + LYLDI+N+FL IL + G
Sbjct:   71 MYGGDNFAAFSDKSVRNGFIRKVYLIMTAQL-LVTCLFIAVFQFVEPIQKWVKRNPWFYYLSFAIFIVTYIALVCCPGVRRKYPGNFFALSIFTLALSYMTATIASFYETPAVLVAAGITAIVCISITIFAMQTKIDF-TMCSGMILVLSLVLLLTGLSCGIIYATMGPSKVVHAVYAGLCILV-------FGIYLIYDTQLVIGGRKYELSPEDYIEGALQLYLDIVNMFLIILSLFG 300          
The following BLAST results are available for this feature:
BLAST of Protein lifeguard 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMBIM43.894e-4846.61transmembrane BAX inhibitor motif containing 4 [So... [more]
TMBIM41.490e-3943.81transmembrane BAX inhibitor motif containing 4 [So... [more]
TMBIM41.876e-2941.84transmembrane BAX inhibitor motif containing 4 [So... [more]
TMBIM42.591e-2340.97transmembrane BAX inhibitor motif containing 4 [So... [more]
TMBIM48.906e-2340.56transmembrane BAX inhibitor motif containing 4 [So... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmbi-41.308e-3436.09Transmembrane BAX inhibitor motif-containing prote... [more]
tag-1201.597e-1729.05pep chromosome:WBcel235:V:9706603:9709814:-1 gene:... [more]
tag-1201.597e-1729.05pep chromosome:WBcel235:V:9707771:9709877:-1 gene:... [more]
Y42H9AR.22.757e-928.10pep chromosome:WBcel235:IV:8099918:8101424:1 gene:... [more]
xbx-65.482e-824.43X-BoX promoter element regulated [Source:UniProtK... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nmda11.801e-3338.99gene:FBgn0013305 transcript:FBtr0089876[more]
Nmda11.801e-3338.99gene:FBgn0013305 transcript:FBtr0309295[more]
Nmda11.801e-3338.99gene:FBgn0013305 transcript:FBtr0309294[more]
Nmda11.801e-3338.99gene:FBgn0013305 transcript:FBtr0089874[more]
Nmda11.977e-3338.99gene:FBgn0013305 transcript:FBtr0332883[more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmbim49.084e-4942.67transmembrane BAX inhibitor motif containing 4 [So... [more]
grinab1.223e-2336.24glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grinab1.325e-2336.24glutamate receptor, ionotropic, N-methyl D-asparta... [more]
zgc:1104101.716e-2031.36zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
zgc:1104101.716e-2031.36zgc:110410 [Source:ZFIN;Acc:ZDB-GENE-050522-465][more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rwdd11.074e-4143.89RWD domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
rwdd14.656e-2939.37RWD domain containing 1 [Source:Xenbase;Acc:XB-GEN... [more]
grina9.251e-2435.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
grina9.251e-2435.95glutamate receptor, ionotropic, N-methyl D-asparta... [more]
tmbim16.674e-1732.50transmembrane BAX inhibitor motif containing 1 [So... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tmbim44.238e-5345.70transmembrane BAX inhibitor motif containing 4 [So... [more]
Tmbim75.263e-2033.48transmembrane BAX inhibitor motif containing 7 [So... [more]
Tmbim71.478e-1831.03transmembrane BAX inhibitor motif containing 7 [So... [more]
Grina7.204e-1832.26glutamate receptor, ionotropic, N-methyl D-asparta... [more]
Tmbim14.922e-1632.88transmembrane BAX inhibitor motif containing 1 [So... [more]
back to top
BLAST of Protein lifeguard 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DA39|LFG4_MOUSE2.965e-5245.70Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tm... [more]
sp|Q9HC24|LFG4_HUMAN1.870e-4746.61Protein lifeguard 4 OS=Homo sapiens OX=9606 GN=TMB... [more]
sp|Q49P94|GAAP_VACCL1.147e-4141.90Golgi anti-apoptotic protein OS=Vaccinia virus (st... [more]
sp|Q11080|TMBI4_CAEEL1.664e-3336.09Transmembrane BAX inhibitor motif-containing prote... [more]
sp|O74888|BXI1_SCHPO6.459e-3336.32Bax inhibitor 1 OS=Schizosaccharomyces pombe (stra... [more]
back to top
BLAST of Protein lifeguard 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293M4S45.927e-6651.72Uncharacterized protein (Fragment) OS=Ornithodoros... [more]
A0A023FGJ57.205e-6650.87Putative golgi antiapoptotic protein OS=Amblyomma ... [more]
A0A1E1XGI69.148e-6651.30Putative golgi antiapoptotic protein OS=Amblyomma ... [more]
A0A023FVL91.161e-6550.87Putative golgi antiapoptotic protein OS=Amblyomma ... [more]
A0A2R5LAQ22.064e-6550.86Putative golgi antiapoptotic protein OS=Ornithodor... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmbim47.319e-5444.44transmembrane BAX inhibitor motif containing 4 [So... [more]
grinab5.601e-2331.80protein lifeguard 1-like [Source:NCBI gene;Acc:103... [more]
grinab1.184e-2231.80protein lifeguard 1-like [Source:NCBI gene;Acc:103... [more]
grinaa9.375e-2235.02glutamate ionotropic receptor NMDA type subunit as... [more]
zgc:1104106.623e-2132.73protein lifeguard 1-like [Source:NCBI gene;Acc:111... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grinaa8.348e-1932.34glutamate receptor, ionotropic, N-methyl D-asparta... [more]
faim2a3.635e-1529.36Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
faim2a7.698e-1531.78Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
ENSPMAT00000007086.16.767e-1032.67pep scaffold:Pmarinus_7.0:GL482243:1328:8907:1 gen... [more]
faim2a1.902e-929.68Fas apoptotic inhibitory molecule 2a [Source:ZFIN;... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BXI15.553e-924.91Protein involved in apoptosis; variously described... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO481597.739e-6044.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375742.303e-3036.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493751.137e-2034.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein lifeguard 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grinab3.218e-2536.21protein lifeguard 1 [Source:NCBI gene;Acc:10116133... [more]
grinaa1.645e-2232.48protein lifeguard 1 [Source:NCBI gene;Acc:10116465... [more]
tmbim1a9.282e-2136.36transmembrane BAX inhibitor motif containing 1 [So... [more]
zgc:1104103.128e-1629.46protein lifeguard 1 [Source:NCBI gene;Acc:10116756... [more]
tmbim1b2.351e-1533.05protein lifeguard 3-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Protein lifeguard 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000027408.11.184e-150100.00SMESG000027408.1[more]
SMESG000014373.18.354e-2034.40SMESG000014373.1[more]
SMESG000014373.18.504e-2034.40SMESG000014373.1[more]
SMESG000057144.12.110e-1633.05SMESG000057144.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013653 ID=SMED30013653|Name=Protein lifeguard 4|organism=Schmidtea mediterranea sexual|type=transcript|length=906bp
GACCATTTGAAATTCTTAGTCGAACTTAATAAAATCGTTAATCTTTTTAA
ATAATCTATTTTTAAAAGATTAGATTTTTTAATCGAATAATAAACATGTT
TGACAAAGAAAGCGGAAATATCGAGGATTTTATGTATGGAGCAACTGTTG
CTCAGTCTCATGTTTCTATTCGGCTTGGCTTTCTACGTAAAGTCTATGGA
ATTTTGTCAGTTCAATTAGGAATGACAACAGTGATTGGATGTATTATGAT
GATGTTCCAAGAATCTGTTCGTTCGTTTTTAAAGGATAACGCTTGGATTC
TATTTCTCTGTCTTATATTAAACATTGTGGTACTGATCACCATGTTTGTT
CTGCGCAAAACTACTCCACATAACTTTTTGTGCCTATTTTTATTTACATT
AATTGAATCAATCACTGTTGGATTTATTATAATTCAATACCAAGTTGCAG
CGGTTCTCATTTCTCTCGTTTTAACGTTACTTGTTAGTGTATCATTAACC
ATTTACACATTTCAAACAAAGCGTGACTTTTCAACATGGGGAGCTGGTTT
GTTTGCCGGTCTAGTGATTCTTTGTTTTGGCGGAATTATTCAATTATTTG
TCAAAAGCTCTGGTTTGGAAATCATTTTGGCAATTGGTGGAGCCTTTTTA
TTTTCAATGCTAATAATATATGATACATGGATGGCTATTCATAGATTGAG
TGCCGAGGAATACATCCTCGCGTGCATTGATCTTTACTTGGATATTATCA
ATCTATTCTTACATATTTTAAGAATTGTCGGAGCTTCTCGAAGCAATTAA
AATGAATAATGTCATTAAAATTACATAATGCTTTGAAACGCTATTGCTAC
TTGAATCTTGGTTATGTCATCATAAAATATATTTAATTTCTCTGTTGAAA
AAAAAA
back to top

protein sequence of SMED30013653-orf-1

>SMED30013653-orf-1 ID=SMED30013653-orf-1|Name=SMED30013653-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=235bp
MFDKESGNIEDFMYGATVAQSHVSIRLGFLRKVYGILSVQLGMTTVIGCI
MMMFQESVRSFLKDNAWILFLCLILNIVVLITMFVLRKTTPHNFLCLFLF
TLIESITVGFIIIQYQVAAVLISLVLTLLVSVSLTIYTFQTKRDFSTWGA
GLFAGLVILCFGGIIQLFVKSSGLEIILAIGGAFLFSMLIIYDTWMAIHR
LSAEEYILACIDLYLDIINLFLHILRIVGASRSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006214Bax_inhibitor_1-related
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006214Bax inhibitor 1-relatedPFAMPF01027Bax1-Icoord: 29..227
e-value: 1.1E-41
score: 143.0
IPR006214Bax inhibitor 1-relatedPANTHERPTHR23291BAX INHIBITOR-RELATEDcoord: 10..228
NoneNo IPR availablePANTHERPTHR23291:SF50PROTEIN LIFEGUARD 4coord: 10..228
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 173..192
NoneNo IPR availableTMHMMTMhelixcoord: 94..113
NoneNo IPR availableTMHMMTMhelixcoord: 117..139