Glycine--tRNA ligase

Overview
NameGlycine--tRNA ligase
Smed IDSMED30013638
Length (bp)1918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycine--tRNA ligase (SMED30013638) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycine--tRNA ligase (SMED30013638) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycine--tRNA ligase (SMED30013638) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycine--tRNA ligase (SMED30013638) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013638

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30013638h1SMcG0004365 dd_Smed_v4_3958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013638h1SMcG0004365 dd_Smed_v4_3958_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycine--tRNA ligase vs. Ensembl Human
Match: GARS1 (glycyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:4162])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 300/614 (48.86%), Postives = 427/614 (69.54%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS +  N+LS P  FNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F+ VA L++ ++++  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +P+   IGK++ K A ++ +Y+    E     ++  + E  + ++  +   F++ +D   +   ++T++ EE VPNVIEPSFGLGRI Y + E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FG+TIDFD++N  P + T+R+RDSM+Q+R  + ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  118 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQET 731          
BLAST of Glycine--tRNA ligase vs. Ensembl Celegans
Match: gars-1 (Glycine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q10039])

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 287/612 (46.90%), Postives = 409/612 (66.83%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGGV G YD+ P G  +  N++ EW   F+  E ML ++C  +TPE VLKASGHV+RF D++VKD+  GE FRADHLI++ +  L+ND   +   K+D +D++ +++ F   ++ E+I  FN KS +  N+L+ P  FNLMF T IGP+G+ K +LRPETAQGIFVNFK+LL+  QGKLPFA AQIG+  RNEISPR GL+RVREF M EIEHF+DP DKS  +F  VA   + +F++ NQ+ G   + + +G+AV  K +ANETLGY+M R + FLMKVGI  +  RFRQH+ NEMAHYA DCWDAE LTSYGWIECVG ADR+ YDLQ+H + + VKLVA++ L EP  V  V  + NM L+GKSF K A  ++  ++ L+ +   AL++++      ++++D  ++ +  +H  + +  + IH +E  P+VIEPS+G+GRI Y L+E +F  RE D  RT+      +A  + S+LPIS+ND   P+++ + +     ++   +D ++ ++G+RYARTD IGIPFGIT+DFDS+   P +VTIR  ++M Q+R+ V EL +L   LV G   W +    YP FE   +
Sbjct:  130 DRLKLEDLLKRRFFYDQSFAIYGGVTGLYDFGPMGCSLKANMLQEWRKHFILEEGMLEVDCTSLTPEPVLKASGHVDRFADWMVKDMKNGECFRADHLIKNSIEKLLNDKKTSAAVKQDGQDVLARLEGFDNKDMHEVITRFNFKSPITGNDLTEPIAFNLMFPTQIGPTGDFKAFLRPETAQGIFVNFKRLLEFNQGKLPFAAAQIGLGFRNEISPRQGLIRVREFTMCEIEHFVDPEDKSLAKFAKVADQKLVLFSACNQLDGAPAQEVAIGEAVAKKTVANETLGYYMARCHQFLMKVGIDGRRLRFRQHLSNEMAHYAQDCWDAEILTSYGWIECVGNADRACYDLQQHYKATNVKLVAEKKLPEPVDVNFVEAQANMALLGKSFKKDAKKIQTSLQQLTSEQVSALEEELLAKKLYNLSVDGQNYALTPEHLNIKKYTKKIHVQEITPSVIEPSYGIGRIMYALLEHSFRQREGDEQRTFLAFKPLVAPIKCSVLPISANDTLIPVMDAVKEELSRFEMSYKVDDSSGTIGRRYARTDEIGIPFGITVDFDSLKTTPFTVTIRHAETMSQIRLEVSELGRLISDLVAGRQQWSDAQAKYPKFEASAT 741          
BLAST of Glycine--tRNA ligase vs. Ensembl Celegans
Match: gars-1 (Glycine--tRNA ligase [Source:UniProtKB/Swiss-Prot;Acc:Q10039])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 287/612 (46.90%), Postives = 409/612 (66.83%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGGV G YD+ P G  +  N++ EW   F+  E ML ++C  +TPE VLKASGHV+RF D++VKD+  GE FRADHLI++ +  L+ND   +   K+D +D++ +++ F   ++ E+I  FN KS +  N+L+ P  FNLMF T IGP+G+ K +LRPETAQGIFVNFK+LL+  QGKLPFA AQIG+  RNEISPR GL+RVREF M EIEHF+DP DKS  +F  VA   + +F++ NQ+ G   + + +G+AV  K +ANETLGY+M R + FLMKVGI  +  RFRQH+ NEMAHYA DCWDAE LTSYGWIECVG ADR+ YDLQ+H + + VKLVA++ L EP  V  V  + NM L+GKSF K A  ++  ++ L+ +   AL++++      ++++D  ++ +  +H  + +  + IH +E  P+VIEPS+G+GRI Y L+E +F  RE D  RT+      +A  + S+LPIS+ND   P+++ + +     ++   +D ++ ++G+RYARTD IGIPFGIT+DFDS+   P +VTIR  ++M Q+R+ V EL +L   LV G   W +    YP FE   +
Sbjct:   66 DRLKLEDLLKRRFFYDQSFAIYGGVTGLYDFGPMGCSLKANMLQEWRKHFILEEGMLEVDCTSLTPEPVLKASGHVDRFADWMVKDMKNGECFRADHLIKNSIEKLLNDKKTSAAVKQDGQDVLARLEGFDNKDMHEVITRFNFKSPITGNDLTEPIAFNLMFPTQIGPTGDFKAFLRPETAQGIFVNFKRLLEFNQGKLPFAAAQIGLGFRNEISPRQGLIRVREFTMCEIEHFVDPEDKSLAKFAKVADQKLVLFSACNQLDGAPAQEVAIGEAVAKKTVANETLGYYMARCHQFLMKVGIDGRRLRFRQHLSNEMAHYAQDCWDAEILTSYGWIECVGNADRACYDLQQHYKATNVKLVAEKKLPEPVDVNFVEAQANMALLGKSFKKDAKKIQTSLQQLTSEQVSALEEELLAKKLYNLSVDGQNYALTPEHLNIKKYTKKIHVQEITPSVIEPSYGIGRIMYALLEHSFRQREGDEQRTFLAFKPLVAPIKCSVLPISANDTLIPVMDAVKEELSRFEMSYKVDDSSGTIGRRYARTDEIGIPFGITVDFDSLKTTPFTVTIRHAETMSQIRLEVSELGRLISDLVAGRQQWSDAQAKYPKFEASAT 677          
BLAST of Glycine--tRNA ligase vs. Ensembl Fly
Match: GlyRS (gene:FBgn0027088 transcript:FBtr0333934)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 300/613 (48.94%), Postives = 418/613 (68.19%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLS-EKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGG+ G YD+ P G  +  NI+  W  +F   E ML ++C I+TPE VLKASGHVERF D +VKD+ TGE FR DHLI+  L  L      T   + + EDI+ K+D   + ELA ++  +NIKS +  N+L+ P  FNLMF T IGP+G +KG+LRPETAQGIFVNFK+LL+  QGKLPFAVAQIG S RNEISPRSGL+RVREF MAEIEHF DP+ K H +F  +    + ++++ NQM GKS   + +G+AV +K++ANETLGY+M RI  FL+ +GIKP+  RFRQHM NEMAHYACDCWDAE LTSYGW+ECVGCADRSAYDL +HT  +GV+LVA++ L  PK V      PN + +GK+F K A  +   +  LS E+ +K  ++   +   K  T D    ++ +D   +    +T+H EEF+P+V+EPSFG+GRI Y L+E +F  R+ D  R YFT+P  +A  + SILP+S+N DF+P  + +S      ++   +D ++ S+G+RYARTD I IP+GIT+DFD++  +P +VT+R+R++M+QVR+ ++E+  +   L     +W++V   YP+FE Q++
Sbjct:  152 DRAKMEDLLKRRFFYDQSFAIYGGITGQYDFGPMGCALKSNILALWRQYFALEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALEKLSKAKDATPALQAECEDIIIKLDGLNKQELAGVLAKYNIKSPLTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQIGNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKSAAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHSTKTVHVEEFIPSVVEPSFGIGRIMYSLLEHSFQCRDGDEQRCYFTLPPLVAPIKCSILPLSNNTDFQPYTQKLSSALTKAELSHKVDDSSGSIGRRYARTDEIAIPYGITVDFDTLK-EPHTVTLRDRNTMKQVRVGLEEVVGVVKDLSTARTTWESVTEQYPLFEQQEA 763          
BLAST of Glycine--tRNA ligase vs. Ensembl Fly
Match: GlyRS (gene:FBgn0027088 transcript:FBtr0075633)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 300/613 (48.94%), Postives = 418/613 (68.19%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLS-EKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGG+ G YD+ P G  +  NI+  W  +F   E ML ++C I+TPE VLKASGHVERF D +VKD+ TGE FR DHLI+  L  L      T   + + EDI+ K+D   + ELA ++  +NIKS +  N+L+ P  FNLMF T IGP+G +KG+LRPETAQGIFVNFK+LL+  QGKLPFAVAQIG S RNEISPRSGL+RVREF MAEIEHF DP+ K H +F  +    + ++++ NQM GKS   + +G+AV +K++ANETLGY+M RI  FL+ +GIKP+  RFRQHM NEMAHYACDCWDAE LTSYGW+ECVGCADRSAYDL +HT  +GV+LVA++ L  PK V      PN + +GK+F K A  +   +  LS E+ +K  ++   +   K  T D    ++ +D   +    +T+H EEF+P+V+EPSFG+GRI Y L+E +F  R+ D  R YFT+P  +A  + SILP+S+N DF+P  + +S      ++   +D ++ S+G+RYARTD I IP+GIT+DFD++  +P +VT+R+R++M+QVR+ ++E+  +   L     +W++V   YP+FE Q++
Sbjct:  152 DRAKMEDLLKRRFFYDQSFAIYGGITGQYDFGPMGCALKSNILALWRQYFALEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALEKLSKAKDATPALQAECEDIIIKLDGLNKQELAGVLAKYNIKSPLTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQIGNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKSAAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHSTKTVHVEEFIPSVVEPSFGIGRIMYSLLEHSFQCRDGDEQRCYFTLPPLVAPIKCSILPLSNNTDFQPYTQKLSSALTKAELSHKVDDSSGSIGRRYARTDEIAIPYGITVDFDTLK-EPHTVTLRDRNTMKQVRVGLEEVVGVVKDLSTARTTWESVTEQYPLFEQQEA 763          
BLAST of Glycine--tRNA ligase vs. Ensembl Fly
Match: GlyRS (gene:FBgn0027088 transcript:FBtr0075632)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 300/613 (48.94%), Postives = 418/613 (68.19%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLS-EKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGG+ G YD+ P G  +  NI+  W  +F   E ML ++C I+TPE VLKASGHVERF D +VKD+ TGE FR DHLI+  L  L      T   + + EDI+ K+D   + ELA ++  +NIKS +  N+L+ P  FNLMF T IGP+G +KG+LRPETAQGIFVNFK+LL+  QGKLPFAVAQIG S RNEISPRSGL+RVREF MAEIEHF DP+ K H +F  +    + ++++ NQM GKS   + +G+AV +K++ANETLGY+M RI  FL+ +GIKP+  RFRQHM NEMAHYACDCWDAE LTSYGW+ECVGCADRSAYDL +HT  +GV+LVA++ L  PK V      PN + +GK+F K A  +   +  LS E+ +K  ++   +   K  T D    ++ +D   +    +T+H EEF+P+V+EPSFG+GRI Y L+E +F  R+ D  R YFT+P  +A  + SILP+S+N DF+P  + +S      ++   +D ++ S+G+RYARTD I IP+GIT+DFD++  +P +VT+R+R++M+QVR+ ++E+  +   L     +W++V   YP+FE Q++
Sbjct:   66 DRAKMEDLLKRRFFYDQSFAIYGGITGQYDFGPMGCALKSNILALWRQYFALEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKQALEKLSKAKDATPALQAECEDIIIKLDGLNKQELAGVLAKYNIKSPLTGNDLTEPIEFNLMFATQIGPTGLVKGFLRPETAQGIFVNFKRLLEFNQGKLPFAVAQIGNSFRNEISPRSGLIRVREFTMAEIEHFCDPVLKDHPKFGNIKSEKLTLYSACNQMDGKSAAQVQIGEAVASKLVANETLGYYMARIQQFLLAIGIKPECLRFRQHMSNEMAHYACDCWDAEILTSYGWVECVGCADRSAYDLGQHTAATGVRLVAEKRLPAPKTVEVSEIVPNKQALGKTFKKEAKNITDALAKLSLEEITKVEEQLAGDGQYKLTTADGQSHDLGKDTISVKHSTKTVHVEEFIPSVVEPSFGIGRIMYSLLEHSFQCRDGDEQRCYFTLPPLVAPIKCSILPLSNNTDFQPYTQKLSSALTKAELSHKVDDSSGSIGRRYARTDEIAIPYGITVDFDTLK-EPHTVTLRDRNTMKQVRVGLEEVVGVVKDLSTARTTWESVTEQYPLFEQQEA 677          
BLAST of Glycine--tRNA ligase vs. Ensembl Zebrafish
Match: gars1 (glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9174])

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 305/614 (49.67%), Postives = 424/614 (69.06%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGL-NELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NI+  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L++D     +KK ++++++ ++DN+ + ELA++   +N+KS    N+L+ P  FNLMF+TSIGP GN++GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  VA L+I +++S  Q SG+S +I+ LGDAV+  +I N  LGYF+GRIY++L+KVG+     RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   IGK++ K A    +Y+    E      +K + E+ + ++  +   F++ +D   +   ++T+H EE VPNVIEPSFG+GRI Y + E  F  RE D  RTYF+ PA +A Y+ S+LP+S N +F P +  +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP++   L  G ++W  V   YPIFEGQ++
Sbjct:   69 IVDRTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQVWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMSDKKCPAEKKAEMDNVITQMDNYTQQELADLFVQYNVKSPSTGNDLTPPISFNLMFQTSIGPGGNMQGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKVHFKFSNVADLDIMLYSSKAQTSGQSAQIMRLGDAVEQGVINNSVLGYFIGRIYLYLVKVGVAKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLCHARATKVPLVAEKPLKEPKVVNVVQFEPNKGAIGKAYKKDAKFAMEYLAICDECYITEQEKLLNENGEFTIETEGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIFEHTFRIREGDEQRTYFSFPATVAPYKCSVLPLSQNQEFMPFVRELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKNPHTATLRDRDSMRQIRAEVGELPEIIRDLANGAITWAEVESKYPIFEGQET 682          
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Match: tmem37 (transmembrane protein 37 [Source:Xenbase;Acc:XB-GENE-997841])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 304/614 (49.51%), Postives = 422/614 (68.73%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L+ D     +KK+++E ++ ++DN+ + +LA++   +N+KS + LN+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  +A L + +++S  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P+  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK +       +   IGK++ K A ++ +Y+    E      +K ++E  + S+  +   F + +D   + + ++TIH EE VPNVIEPSFGLGRI Y + E  F  R+ D  RT+FT PA +A Y+ S+LP+S N +F P ++ +SD      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   YP+FEGQ++
Sbjct:  124 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMADKKCPAEKKQEMESVLTQMDNYNQQDLADLFVTYNVKSPITLNDLTPPVSFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHPKFGNLADLILTLYSSKAQLSGESAHKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPEKLRFRQHMENEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTIDVTQFDASKSAIGKAYKKDAKLVLEYLAICDECFILEQEKLLQEKGEFSIETEGKTFLLTKDMVSVKKFQKTIHVEEIVPNVIEPSFGLGRIMYTVFEHTFQVRQGDEQRTFFTFPAIVAPYKCSVLPLSQNLEFMPFVKELSDALTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAAVSELPGIVRDLANGCLTWAEVETQYPVFEGQET 737          
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Match: tmem37 (transmembrane protein 37 [Source:Xenbase;Acc:XB-GENE-997841])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 301/620 (48.55%), Postives = 418/620 (67.42%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIP-----AWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L+ D     +KK+++E ++ ++DN+ + +LA++   +N+KS + LN+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  +A L + +++S  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P+  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEP     V     +   IGK++ K A ++ +Y+    E      +K ++E  + S+  +   F + +D   + + ++TIH EE VPNVIEPSFGLGRI Y + E  F  R+ D  RT  + P       +A Y+ S+LP+S N +F P ++ +SD      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   YP+FEGQ++
Sbjct:   64 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMADKKCPAEKKQEMESVLTQMDNYNQQDLADLFVTYNVKSPITLNDLTPPVSFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHPKFGNLADLILTLYSSKAQLSGESAHKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPEKLRFRQHMENEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPISFANVTQFDASKSAIGKAYKKDAKLVLEYLAICDECFILEQEKLLQEKGEFSIETEGKTFLLTKDMVSVKKFQKTIHVEEIVPNVIEPSFGLGRIMYTVFEHTFQVRQGDEQRTVISPPIRSAMLCVAPYKCSVLPLSQNLEFMPFVKELSDALTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAAVSELPGIVRDLANGCLTWAEVETQYPVFEGQET 683          
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Match: tmem37 (transmembrane protein 37 [Source:Xenbase;Acc:XB-GENE-997841])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 301/620 (48.55%), Postives = 418/620 (67.42%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIP-----AWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L+ D     +KK+++E ++ ++DN+ + +LA++   +N+KS + LN+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  +A L + +++S  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P+  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEP     V     +   IGK++ K A ++ +Y+    E      +K ++E  + S+  +   F + +D   + + ++TIH EE VPNVIEPSFGLGRI Y + E  F  R+ D  RT  + P       +A Y+ S+LP+S N +F P ++ +SD      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   YP+FEGQ++
Sbjct:   55 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMADKKCPAEKKQEMESVLTQMDNYNQQDLADLFVTYNVKSPITLNDLTPPVSFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHPKFGNLADLILTLYSSKAQLSGESAHKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPEKLRFRQHMENEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPISFANVTQFDASKSAIGKAYKKDAKLVLEYLAICDECFILEQEKLLQEKGEFSIETEGKTFLLTKDMVSVKKFQKTIHVEEIVPNVIEPSFGLGRIMYTVFEHTFQVRQGDEQRTVISPPIRSAMLCVAPYKCSVLPLSQNLEFMPFVKELSDALTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAAVSELPGIVRDLANGCLTWAEVETQYPVFEGQET 674          
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Match: tmem37 (transmembrane protein 37 [Source:Xenbase;Acc:XB-GENE-997841])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 301/620 (48.55%), Postives = 418/620 (67.42%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIP-----AWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L+ D     +KK+++E ++ ++DN+ + +LA++   +N+KS + LN+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  +A L + +++S  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P+  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEP     V     +   IGK++ K A ++ +Y+    E      +K ++E  + S+  +   F + +D   + + ++TIH EE VPNVIEPSFGLGRI Y + E  F  R+ D  RT  + P       +A Y+ S+LP+S N +F P ++ +SD      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   YP+FEGQ++
Sbjct:   79 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMADKKCPAEKKQEMESVLTQMDNYNQQDLADLFVTYNVKSPITLNDLTPPVSFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHPKFGNLADLILTLYSSKAQLSGESAHKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPEKLRFRQHMENEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPISFANVTQFDASKSAIGKAYKKDAKLVLEYLAICDECFILEQEKLLQEKGEFSIETEGKTFLLTKDMVSVKKFQKTIHVEEIVPNVIEPSFGLGRIMYTVFEHTFQVRQGDEQRTVISPPIRSAMLCVAPYKCSVLPLSQNLEFMPFVKELSDALTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAAVSELPGIVRDLANGCLTWAEVETQYPVFEGQET 698          
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Match: tmem37 (transmembrane protein 37 [Source:Xenbase;Acc:XB-GENE-997841])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 301/620 (48.55%), Postives = 418/620 (67.42%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIP-----AWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L+ D     +KK+++E ++ ++DN+ + +LA++   +N+KS + LN+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  +A L + +++S  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P+  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEP     V     +   IGK++ K A ++ +Y+    E      +K ++E  + S+  +   F + +D   + + ++TIH EE VPNVIEPSFGLGRI Y + E  F  R+ D  RT  + P       +A Y+ S+LP+S N +F P ++ +SD      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   YP+FEGQ++
Sbjct:   65 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQIWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMADKKCPAEKKQEMESVLTQMDNYNQQDLADLFVTYNVKSPITLNDLTPPVSFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHPKFGNLADLILTLYSSKAQLSGESAHKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPEKLRFRQHMENEMAHYACDCWDAEAKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPISFANVTQFDASKSAIGKAYKKDAKLVLEYLAICDECFILEQEKLLQEKGEFSIETEGKTFLLTKDMVSVKKFQKTIHVEEIVPNVIEPSFGLGRIMYTVFEHTFQVRQGDEQRTVISPPIRSAMLCVAPYKCSVLPLSQNLEFMPFVKELSDALTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNRTPHTATLRDRDSMRQIRAAVSELPGIVRDLANGCLTWAEVETQYPVFEGQET 684          
BLAST of Glycine--tRNA ligase vs. Ensembl Mouse
Match: Gars (glycyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:2449057])

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 302/614 (49.19%), Postives = 429/614 (69.87%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS    N+LS P PFNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F++VA L + ++++  Q++G+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   +GK++ K A ++ +Y+ +  E     ++  + E  + ++  +   F++ +D   +   ++T+H EE VP+VIEPSFGLGRI Y ++E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  108 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFQSVADLCLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRDLANGNITWADVEARYPLFEGQET 721          
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q9CZD3|GARS_MOUSE (Glycine--tRNA ligase OS=Mus musculus OX=10090 GN=Gars1 PE=1 SV=1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 302/614 (49.19%), Postives = 429/614 (69.87%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS    N+LS P PFNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F++VA L + ++++  Q++G+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   +GK++ K A ++ +Y+ +  E     ++  + E  + ++  +   F++ +D   +   ++T+H EE VP+VIEPSFGLGRI Y ++E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  108 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFQSVADLCLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLSACDECYISEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPNVVRDLANGNITWADVEARYPLFEGQET 721          
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q5I0G4|GARS_RAT (Glycine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Gars1 PE=1 SV=2)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 302/614 (49.19%), Postives = 428/614 (69.71%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS    N+LS P PFNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F +VA L + ++++  Q++G+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   +GK++ K A ++ +Y+ +  E     ++  + E  + ++  +   F++ +D   +   ++T+H EE VP+VIEPSFGLGRI Y ++E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  107 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSAEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPTTGNDLSPPVPFNLMFQTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTEKDHPKFPSVADLYLYLYSAKAQVTGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAVGKAYKKDAKLVLEYLGACDECYITEMELLLSEKGEFTIETEGKTFQLTKDMVSVKRFQKTLHVEEVVPSVIEPSFGLGRIMYTILEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSVVRDLANGNITWADVEARYPLFEGQET 720          
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q5RBL1|GARS_PONAB (Glycine--tRNA ligase OS=Pongo abelii OX=9601 GN=GARS1 PE=2 SV=1)

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 302/614 (49.19%), Postives = 427/614 (69.54%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS +  N+LS P  FNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F+ VA L++ ++++  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   IGK++ K A ++ +Y+    E     ++  + E  + ++  +   F++ +D   +   ++T++ EE VPNVIEPSFGLGRI Y + E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FG+TIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  118 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPNKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMVNVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPSIVRDLANGNITWADVEARYPLFEGQET 731          
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Match: sp|P41250|GARS_HUMAN (Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3)

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 300/614 (48.86%), Postives = 427/614 (69.54%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NII  W   F++ E +L I+C ++TPE VLK SGHV++F D++VKD+  GE FRADHL++++L  L++D   + +KK ++E ++ ++DN+G+ ELA++  N+N+KS +  N+LS P  FNLMF+T IGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F+ VA L++ ++++  Q+SG+S   + LGDAV+  +I N  LGYF+GRIY++L KVGI P   RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +P+   IGK++ K A ++ +Y+    E     ++  + E  + ++  +   F++ +D   +   ++T++ EE VPNVIEPSFGLGRI Y + E  F  RE D  RT+F+ PA +A ++ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IG+ FG+TIDFD++N  P + T+R+RDSM+Q+R  + ELP +   L  G ++W +V   YP+FEGQ++
Sbjct:  118 IVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVADLHLYLYSAKAQVSGQSARKMRLGDAVEQGVINNTVLGYFIGRIYLYLTKVGISPDKLRFRQHMENEMAHYACDCWDAESKTSYGWIEIVGCADRSCYDLSCHARATKVPLVAEKPLKEPKTVNVVQFEPSKGAIGKAYKKDAKLVMEYLAICDECYITEMEMLLNEKGEFTIETEGKTFQLTKDMINVKRFQKTLYVEEVVPNVIEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQNQEFMPFVKELSEALTRHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQET 731          
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Match: sp|Q04451|SYG_BOMMO (Glycine--tRNA ligase OS=Bombyx mori OX=7091 PE=1 SV=2)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 292/612 (47.71%), Postives = 420/612 (68.63%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ Y QS  IYGG+ G +D+ P G  +  N+IH W  FF+ +E ML +EC I+TPE VLKASGHVERF D + KDI TGE FR DHLI+ +L  + +D     + K +IEDI+ K+D    +E++ +++ F +KS +  N+L+ P  FNLMF T IGPSG +KG+LRPETAQGIFVNFK+LL+  QG+LPFA AQIG S RNEISPRSGLLRVREF M EIEHF D   K H +F++V +    ++++ NQ  GK  ++  +GDAV   I+ NETLGYFM RI+M+++ VGI P+  RFRQHM NEMAHYACDCWDAECL+SYGWIECVGCADRSAYDL +HT+ +G++L A++ L  PK++  V    N   IGK+F K +  +   + +L     + + K++  + + ++     +F++      + + ++TIH EE +P+VIEPSFG+GRI YC++E NF  RE D  RTYF++P  +A  +  +LP+S N +F+P +  +S     +D+   +D ++ S+G+RYARTD +G+P+ +T+DFD+I  +P +VT+RERDSM+QVR+ + ++P +   L    + W +V + YP FE Q++
Sbjct:   66 DRAKMEDLIKRRFFYDQSFAIYGGITGQFDFGPMGCALKSNMIHLWKKFFILQEQMLEVECSILTPEPVLKASGHVERFADLMTKDIKTGECFRLDHLIKGHLEKIKSDKNTKIELKAEIEDILIKLDGMNADEMSALMKRFEMKSPISGNDLTPPIEFNLMFNTQIGPSGLVKGFLRPETAQGIFVNFKRLLEFNQGRLPFAAAQIGNSFRNEISPRSGLLRVREFTMCEIEHFCDV--KEHPKFESVKNTQSLLYSADNQEQGKPADLTTIGDAVCKGIVNNETLGYFMARIHMYMLAVGIDPKRLRFRQHMGNEMAHYACDCWDAECLSSYGWIECVGCADRSAYDLTQHTKATGIRLAAEKKLPAPKQIEVVEAIANNGRIGKAFKKDSQAINDTLATLDNAALEEMQKELDSNGEYTLITARGEFKLTPSLVNVKKTQKTIHVEEIIPSVIEPSFGVGRILYCILEHNFRMREGDEQRTYFSLPPTVAPMKCVVLPLSGNAEFQPFVRDLSQELITVDVSHKVDDSSGSIGRRYARTDELGVPYAVTVDFDTIK-EPHTVTLRERDSMRQVRLPMADVPTVVRDLSNSKILWSDVEQKYPKFEQQET 674          
BLAST of Glycine--tRNA ligase vs. TrEMBL
Match: A0A154PEH1 (Glycine--tRNA ligase OS=Dufourea novaeangliae OX=178035 GN=WN55_01378 PE=4 SV=1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 329/622 (52.89%), Postives = 438/622 (70.42%), Query Frame = 2
Query:   17 LKMSNVKIADKEKFRNIFQTQ-YVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDN-IDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            L +S   + DK +  ++ + + Y+ QS  IYGG+ G +D+ P G     N+++ W  FF+  E ML ++C I+TPE VLKASGHVERF D +VKD+ +GE FR DHLI+++L  +I+D    D  + +  DI+ K+D   + E+A ++  FN+KS +  N+L+ P  FNLMF T IGPSG +KGYLRPETAQGIFVNFK+LL   Q +LPFA AQIG + RNEISPRSGL+RVREF MAEIEHF DP DKSH +F+T+  L + ++++ NQM GKS E + LGDAV +K+IANETLGYFMGRIY FL+KVG+ P+  RFRQHM NEMAHYACDCWDAECLTSYGW+ECVGCADRSAYDL +HT+ +GVKLVA++ L  PK V      PN  LIGK+F K + +++  +E+L+E +  AL+ D  E  +  + L N    +I +D  ++   ++T+H EE +P+VIEPSFG+GRI Y + E NF TRE D  RTYF++P  +A  + S+LP+S ND+F P ++ +S     LD+   ID ++ S+G+RYARTD I IPFGITIDFD++   P S T+RERDSM QVRI +DELP +   L  G ++W  V   YP FE Q+S
Sbjct:  117 LSLSETTLFDKARMEDLLKRRFYLDQSFAIYGGITGQFDFGPMGCAFKTNLLNHWRNFFILEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKSGECFRLDHLIKAHLEKIISDKKTDDNTRAECRDIIIKLDGMTKGEMAAVLIKFNMKSPISGNDLTEPIEFNLMFGTQIGPSGLIKGYLRPETAQGIFVNFKRLLAFNQERLPFAAAQIGNAFRNEISPRSGLIRVREFTMAEIEHFCDPNDKSHPKFETIKDLKLLLYSACNQMDGKSAEHITLGDAVMSKLIANETLGYFMGRIYQFLVKVGVDPKKLRFRQHMGNEMAHYACDCWDAECLTSYGWVECVGCADRSAYDLTQHTKATGVKLVAEKKLPAPKNVDICEIVPNKVLIGKTFKKDSKLVQSALEALNESEINALEADFDEKGEHDLKLSNDTKIKITKDMIQVKRYQKTVHVEEIIPSVIEPSFGIGRIMYAIFEHNFRTREGDEKRTYFSLPPVVAPLKCSVLPLSGNDEFVPFVKQLSQNLTKLDVSHKIDDSSGSIGRRYARTDEIAIPFGITIDFDTLKT-PHSATLRERDSMGQVRINLDELPSVVRDLSYGKITWSEVEAKYPKFEQQES 737          
BLAST of Glycine--tRNA ligase vs. TrEMBL
Match: A0A151IZ28 (Glycyl-tRNA synthetase OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_14060 PE=4 SV=1)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 325/622 (52.25%), Postives = 442/622 (71.06%), Query Frame = 2
Query:   17 LKMSNVKIADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTL-DNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            L  SNV   D+ +  ++ + ++   QS  IYGG+ G YD+ P G  +  N+I+ W  FFV  E ML ++C I+TPE VLKASGHVERF D +VKD+ TGE FR DHLI+++L  +I D    D+ +++  DIV K+D   ++E+A ++  +N+KS V  N+L+ P  FNLMF+T IGP+G +KG+LRPETAQGIFVNFK+LL   Q +LPFA AQIG + RNEISPRSGL+RVREF MAEIEHF DP DKSH +F+TV  +++ ++++ NQM GKS + L +G+AV + ++ANETLGYFM RI+ FL+KVGI P   RFRQHM NEMAHYACDCWDAECLTSYGWIECVGCADRSAYDL +HT+ +GVKLVA++ L  PK V      PN  LIGK+F K + +++  + +L++K+ ++L++ + E  +  +TL +N+  +I +D  E+   ++T+H EE +P+VIEPSFG+GRI Y L E NF  RE D  RTYF++P  +A  + S+LP+S ND+F P ++ +S      DI   +D ++ S+G+RYARTD I IPFGITIDFD++ + P S T+R+RDSM QVRI +DELP +   L  G  +W  V   YP FE Q+S
Sbjct:  120 LASSNVTF-DRARMEDLLKRRFFLDQSFAIYGGITGQYDFGPMGCSLKTNLINAWRNFFVLEEQMLEVDCSILTPEPVLKASGHVERFADLMVKDVKTGECFRLDHLIKAHLEKVICDKKTNDKTREECRDIVIKLDGMTKDEMAAVLLKYNMKSPVSGNDLTEPIEFNLMFDTHIGPTGLVKGFLRPETAQGIFVNFKRLLAFNQERLPFAAAQIGNAFRNEISPRSGLIRVREFTMAEIEHFCDPSDKSHPKFETVKDIDMLLYSACNQMDGKSAQRLTIGEAVSSGLVANETLGYFMARIHQFLLKVGIDPNRLRFRQHMSNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQHTKATGVKLVAEKKLPAPKTVDVCEIMPNKVLIGKTFKKDSKVVQDALAALNKKEIESLERVLSEKGEHELTLPNNVVVKITKDIIEVKRYQKTVHVEEIIPSVIEPSFGIGRIMYALFEHNFQAREGDEKRTYFSLPPVVAPLKCSVLPLSGNDEFVPFVKKLSQDLTKADISHKVDDSSGSIGRRYARTDEIAIPFGITIDFDTLKM-PHSATLRDRDSMGQVRINLDELPSVVRDLSYGRTTWTEVETKYPKFEQQES 739          
BLAST of Glycine--tRNA ligase vs. TrEMBL
Match: A0A195ATP8 (Glycyl-tRNA synthetase OS=Atta colombica OX=520822 GN=ALC53_13999 PE=4 SV=1)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 324/622 (52.09%), Postives = 440/622 (70.74%), Query Frame = 2
Query:   17 LKMSNVKIADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTL-DNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            L  SNV   D+ +  ++ + ++   QS  IYGG+ G YD+ P G  +  N+I+ W  FFV  E ML ++C I+TPE VLK SGHVERF D +VKDI TGE FR DHLI+++L  +I D    D+ +++  DI+ K+D   ++E+A ++  +N+KS V  N+L+ P  FNLMF T IGP+G +KG+LRPETAQGIFVNFK+LL   Q +LPFA AQIG + RNEISPRSGL+RVREF MAEIEHF DP DKSH +F+TV  +++ ++++ NQM GKS + L +G+AV + ++ANETLGYFM RI+ FL+K+GI P   RFRQHM NEMAHYACDCWDAECLTSYGWIECVGCADRSAYDL +HT+ +GVKLVA++ L  PK V      PN  LIGK+F K + +++  + +L++K+ ++L+K + E  +  +TL +N+  +I +D  E+   ++T+H EE +P+VIEPSFG+GRI Y L E NF  RE D  RTYF++P  +A  + S+LP+S ND+F P ++ +S      D+   +D ++ S+G+RYARTD I IPFGITIDFD++ I P S T+R+RDSM QVRI +DELP +   L  G  +W  V   YP FE Q+S
Sbjct:  120 LASSNVTF-DRARMEDLLKRRFFLDQSFAIYGGITGQYDFGPMGCSLKTNLINAWRNFFVLEEQMLEVDCSILTPEPVLKTSGHVERFADLMVKDIKTGECFRLDHLIKAHLEKVIYDKKTNDKTREECRDIIIKLDGMTKDEMAAVLLKYNMKSPVSGNDLTEPIEFNLMFGTQIGPTGLVKGFLRPETAQGIFVNFKRLLAFNQERLPFAAAQIGNAFRNEISPRSGLIRVREFTMAEIEHFCDPSDKSHPKFETVTDMDMLLYSACNQMDGKSAQRLTIGEAVSSGLVANETLGYFMARIHQFLLKIGIDPNRLRFRQHMSNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLTQHTKATGVKLVAEKKLPAPKTVDVCEIMPNKVLIGKTFKKDSKVVQDALAALNKKEIESLEKVLSEKGEHELTLPNNVVMKITKDMIEVKRYQKTVHVEEIIPSVIEPSFGIGRIMYALFEHNFQAREGDEKRTYFSLPPVVAPLKCSVLPLSGNDEFVPFVKKLSQDLTKADVSHKVDDSSGSIGRRYARTDEIAIPFGITIDFDTLKI-PHSATLRDRDSMGQVRIDLDELPGVVRDLSYGRTTWTEVETKYPKFEQQES 739          
BLAST of Glycine--tRNA ligase vs. TrEMBL
Match: A0A564YXG5 (Uncharacterized protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10250 PE=4 SV=1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 315/612 (51.47%), Postives = 433/612 (70.75%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++VY QS  IYGG+QG YDY P G  I  NI+  W  FFV  E +L ++C ++TPE VLKASGHVERF DY+V+D +TGE FRADHL+E  L         ++ +KK+I+  + +IDN+G  EL E+I+ +++KS    N+++  + FNLMF TSIGP+G ++G+LRPETAQGIFVNF++LL   QG+LPF  AQIG + RNEISPRSG++RVREF MAEIE F+DP DK+H +F   A L + +F++ +QM GKS   + L DAV   IIANETL YFM RIY+FL  VG+KP   RFRQHM NEMAHYACDCWDAECLT+YGWIECVGCADRS YDL +H + +GV+LVA++ L EP K+  V C PN   IGK+F   A  + +  E  S +++  L +++ +  K +++++  +FEI  D   + E + T+H EE VP+VIEPSFG+GRI Y ++E NF TRE+D  RT+ ++P  IA Y+ S+LP+SS+ DF P +  +S+    + I   +D +  S+G+RYARTD I IP+GITIDFD+IN KP S T+RERD+M+Q+R+ +++LP+L   L  G+VSW + +  YP FE Q++
Sbjct:  113 DRSKLEDLLKQKFVYDQSFSIYGGIQGLYDYGPIGCSIKANILSAWRQFFVLEEQLLEVDCSMLTPEPVLKASGHVERFTDYMVRDAITGECFRADHLVEGALEAKRALKGTSETEKKEIDKYLAQIDNYGAEELDELIKKYDVKSPTTKNDVTGSQKFNLMFSTSIGPTGQVQGFLRPETAQGIFVNFQRLLQFNQGRLPFGAAQIGSAFRNEISPRSGIIRVREFTMAEIEFFVDPKDKAHPKFAQYADLKLPLFSACDQMDGKSTREVALKDAVAQGIIANETLAYFMARIYLFLYMVGVKPDRCRFRQHMKNEMAHYACDCWDAECLTTYGWIECVGCADRSCYDLSQHHKATGVRLVAEKLLPEPVKIKMVQCVPNKGKIGKTFRAEAAQIFKAFEMFSSEENLKLKEELAKVKKYTLSVNGSNFEITPDMVTVKEEDVTMHVEEIVPSVIEPSFGIGRIMYSILEHNFHTRENDEQRTFLSLPPIIAPYKCSVLPLSSHQDFTPYVRELSEKLTRVGISHRVDESGGSIGRRYARTDQIAIPYGITIDFDTINQKPPSATLRERDTMKQIRVPLEDLPELVSDLSNGIVSWADALANYPNFEQQEA 724          
BLAST of Glycine--tRNA ligase vs. TrEMBL
Match: A0A0R3SB05 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1594 PE=4 SV=1)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 315/612 (51.47%), Postives = 433/612 (70.75%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++VY QS  IYGG+QG YDY P G  I  NI+  W  FFV  E +L ++C ++TPE VLKASGHVERF DY+V+D +TGE FRADHL+E  L         ++ +KK+I+  + +IDN+G  EL E+I+ +++KS    N+++  + FNLMF TSIGP+G ++G+LRPETAQGIFVNF++LL   QG+LPF  AQIG + RNEISPRSG++RVREF MAEIE F+DP DK+H +F   A L + +F++ +QM GKS   + L DAV   IIANETL YFM RIY+FL  VG+KP   RFRQHM NEMAHYACDCWDAECLT+YGWIECVGCADRS YDL +H + +GV+LVA++ L EP K+  V C PN   IGK+F   A  + +  E  S +++  L +++ +  K +++++  +FEI  D   + E + T+H EE VP+VIEPSFG+GRI Y ++E NF TRE+D  RT+ ++P  IA Y+ S+LP+SS+ DF P +  +S+    + I   +D +  S+G+RYARTD I IP+GITIDFD+IN KP S T+RERD+M+Q+R+ +++LP+L   L  G+VSW + +  YP FE Q++
Sbjct:  115 DRSKLEDLLKQKFVYDQSFSIYGGIQGLYDYGPIGCSIKANILSAWRQFFVLEEQLLEVDCSMLTPEPVLKASGHVERFTDYMVRDAITGECFRADHLVEGALEAKRALKGTSETEKKEIDKYLAQIDNYGAEELDELIKKYDVKSPTTKNDVTGSQKFNLMFSTSIGPTGQVQGFLRPETAQGIFVNFQRLLQFNQGRLPFGAAQIGSAFRNEISPRSGIIRVREFTMAEIEFFVDPKDKAHPKFAQYADLKLPLFSACDQMDGKSTREVALKDAVAQGIIANETLAYFMARIYLFLYMVGVKPDRCRFRQHMKNEMAHYACDCWDAECLTTYGWIECVGCADRSCYDLSQHHKATGVRLVAEKLLPEPVKIKMVQCVPNKGKIGKTFRAEAAQIFKAFEMFSSEENLKLKEELAKVKKYTLSVNGSNFEITPDMVTVKEEDVTMHVEEIVPSVIEPSFGIGRIMYSILEHNFHTRENDEQRTFLSLPPIIAPYKCSVLPLSSHQDFTPYVRELSEKLTRVGISHRVDESGGSIGRRYARTDQIAIPYGITIDFDTINQKPPSATLRERDTMKQIRVPLEDLPELVSDLSNGIVSWADALANYPNFEQQEA 726          
BLAST of Glycine--tRNA ligase vs. Ensembl Cavefish
Match: gars1 (glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9174])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 298/599 (49.75%), Postives = 413/599 (68.95%), Query Frame = 2
Query:   80 YVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            +VY   +   GV G YD+ P G  +  NI+  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L++D   +  KK +++ ++ ++DN+ + ELA++   +N+KS    N+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  VA L I +++S  Q SG+S +++ LGDAV+  II N  LGYF+GRIY++L+KVG+     RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   IGKS+ K A ++ +++ +  E      +  + E+ + ++  D   F++ +D   +   ++T+H EE VPNVIEPSFG+GRI Y + E  F  RE D  RT+F+ PA +A Y+ S+LP+S N +F P +  +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP++   L  G+ +W  V   YPIFEGQ++
Sbjct:   19 FVYLFDECVLGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMSDKKCSADKKSEMDGVITQMDNYTQQELADLFVQYNVKSPTTGNDLTPPILFNLMFQTSIGPGGNMTGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHSKFSNVADLEIMLYSSKAQTSGQSAQVMRLGDAVEQGIINNSVLGYFIGRIYLYLIKVGVSKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLCHARATRVPLVAEKPLKEPKVVNVVQFEPNKGAIGKSYKKEAKLVMEFLAACDECYITDQETLLTENGEFTIETDGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIFEHTFRIREGDEQRTFFSFPATVAPYKCSVLPLSQNQEFMPFVRELSESMTKYGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVQELPEIVRDLANGVTTWAEVESKYPIFEGQET 617          
BLAST of Glycine--tRNA ligase vs. Ensembl Cavefish
Match: gars1 (glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9174])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 298/599 (49.75%), Postives = 413/599 (68.95%), Query Frame = 2
Query:   80 YVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            +VY   +   GV G YD+ P G  +  NI+  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L++D   +  KK +++ ++ ++DN+ + ELA++   +N+KS    N+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  VA L I +++S  Q SG+S +++ LGDAV+  II N  LGYF+GRIY++L+KVG+     RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LVA++ LKEPK V  V  +PN   IGKS+ K A ++ +++ +  E      +  + E+ + ++  D   F++ +D   +   ++T+H EE VPNVIEPSFG+GRI Y + E  F  RE D  RT+F+ PA +A Y+ S+LP+S N +F P +  +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP++   L  G+ +W  V   YPIFEGQ++
Sbjct:   19 FVYLFDECVLGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMSDKKCSADKKSEMDGVITQMDNYTQQELADLFVQYNVKSPTTGNDLTPPILFNLMFQTSIGPGGNMTGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHSKFSNVADLEIMLYSSKAQTSGQSAQVMRLGDAVEQGIINNSVLGYFIGRIYLYLIKVGVSKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLCHARATRVPLVAEKPLKEPKVVNVVQFEPNKGAIGKSYKKEAKLVMEFLAACDECYITDQETLLTENGEFTIETDGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIFEHTFRIREGDEQRTFFSFPATVAPYKCSVLPLSQNQEFMPFVRELSESMTKYGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVQELPEIVRDLANGVTTWAEVESKYPIFEGQET 617          
BLAST of Glycine--tRNA ligase vs. Ensembl Cavefish
Match: gars1 (glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9174])

HSP 1 Score: 611.298 bits (1575), Expect = 0.000e+0
Identity = 288/591 (48.73%), Postives = 400/591 (67.68%), Query Frame = 2
Query:  104 YGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            + GV G YD+ P G  +  NI+  W   F++ E +L I+C ++TPE VLK SGHV++F DY+VKD+  GE FRADHL++++L  L++D   +  KK +++ ++ ++DN+ + ELA++   +N+KS    N+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP +K H +F  VA L I +++S  Q SG+S +++ LGDAV+  II N  LGYF+GRIY++L+KVG+     RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL  H   + V LV +               PN   IGKS+ K A ++ +++ +  E      +  + E+ + ++  D   F++ +D   +   ++T+H EE VPNVIEPSFG+GRI Y + E  F  RE D  RT+F+ PA +A Y+ S+LP+S N +F P +  +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP++   L  G+ +W  V   YPIFEGQ++
Sbjct:  119 HQGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADYMVKDVKNGECFRADHLLKAHLQKLMSDKKCSADKKSEMDGVITQMDNYTQQELADLFVQYNVKSPTTGNDLTPPILFNLMFQTSIGPGGNMTGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNEKIHSKFSNVADLEIMLYSSKAQTSGQSAQVMRLGDAVEQGIINNSVLGYFIGRIYLYLIKVGVSKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLLCHARATRVPLVFE---------------PNKGAIGKSYKKEAKLVMEFLAACDECYITDQETLLTENGEFTIETDGKTFKLTKDMVNIKRFQKTLHVEEVVPNVIEPSFGIGRIMYSIFEHTFRIREGDEQRTFFSFPATVAPYKCSVLPLSQNQEFMPFVRELSESMTKYGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVQELPEIVRDLANGVTTWAEVESKYPIFEGQET 694          
BLAST of Glycine--tRNA ligase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007309.1 (pep scaffold:Pmarinus_7.0:GL501124:37347:57869:-1 gene:ENSPMAG00000006586.1 transcript:ENSPMAT00000007309.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 289/619 (46.69%), Postives = 418/619 (67.53%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIV--QKIDNFGENELAEIIQ-NFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPK-KVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G +D+ P G  +  NII +W   F++ E +L I+C ++TPE VLKASGHV++F D++VKD+  GE FRADHL++++L  L++D   +++KK ++++++  Q +  +  +  A ++  ++ +KS V  N+LS P  FNLMF+TSIGP G   GYLRPETAQGIF+N+K+LL+  QGKLPFA AQIG S RNEISPRSGL+RVREF MAEIEHF+DP DK H +F+ +A L +++++   Q SG+S + + LGDAV+  II N  LGYF+GRIY FL+KVG+K +  RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS +DLQ H+  + V LVA++ LKEP  KV++V   + N  ++GK+F K A ++ +++E       ++++K + E    +  ++   F + +D   +   ++T+  EE VPNVIEPSFG+GRI Y ++E +F  RE D  RTYF+ P  +A Y+ S+LP+S N +F P ++ +S+      +   +D ++ S+G+RYARTD IGI                + T+RERDSM+Q+R  VDELP L   L  G+++W  V   +P+FEGQ++
Sbjct:   69 IIDRAKMEDTLKRRFFYDQAFAIYGGVSGLFDFGPVGCALKNNIIQQWRQHFIQEEQILEIDCTMLTPEPVLKASGHVDKFADFMVKDLKNGECFRADHLLKAHLEKLMSDKKCSEEKKAEMKNVITQQGLTEYARSNAAPLLCIDYAVKSPVTGNDLSPPLAFNLMFQTSIGPGGQTPGYLRPETAQGIFLNYKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPTDKQHPKFENMADLELSLYSGQAQTSGRSPQRMRLGDAVQQGIINNTVLGYFIGRIYQFLVKVGVKDEHLRFRQHMDNEMAHYACDCWDAETKTSYGWIEVVGCADRSCFDLQCHSRATKVPLVAEKPLKEPTHKVVEVVQLEANKGIVGKAFKKDARLVNKFLEDCDSFYIESVEKQLAEKGAFNFEVEGKSFTLSKDMVTVKRFQKTLFVEEVVPNVIEPSFGIGRIMYTILEHSFRVREGDEQRTYFSFPPTVAPYKCSVLPLSQNPEFAPFVKMLSEALTRNGVSHKVDDSSGSIGRRYARTDEIGISH--------------TATLRERDSMRQIRAEVDELPGLVRDLSNGVLAWAEVEARHPLFEGQET 673          
BLAST of Glycine--tRNA ligase vs. Ensembl Yeast
Match: GRS1 (Cytoplasmic and mitochondrial glycyl-tRNA synthase; ligates glycine to the cognate anticodon-bearing tRNA; transcription termination factor that may interact with the 3'-end of pre-mRNA to promote 3'-end formation; GRS1 has a paralog, GRS2, that arose from the whole genome duplication; human homolog GARS implicated in Charcot-Marie-Tooth disease, can complement yeast null mutant [Source:SGD;Acc:S000000325])

HSP 1 Score: 518.464 bits (1334), Expect = 1.251e-177
Identity = 274/646 (42.41%), Postives = 388/646 (60.06%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVYQSA-DIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPA---------------------------------ITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNE-LSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEIL-NLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDH--FELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQ 1867
            ++E+  ++ + ++ Y  A D+YGGV G YDY P G     NII  W   F+  EDML ++C ++TP +VLK SGHV++F+D++ +D+ TGE FRADHL+E  L   +                                     + D   K+ E+I+ KID +   EL E+++ ++I +    E L  P+ FNLMFET+IGPSG LKGYLRPETAQG F+NF KLL+    K PFA A IG S RNEISPR+GLLRVREF MAEIEHF+DP+DKSH +F  +  + ++      Q +G +  I+  +G+AV ++++ NETLGYF+ RIY FLMK+G+     RFRQHM NEMAHYA DCWD E  TSYGWIECVGCADRSAYDL  H++ +  KLV ++ L  P +V K       KL G  F K A  ++ ++ ++S+ D  +  + +K + K ++ +D +D E+  D    ++ +R +  H  E+VP+VIEPSFG+GRI Y + E +F  R  D  R+  + P  +A  +  ++P+S++ D  P+   ++ I     I   ID +  S+GKRYAR D +G PFG+TIDF+S   K  SVT+RERDS +QVR  V+ + K    +     SW+   +    F  Q
Sbjct:   16 NREQLESVLRGRFFYAPAFDLYGGVSGLYDYGPPGCAFQNNIIDAWRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDLKTGEIFRADHLVEEVLEARLKGDQEARGLVEDANAAAKDDAEKKKRKKKVKQIKAVKLDDDVVKEYEEILAKIDGYSGPELGELMEKYDIGNPVTGETLESPRAFNLMFETAIGPSGQLKGYLRPETAQGQFLNFNKLLEFNNSKTPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVDPLDKSHPKFNEIKDIKLSFLPRDVQEAGSTEPIVKTVGEAVASRMVDNETLGYFIARIYQFLMKIGVDESKLRFRQHMANEMAHYAADCWDGELKTSYGWIECVGCADRSAYDLTVHSKKTKEKLVVRQKLDNPIEVTKWEIDLTKKLFGPKFRKDAPKVESHLLNMSQDDLASKAELLKANGKFTIKVDGVDGEVELDDKLVKIEQRTKVEHVREYVPSVIEPSFGIGRIIYSVFEHSFWNRPEDNARSVLSFPPLVAPTKVLLVPLSNHKDLVPVTTEVAKILRKSQIPFKIDDSGVSIGKRYARNDELGTPFGVTIDFES--AKDHSVTLRERDSTKQVRGSVENVIKAIRDITYNGASWEEGTKDLTPFIAQ 659          
BLAST of Glycine--tRNA ligase vs. Ensembl Yeast
Match: GRS2 (Glycine-tRNA synthetase, not expressed under normal growth conditions; expression is induced under heat, oxidative, pH, or ethanol stress conditions; more stable than the major glycine-tRNA synthetase Grs1p at 37 deg C; GRS2 has a paralog, GRS1, that arose from the whole genome duplication [Source:SGD;Acc:S000006285])

HSP 1 Score: 498.049 bits (1281), Expect = 2.319e-170
Identity = 265/590 (44.92%), Postives = 373/590 (63.22%), Query Frame = 2
Query:   23 MSNVKIADKEKFRNIFQTQYVYQ-SADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNE-LSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEI---LNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVE---REETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVR 1768
            MSN   ++++K  +  + ++ Y  S +IYGGV G +D  P G ++  N+I  W   F+  E+ML ++ P++TP  VLK SGHV++F D++ ++  TGE +RADHLIE  L   + D  +  Q  K++E I+  ID F   EL  ++Q +NI     N+ L     FNLMFET IG SG LK +LRPETAQG F+NF KLL+  QGK+PFA A IG S RNEISPRSGLLRVREF MAEIEHF+DP++KSH +F  V +  I + +   Q SG+ V++   + +G+AV + ++ NETLGYFM R++ FL+ +GI    FRFRQH+ NEMAHYA DCWD E LTSYGWIECVGCADR+A+DL  H++ +G  L  ++ L  PK+  +   + N K  G  F + A +++  +   S+ +   L +  +E  K       ++ +IV+    LV    +    H  E++PNVIEPSFGLGRI YC+ +  F  R    +R +F+ P  IA  +  +  IS+ND F  +++ IS      +I   ID +  S+GK+YAR D +G PFGITIDF++  IK  +VT+RER+SM+QVR
Sbjct:    4 MSN---SERDKLESTLRRRFFYTPSFEIYGGVSGLFDLGPPGCQLQNNLIRLWREHFIMEENMLQVDGPMLTPYDVLKTSGHVDKFTDWMCRNPKTGEYYRADHLIEQTLKKRLLDKDVNPQDMKNMEKILTTIDGFSGPELNLVMQEYNINDPVTNDVLDALTSFNLMFETKIGASGQLKAFLRPETAQGQFLNFNKLLEINQGKIPFASASIGKSFRNEISPRSGLLRVREFLMAEIEHFVDPLNKSHAKFNEVLNEEIPLLSRRLQESGE-VQLPVKMTIGEAVNSGMVENETLGYFMARVHQFLLNIGINKDKFRFRQHLKNEMAHYATDCWDGEILTSYGWIECVGCADRAAFDLTVHSKKTGRSLTVKQKLDTPKERTEWVVEVNKKFFGSKFKQKAKLIESVLSKFSQDE---LIRRHEELEKNGEFTCQVNGQIVKLDSSLVTIKMKTTLQHIREYIPNVIEPSFGLGRIIYCIFDHCFQVRVDSESRGFFSFPLQIAPIKVFVTTISNNDGFPAILKRISQALRKREIYFKIDDSNTSIGKKYARNDELGTPFGITIDFET--IKDQTVTLRERNSMRQVR 584          
BLAST of Glycine--tRNA ligase vs. Ensembl Nematostella
Match: EDO45824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU7])

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 297/613 (48.45%), Postives = 419/613 (68.35%), Query Frame = 2
Query:   44 DKEKFRNIFQTQYVYQSA-DIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGL-NELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVER-EETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            D+ K  ++ + ++ +  A +IYGGV G YDY P G  +  N+I+ W   F+  E ML I   ++TP  VLKASGHV+RF D +VKD+ TG+ +RADHL+E +L  L+ D  + + K+ + + ++ KIDN+   EL E+I+ ++ K+    N+LS P  FNLMF TSIGPSG + G+LRPETAQGIFVNFK+LL+   G+LPFA AQIG + RNEISPRSGLLRVREF +AEIEHF+DP DKSH RF  V  L + +F S  QM G+    + LGDA++ K+I++ T+ YF+GRIY+FL+K G+ P   RFRQHM NEMAHYACDCWDAE  TSYGWIECVGCADR+ YDL +HT  +G KLVAQ DL EP KV  V   P+  ++GK+F K A  + + + +L  K +K L+  + E  + ++T+D+    I +   + ++R ++ +H  +  P+VIEPSFG+GRI Y ++E NF  RE D  RT+ ++P  IA  + S+LP+S N +F P ++ +S    ++DI   +D ++ S+G+RYARTD I IPFGIT+DFD++N +P + T+RER++ +Q+R  V  LP+L   LV G ++W  V   + +FEGQ +
Sbjct:   66 DRGKLEDLLKRRFFFVPAFEIYGGVAGLYDYGPAGCAMESNVINLWKKHFILEEHMLEIRAALLTPHPVLKASGHVDRFADVMVKDVKTGDCYRADHLLEGHLEKLMADKKLPEDKRNEYQSVLNKIDNYNMQELGELIKKYDAKATTTGNDLSDPVEFNLMFTTSIGPSGIIPGFLRPETAQGIFVNFKRLLEANNGRLPFASAQIGPAFRNEISPRSGLLRVREFMLAEIEHFVDPTDKSHPRFPEVESLKVTLFPSDYQMDGRPAMQITLGDAIQQKMISSTTVAYFLGRIYLFLIKCGVDPSKLRFRQHMSNEMAHYACDCWDAELCTSYGWIECVGCADRACYDLCQHTNATGEKLVAQVDLPEPVKVDVVEVVPDKAILGKAFKKQAKEVMEKLTTLDSKGAKQLEDALNEKGEFAMTVDDQQLLIQKAMVKEIKRYQKDVHVRDVEPHVIEPSFGIGRIIYSVLEHNFKIREGDEQRTWLSLPPVIAPVKCSVLPLSKNKEFSPFVKELSSALTEMDISHKVDDSSGSIGRRYARTDEIAIPFGITVDFDTVNKEPHTATLRERNTTRQIRAEVSLLPQLVRDLVHGKITWSEVETKFGLFEGQTT 678          
BLAST of Glycine--tRNA ligase vs. Ensembl Nematostella
Match: EDO27980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7R9])

HSP 1 Score: 78.1814 bits (191), Expect = 1.740e-15
Identity = 56/190 (29.47%), Postives = 87/190 (45.79%), Query Frame = 2
Query:  203 DMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYL--------------NTLINDP--------------AITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIK--SVGLNELSRPKPFNLMFETSIGPSGN--LKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRN 676
            +++ I+  I       KASGHV+ F+D L+ +  + + +RAD LIE Y                T   D                   QK + ++ + + ++N    ++  +I+   I     G    +  + FNLMF T IG S +  +  YLRPETAQGIFVNF  +    + K+PF +AQ G+   N
Sbjct:    2 NIVGIDASIFMHPTTWKASGHVDAFSDPLIDNKDSKKRYRADVLIEEYAEKINIKAQKEITKAKTRFGDAFNEEEFVTTNERVKGYLQQKNEILQRLARSLENDDLADVKSLIEELGIACPESGSKNWTEVRQFNLMFATKIGASADTAMDLYLRPETAQGIFVNFLNVQKTGRMKIPFGIAQTGLGEEN 191          

HSP 2 Score: 72.0182 bits (175), Expect = 2.114e-13
Identity = 44/135 (32.59%), Postives = 73/135 (54.07%), Query Frame = 2
Query: 1388 FVPNVIEPSFGLGRIFYCLMEQNFA--TRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDEL 1786
            +VP V+E S GL R+F  +  +     T E    RT   +P+ +A  + ++LP+   D    + + I +       + + +  A  +G+RY R D++G PF IT+D  ++  K  +VTIR RDSM+Q R+ + EL
Sbjct:  254 YVPYVVETSVGLDRMFLAVFSKALEEETLEDGSTRTVLRLPSVLAPTKAAVLPLVKKDGLPEVAKEIIEDLKWDFNVAYDEKDA--VGRRYRRQDALGTPFCITVDHQTLEDK--TVTIRHRDSMEQQRVAISEL 384          
BLAST of Glycine--tRNA ligase vs. Ensembl Medaka
Match: gars1 (glycyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101167251])

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 299/616 (48.54%), Postives = 417/616 (67.69%), Query Frame = 2
Query:   38 IADKEKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKS-VGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQR-DLKEPKKVLKVF-CKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            I D+ K  +  + ++ Y Q+  IYGGV G YD+ P G  +  NI+  W   F++ E +L I+C ++TPE VLK SGHVE+F DY+VKD+  GE FRADHL++++L  L++D   +  KK ++E ++ ++DN+ + ELA++   +N+KS    N+L+ P  FNLMF+TSIGP GN+ GYLRPETAQGIF+NFK+LL+  QGKLPFA AQIG S RNEISPR+GL+RVREF MAEIEHF+DP +K H +F  VA L I +++S  Q SG+S +++ LGDAV+  +I N  LGYF+GRIY++L KVG+     RFRQHM NEMAHYACDCWDAE  TSYGWIE VGCADRS YDL+ H   + V LVA+   L    K + V   +PN   IGK + K A ++ +Y+    E      ++ + E  + ++  +   F++ +D   +  +++T+H EE VPNVIEPSFG+GRI Y + E  F  RE D  RTYF+ PA +A Y+ S+LP+S N +F P +  +S+      +   +D ++ S+G+RYARTD IG+ FGITIDFD++N  P + T+R+RDSM+Q+R  V ELP +   L  G ++W  V   +PIFEGQ++
Sbjct:  128 IVDRSKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNILQAWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVEKFADYMVKDVKNGECFRADHLLKAFLQKLMSDKKCSADKKAEMESVIVQLDNYSQQELADLFVKYNVKSPTTGNDLTAPISFNLMFQTSIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRAGLIRVREFTMAEIEHFVDPSEKVHPKFSNVADLEITLYSSKAQTSGQSAQMMRLGDAVEQGVINNSVLGYFIGRIYLYLTKVGVAKDKLRFRQHMDNEMAHYACDCWDAETKTSYGWIEIVGCADRSCYDLKCHARATKVPLVAENCSLTLLHKTVNVVQFEPNKGAIGKMYKKDAKLVMEYLAVCDECFITEQEQLLNETGEFNIETEGKTFKLTKDMVSVRRQQKTLHVEEVVPNVIEPSFGIGRIMYTIFEHTFHIREGDEQRTYFSFPATVAPYKCSVLPLSPNPEFMPFVRELSEAMTKNGVSHKVDDSSGSIGRRYARTDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPVIVRDLASGTMTWAEVESKFPIFEGQET 743          
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Match: SMESG000055316.1 (SMESG000055316.1)

HSP 1 Score: 1241.48 bits (3211), Expect = 0.000e+0
Identity = 614/617 (99.51%), Postives = 617/617 (100.00%), Query Frame = 2
Query:   23 MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMK+IGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLA+QLV+GLVSWQNVIRTYPIFEGQQS
Sbjct:    1 MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKIIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLALQLVRGLVSWQNVIRTYPIFEGQQS 617          
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Match: SMESG000054373.1 (SMESG000054373.1)

HSP 1 Score: 1241.48 bits (3211), Expect = 0.000e+0
Identity = 615/617 (99.68%), Postives = 617/617 (100.00%), Query Frame = 2
Query:   23 MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELS+PKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMK+IGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS
Sbjct:    1 MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSKPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKIIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 617          
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Match: SMESG000055316.1 (SMESG000055316.1)

HSP 1 Score: 1238.4 bits (3203), Expect = 0.000e+0
Identity = 612/620 (98.71%), Postives = 618/620 (99.68%), Query Frame = 2
Query:   14 ILKMSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETXXXXXXXXXXXXXXXTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLVSWQNVIRTYPIFEGQQS 1873
            ++K + VKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMK+IGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLA+QLV+GLVSWQNVIRTYPIFEGQQS
Sbjct:    3 LIKEAQVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKIIGKSFNKTANILKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREETIHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASYQFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSIGIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLALQLVRGLVSWQNVIRTYPIFEGQQS 622          
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Match: SMESG000038225.1 (SMESG000038225.1)

HSP 1 Score: 311.612 bits (797), Expect = 1.498e-99
Identity = 155/368 (42.12%), Postives = 236/368 (64.13%), Query Frame = 2
Query:   50 EKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKD-IEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEP 1147
            ++  N+ + Q+ Y  S+ I+GG++G YDY P G  +  NII  W   F+   +M+ I+C I+TP++VL++SGH   F+DYL+ D  +G  +R DH+I+++LN L     I D+ ++D IE+I+  +      ++  II+ ++IK     +LS+P  FNL+F+T+   S N   YLRPETAQGIF NF  L      KLPF V Q+G   RNEI P+  L+R RE ++AEIE+F +P    H +F  +A L +N++++ +Q +  +   +++  AV  KI   E   YF+GRIY FL++VGI  +  RFRQH+P E AHY+ +CWDAECLTS GW+E VGCA+R  YDL KH++++G  L  ++++ +P
Sbjct:   71 KQMMNLVKEQFFYINSSLIHGGLKGIYDYGPCGCNMKNNIIDLWRHIFINSNNMVEIDCSILTPKRVLESSGHTSYFHDYLITDSKSGNIYRCDHVIKNHLNKL--KVEIEDENERDKIENILNILSEMDIKDMENIIKMYDIKGPDSGDLSKPAKFNLLFQTT-NNSENDYLYLRPETAQGIFTNFSLLSRFFHQKLPFGVGQVGTVFRNEIRPQYNLIRTREIQLAEIEYFYNPNLTGHEQFFEIADLVVNIWSANDQNNNLNASKMSIEKAVNQKIFT-ENYAYFIGRIYQFLIEVGINSEKLRFRQHLPKEFAHYSNNCWDAECLTSVGWVELVGCANRGNYDLMKHSKNTGKALDIKQNIDKP 434          
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Match: SMESG000038225.1 (SMESG000038225.1)

HSP 1 Score: 311.227 bits (796), Expect = 1.922e-99
Identity = 155/368 (42.12%), Postives = 236/368 (64.13%), Query Frame = 2
Query:   50 EKFRNIFQTQYVY-QSADIYGGVQGFYDYAPDGDRIMKNIIHEWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFRADHLIESYLNTLINDPAITDQKKKD-IEDIVQKIDNFGENELAEIIQNFNIKSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDKKQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRRFKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIYMFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADRSAYDLQKHTEHSGVKLVAQRDLKEP 1147
            ++  N+ + Q+ Y  S+ I+GG++G YDY P G  +  NII  W   F+   +M+ I+C I+TP++VL++SGH   F+DYL+ D  +G  +R DH+I+++LN L     I D+ ++D IE+I+  +      ++  II+ ++IK     +LS+P  FNL+F+T+   S N   YLRPETAQGIF NF  L      KLPF V Q+G   RNEI P+  L+R RE ++AEIE+F +P    H +F  +A L +N++++ +Q +  +   +++  AV  KI   E   YF+GRIY FL++VGI  +  RFRQH+P E AHY+ +CWDAECLTS GW+E VGCA+R  YDL KH++++G  L  ++++ +P
Sbjct:   69 KQMMNLVKEQFFYINSSLIHGGLKGIYDYGPCGCNMKNNIIDLWRHIFINSNNMVEIDCSILTPKRVLESSGHTSYFHDYLITDSKSGNIYRCDHVIKNHLNKL--KVEIEDENERDKIENILNILSEMDIKDMENIIKMYDIKGPDSGDLSKPAKFNLLFQTT-NNSENDYLYLRPETAQGIFTNFSLLSRFFHQKLPFGVGQVGTVFRNEIRPQYNLIRTREIQLAEIEYFYNPNLTGHEQFFEIADLVVNIWSANDQNNNLNASKMSIEKAVNQKIFT-ENYAYFIGRIYQFLIEVGINSEKLRFRQHLPKEFAHYSNNCWDAECLTSVGWVELVGCANRGNYDLMKHSKNTGKALDIKQNIDKP 432          
The following BLAST results are available for this feature:
BLAST of Glycine--tRNA ligase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GARS10.000e+048.86glycyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gars-10.000e+046.90Glycine--tRNA ligase [Source:UniProtKB/Swiss-Prot... [more]
gars-10.000e+046.90Glycine--tRNA ligase [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GlyRS0.000e+048.94gene:FBgn0027088 transcript:FBtr0333934[more]
GlyRS0.000e+048.94gene:FBgn0027088 transcript:FBtr0075633[more]
GlyRS0.000e+048.94gene:FBgn0027088 transcript:FBtr0075632[more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gars10.000e+049.67glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem370.000e+049.51transmembrane protein 37 [Source:Xenbase;Acc:XB-GE... [more]
tmem370.000e+048.55transmembrane protein 37 [Source:Xenbase;Acc:XB-GE... [more]
tmem370.000e+048.55transmembrane protein 37 [Source:Xenbase;Acc:XB-GE... [more]
tmem370.000e+048.55transmembrane protein 37 [Source:Xenbase;Acc:XB-GE... [more]
tmem370.000e+048.55transmembrane protein 37 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gars0.000e+049.19glycyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Glycine--tRNA ligase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CZD3|GARS_MOUSE0.000e+049.19Glycine--tRNA ligase OS=Mus musculus OX=10090 GN=G... [more]
sp|Q5I0G4|GARS_RAT0.000e+049.19Glycine--tRNA ligase OS=Rattus norvegicus OX=10116... [more]
sp|Q5RBL1|GARS_PONAB0.000e+049.19Glycine--tRNA ligase OS=Pongo abelii OX=9601 GN=GA... [more]
sp|P41250|GARS_HUMAN0.000e+048.86Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GA... [more]
sp|Q04451|SYG_BOMMO0.000e+047.71Glycine--tRNA ligase OS=Bombyx mori OX=7091 PE=1 S... [more]
back to top
BLAST of Glycine--tRNA ligase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A154PEH10.000e+052.89Glycine--tRNA ligase OS=Dufourea novaeangliae OX=1... [more]
A0A151IZ280.000e+052.25Glycyl-tRNA synthetase OS=Trachymyrmex cornetzi OX... [more]
A0A195ATP80.000e+052.09Glycyl-tRNA synthetase OS=Atta colombica OX=520822... [more]
A0A564YXG50.000e+051.47Uncharacterized protein (Fragment) OS=Hymenolepis ... [more]
A0A0R3SB050.000e+051.47Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gars10.000e+049.75glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
gars10.000e+049.75glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
gars10.000e+048.73glycyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007309.10.000e+046.69pep scaffold:Pmarinus_7.0:GL501124:37347:57869:-1 ... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GRS11.251e-17742.41Cytoplasmic and mitochondrial glycyl-tRNA synthase... [more]
GRS22.319e-17044.92Glycine-tRNA synthetase, not expressed under norma... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO458240.000e+048.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279801.740e-1529.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gars10.000e+048.54glycyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glycine--tRNA ligase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055316.10.000e+099.51SMESG000055316.1[more]
SMESG000054373.10.000e+099.68SMESG000054373.1[more]
SMESG000055316.10.000e+098.71SMESG000055316.1[more]
SMESG000038225.11.498e-9942.12SMESG000038225.1[more]
SMESG000038225.11.922e-9942.12SMESG000038225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013638 ID=SMED30013638|Name=Glycine--tRNA ligase|organism=Schmidtea mediterranea sexual|type=transcript|length=1918bp
AAAGTAAAGATAAATTTTAAAAATGTCAAATGTTAAAATAGCTGATAAAG
AAAAGTTTAGAAATATTTTTCAAACTCAATATGTTTATCAATCCGCTGAC
ATTTATGGTGGAGTTCAAGGATTTTATGATTATGCACCCGATGGGGATAG
AATTATGAAAAACATAATCCATGAATGGGATTTATTTTTTGTTCGTAGAG
AAGATATGCTTACTATAGAATGTCCGATTATTACTCCTGAAAAGGTTTTA
AAAGCTTCGGGTCACGTTGAACGTTTTAATGATTACTTAGTAAAAGATAT
TGTAACTGGAGAATCTTTCAGAGCTGACCATTTAATCGAAAGTTATTTAA
ATACATTAATTAATGATCCAGCAATTACTGATCAGAAAAAGAAAGACATT
GAAGATATAGTGCAAAAAATAGATAATTTTGGAGAAAATGAATTGGCTGA
GATCATACAAAACTTCAACATTAAATCAGTCGGACTAAATGAACTGAGTA
GACCAAAACCATTCAATTTAATGTTTGAAACGTCAATTGGTCCATCTGGC
AATTTGAAAGGATATTTGAGACCTGAAACTGCCCAAGGGATTTTCGTTAA
CTTTAAAAAACTATTGGATAAAAAACAAGGAAAATTACCCTTTGCAGTCG
CACAAATAGGAATTTCTTGTAGAAACGAAATTTCACCAAGATCTGGTTTA
CTTCGTGTTCGGGAATTTAAAATGGCTGAAATCGAACATTTTCTTGACCC
AATTGATAAATCACATAGACGATTCAAGACAGTAGCTCATTTAAACATTA
ATATGTTCACTAGTCCCAACCAAATGTCAGGCAAATCGGTAGAAATATTA
AATCTTGGAGATGCCGTAAAGAATAAAATTATAGCTAACGAAACTCTTGG
ATATTTTATGGGTCGAATTTATATGTTTTTGATGAAAGTAGGAATTAAAC
CACAATCTTTTCGATTTCGTCAACATATGCCAAATGAAATGGCACATTAT
GCCTGTGATTGTTGGGATGCTGAATGTTTAACATCCTATGGGTGGATTGA
ATGTGTTGGATGTGCAGACAGGAGTGCGTACGATTTACAAAAACATACTG
AGCACAGTGGGGTTAAGTTGGTTGCTCAACGCGATTTAAAAGAACCTAAA
AAAGTCCTAAAAGTCTTCTGTAAGCCTAACATGAAACTTATCGGAAAATC
TTTCAATAAAACTGCCAACATCTTAAAGCAATACATTGAATCATTATCGG
AAAAAGATTCCAAAGCTTTGGACAAAGACATAAAGGAACACAATAAGAAA
TCAGTAACTTTAGATAATATCGATTTTGAAATTGTACAAGATCACTTTGA
ACTAGTCGAAAGAGAGGAAACGATTCACGCTGAAGAATTTGTTCCGAATG
TTATTGAACCATCTTTCGGTCTTGGGAGAATTTTCTATTGCTTAATGGAA
CAGAATTTCGCTACCAGAGAATCTGACGTTAATCGCACGTATTTTACTAT
TCCTGCATGGATTGCATCGTACCAATTTTCTATTTTACCTATCTCATCAA
ATGATGATTTTAAGCCATTGATTGAAACTATTTCTGATATTTTTGATGAT
CTCGACATTTTAAAATTCATTGATACAACAGCAGCGTCTCTGGGAAAGCG
ATACGCAAGAACCGATTCAATTGGAATTCCTTTTGGAATCACAATTGATT
TTGATTCGATTAACATTAAACCGGCATCGGTGACAATCAGAGAACGAGAT
TCGATGCAACAAGTTCGTATCAGAGTTGATGAATTGCCGAAACTTGCAGT
TCAATTGGTGAAGGGGCTCGTTAGCTGGCAAAATGTTATTCGTACCTATC
CAATTTTCGAAGGTCAACAATCTTAACAAAATTTTATTATTGTTTTGGAA
ATAAAATTTTTTGCGTGA
back to top

protein sequence of SMED30013638-orf-1

>SMED30013638-orf-1 ID=SMED30013638-orf-1|Name=SMED30013638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=618bp
MSNVKIADKEKFRNIFQTQYVYQSADIYGGVQGFYDYAPDGDRIMKNIIH
EWDLFFVRREDMLTIECPIITPEKVLKASGHVERFNDYLVKDIVTGESFR
ADHLIESYLNTLINDPAITDQKKKDIEDIVQKIDNFGENELAEIIQNFNI
KSVGLNELSRPKPFNLMFETSIGPSGNLKGYLRPETAQGIFVNFKKLLDK
KQGKLPFAVAQIGISCRNEISPRSGLLRVREFKMAEIEHFLDPIDKSHRR
FKTVAHLNINMFTSPNQMSGKSVEILNLGDAVKNKIIANETLGYFMGRIY
MFLMKVGIKPQSFRFRQHMPNEMAHYACDCWDAECLTSYGWIECVGCADR
SAYDLQKHTEHSGVKLVAQRDLKEPKKVLKVFCKPNMKLIGKSFNKTANI
LKQYIESLSEKDSKALDKDIKEHNKKSVTLDNIDFEIVQDHFELVEREET
IHAEEFVPNVIEPSFGLGRIFYCLMEQNFATRESDVNRTYFTIPAWIASY
QFSILPISSNDDFKPLIETISDIFDDLDILKFIDTTAASLGKRYARTDSI
GIPFGITIDFDSINIKPASVTIRERDSMQQVRIRVDELPKLAVQLVKGLV
SWQNVIRTYPIFEGQQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036621Anticodon-bd_dom_sf
IPR027031Gly-tRNA_synthase/POLG2
IPR033731GlyRS-like_core
IPR002315tRNA-synt_gly
IPR004154Anticodon-bd
IPR002314aa-tRNA-synt_IIb
IPR006195aa-tRNA-synth_II
Vocabulary: biological process
TermDefinition
GO:0006426glycyl-tRNA aminoacylation
GO:0006418tRNA aminoacylation for protein translation
GO:0006412translation
GO:0015966diadenosine tetraphosphate biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004820glycine-tRNA ligase activity
GO:0004812aminoacyl-tRNA ligase activity
GO:0016787hydrolase activity
GO:0016874ligase activity
GO:0046983protein dimerization activity
GO:0004081bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0030141secretory granule
GO:0030424axon
GO:0042995cell projection
GO:0070062extracellular exosome
GO:0005739mitochondrion
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002315Glycyl-tRNA synthetasePRINTSPR01043TRNASYNTHGLYcoord: 540..559
score: 59.72
coord: 213..230
score: 64.81
coord: 181..198
score: 79.94
coord: 458..470
score: 73.5
coord: 230..240
score: 68.69
coord: 162..174
score: 64.96
coord: 27..41
score: 61.48
IPR002315Glycyl-tRNA synthetaseTIGRFAMTIGR00389TIGR00389coord: 17..591
e-value: 9.0E-198
score: 656.3
IPR002314Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)PFAMPF00587tRNA-synt_2bcoord: 181..255
e-value: 6.0E-8
score: 32.9
NoneNo IPR availableGENE3DG3DSA:1.20.1430.20coord: 85..167
e-value: 9.8E-193
score: 643.2
NoneNo IPR availableGENE3DG3DSA:3.30.930.10coord: 20..485
e-value: 9.8E-193
score: 643.2
NoneNo IPR availableGENE3DG3DSA:1.10.30.30coord: 372..452
e-value: 9.8E-193
score: 643.2
NoneNo IPR availablePANTHERPTHR10745:SF0GLYCINE--TRNA LIGASEcoord: 7..616
NoneNo IPR availableSUPERFAMILYSSF55681Class II aaRS and biotin synthetasescoord: 11..504
NoneNo IPR availableSUPERFAMILYSSF52954Class II aaRS ABD-relatedcoord: 488..612
IPR004154Anticodon-bindingPFAMPF03129HGTP_anticodoncoord: 501..591
e-value: 1.4E-14
score: 54.0
IPR036621Anticodon-binding domain superfamilyGENE3DG3DSA:3.40.50.800coord: 500..616
e-value: 8.0E-33
score: 114.7
IPR027031Glycyl-tRNA synthetase/DNA polymerase subunit gamma-2PANTHERPTHR10745GLYCYL-TRNA SYNTHETASE/DNA POLYMERASE SUBUNIT GAMMA-2coord: 7..616
IPR006195Aminoacyl-tRNA synthetase, class IIPROSITEPS50862AA_TRNA_LIGASE_IIcoord: 2..506
score: 9.763
IPR033731Glycyl-tRNA synthetase-like core domainCDDcd00774GlyRS-like_corecoord: 20..356
e-value: 1.48361E-100
score: 304.513