UPF0546 membrane protein AGAP012180

Overview
NameUPF0546 membrane protein AGAP012180
Smed IDSMED30013637
Length (bp)501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UPF0546 membrane protein AGAP012180 (SMED30013637) t-SNE clustered cells

Violin plots show distribution of expression levels for UPF0546 membrane protein AGAP012180 (SMED30013637) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013637

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013637SMESG000012908.1 Contig3122newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013637SMESG000012908.1 Contig3122uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013637SMESG000064518.1 Contig3122newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013637SMESG000064518.1 Contig3122uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Match: TMEM234 (transmembrane protein 234 [Source:HGNC Symbol;Acc:HGNC:28837])

HSP 1 Score: 47.3654 bits (111), Expect = 1.016e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Match: TMEM234 (transmembrane protein 234 [Source:HGNC Symbol;Acc:HGNC:28837])

HSP 1 Score: 47.3654 bits (111), Expect = 1.441e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Match: TMEM234 (transmembrane protein 234 [Source:HGNC Symbol;Acc:HGNC:28837])

HSP 1 Score: 47.3654 bits (111), Expect = 1.441e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Match: TMEM234 (transmembrane protein 234 [Source:HGNC Symbol;Acc:HGNC:28837])

HSP 1 Score: 47.3654 bits (111), Expect = 1.441e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Match: TMEM234 (transmembrane protein 234 [Source:HGNC Symbol;Acc:HGNC:28837])

HSP 1 Score: 47.3654 bits (111), Expect = 1.441e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Fly
Match: CG12929 (gene:FBgn0033429 transcript:FBtr0088541)

HSP 1 Score: 57.3806 bits (137), Expect = 7.827e-11
Identity = 39/114 (34.21%), Postives = 58/114 (50.88%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKL-----------------FQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICC 405
            VG++WG+TN  ++L                 F  +   I    ++ + F LNQ  S  ++ TL+ + I+VAVP+ NSL+F  +AI GYAL  EKL      G   +L  L +CC
Sbjct:   11 VGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEARTIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITGYAL-GEKLP-----GRKVILGTLLVCC 118          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Fly
Match: CG12929 (gene:FBgn0033429 transcript:FBtr0113060)

HSP 1 Score: 55.8398 bits (133), Expect = 2.006e-10
Identity = 34/95 (35.79%), Postives = 51/95 (53.68%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKL-----------------FQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKL 348
            VG++WG+TN  ++L                 F  +   I    ++ + F LNQ  S  ++ TL+ + I+VAVP+ NSL+F  +AI GYAL  EKL
Sbjct:   11 VGLLWGVTNPFIRLGSQGIESVGDTGSKWRNFVQEARTIGSRWRYWIPFGLNQCGSALYVWTLQRASITVAVPVANSLSFAFTAITGYAL-GEKL 104          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Zebrafish
Match: tmem234 (transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GENE-090313-326])

HSP 1 Score: 53.5286 bits (127), Expect = 2.941e-9
Identity = 36/112 (32.14%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKLFQTDDSPIYK----------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V I+WG TN  +K        + K                N K+L+ FLLNQS S+ F  TL  + +S+AVP+ NSLTF+ + + G  L  E     + +G+  ++ G+ +C
Sbjct:   13 VAILWGGTNPFLKKGTEGIEEVQKKNKLLQFLAELKFLFLNFKYLVPFLLNQSGSLVFYFTLASTDLSLAVPVVNSLTFLFTLLMGKVLGEEFGGKGAIMGMLLIMCGVTVC 124          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Zebrafish
Match: tmem234 (transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GENE-090313-326])

HSP 1 Score: 53.5286 bits (127), Expect = 3.617e-9
Identity = 36/112 (32.14%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKLFQTDDSPIYK----------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V I+WG TN  +K        + K                N K+L+ FLLNQS S+ F  TL  + +S+AVP+ NSLTF+ + + G  L  E     + +G+  ++ G+ +C
Sbjct:   13 VAILWGGTNPFLKKGTEGIEEVQKKNKLLQFLAELKFLFLNFKYLVPFLLNQSGSLVFYFTLASTDLSLAVPVVNSLTFLFTLLMGKVLGEEFGGKGAIMGMLLIMCGVTVC 124          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Zebrafish
Match: tmem234 (transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GENE-090313-326])

HSP 1 Score: 53.5286 bits (127), Expect = 3.617e-9
Identity = 36/112 (32.14%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKLFQTDDSPIYK----------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V I+WG TN  +K        + K                N K+L+ FLLNQS S+ F  TL  + +S+AVP+ NSLTF+ + + G  L  E     + +G+  ++ G+ +C
Sbjct:   13 VAILWGGTNPFLKKGTEGIEEVQKKNKLLQFLAELKFLFLNFKYLVPFLLNQSGSLVFYFTLASTDLSLAVPVVNSLTFLFTLLMGKVLGEEFGGKGAIMGMLLIMCGVTVC 124          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Mouse
Match: Tmem234 (transmembrane protein 234 [Source:MGI Symbol;Acc:MGI:1924049])

HSP 1 Score: 47.7506 bits (112), Expect = 4.499e-7
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  178 IYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            ++ N ++LM FLLNQS S+ + +TL  + +++AVPI NSL  V + I G  L  +     +  G+   + G+ +C T+
Sbjct:   51 LFGNTEYLMPFLLNQSGSLLYYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKEAVAGMVLTITGITVCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Mouse
Match: Tmem234 (transmembrane protein 234 [Source:MGI Symbol;Acc:MGI:1924049])

HSP 1 Score: 45.4394 bits (106), Expect = 3.654e-6
Identity = 27/78 (34.62%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  178 IYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            ++ N ++LM FLLNQS S+ + +TL  + +++AVPI NSL  V + I G  L  +    ++  G+   + G+ +C T+
Sbjct:   51 LFGNTEYLMPFLLNQSGSLLYYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKVA--GMVLTITGITVCITS 126          
BLAST of UPF0546 membrane protein AGAP012180 vs. UniProt/SwissProt
Match: sp|Q54ZG7|TM234_DICDI (Transmembrane protein 234 homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277575 PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 2.239e-9
Identity = 41/126 (32.54%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   82 MDLVIILIQCFVGIVWGLTNVLMKLFQTDDSPIYKN----------------LKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            MD   I+    VG +WG TN L+K      S + K+                  + +  L+N S S+ F  TL    IS+ VPI+NSLTF+ +++ G  L  + L + S++G+ FVL G+ IC ++
Sbjct:    1 MDTYNIISLLLVGFIWGGTNPLIKRGSEGVSKVKKDNFLSQIIYEFVYLWTRPSYTIPMLINLSGSVVFFYTLSKVDISLVVPISNSLTFLFTSLMGMLLGEKVLHFKSYLGMIFVLAGVTICVSS 126          
BLAST of UPF0546 membrane protein AGAP012180 vs. UniProt/SwissProt
Match: sp|A0NGI1|TM234_ANOGA (Transmembrane protein 234 homolog OS=Anopheles gambiae OX=7165 GN=AGAP012180 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 4.210e-9
Identity = 37/123 (30.08%), Postives = 62/123 (50.41%), Query Frame = 1
Query:   82 MDLVIILIQCFVGIVWGLTNVLMKLFQ------TDDSPIYK----------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            +D+  +L    V I+WG TN  +K           DS + +            ++L+  ++NQ  SI +++TL+ + +S+ VP+ NSLTFV +AI    L   +  W  + G+  V+LG  IC
Sbjct:   12 VDIYAVLSILLVAIMWGATNPFIKRGSIGYNELKADSKLGQLWLEVRFLITRWQYLLPLVINQLGSIVYVLTLQRTELSLTVPMANSLTFVFTAITARLLGERQSGWKIYCGMTLVILGTVIC 134          
BLAST of UPF0546 membrane protein AGAP012180 vs. UniProt/SwissProt
Match: sp|Q8R1E7|TM234_MOUSE (Transmembrane protein 234 OS=Mus musculus OX=10090 GN=Tmem234 PE=1 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 3.147e-6
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  178 IYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            ++ N ++LM FLLNQS S+ + +TL  + +++AVPI NSL  V + I G  L  +     +  G+   + G+ +C T+
Sbjct:   51 LFGNTEYLMPFLLNQSGSLLYYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKEAVAGMVLTITGITVCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. UniProt/SwissProt
Match: sp|Q8WY98|TM234_HUMAN (Transmembrane protein 234 OS=Homo sapiens OX=9606 GN=TMEM234 PE=1 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 6.921e-6
Identity = 33/111 (29.73%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  127 WGLTNVLMKL----FQTDDSPIYK------------NLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            WG T  L+K      Q    P +             N ++LM FLLNQ  S+ + +TL  + +++AVPI NSL  + + I G AL  +     +  G+   ++G+ +C T+
Sbjct:   18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCITS 128          
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Match: A0A151XJ06 (Uncharacterized protein OS=Trachymyrmex zeteki OX=64791 GN=ALC60_00800 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.681e-16
Identity = 49/126 (38.89%), Postives = 75/126 (59.52%), Query Frame = 1
Query:   76 FIMDLVIILIQCFVGIVWGLTNVLMK-----LFQTDDSPIY-----------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICC 405
            +I D VI L  CFV I+WG+TN  +K     L   +   +Y            NLK+++ FLLNQ  S+ + +TL+ S +S+AVP++NSLTFV +A+ G+ L  EK+   +++G+  VL G  +CC
Sbjct:    4 YIADTVIYL--CFVAILWGVTNPFIKKGAQGLENINAKSVYGQFFKEQLFLITNLKYIVPFLLNQCGSVLYFLTLQSSDLSLAVPVSNSLTFVFTAVTGWFLGEEKVHRNTYLGMILVLCGTMLCC 127          
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Match: A0A195FLA5 (Uncharacterized protein (Fragment) OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_04277 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.072e-16
Identity = 50/126 (39.68%), Postives = 75/126 (59.52%), Query Frame = 1
Query:   76 FIMDLVIILIQCFVGIVWGLTNVLMK-----LFQTDDSPIY-----------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICC 405
            +I+D VI L  CFV I+WG+TN  +K     L       +Y            NLK+++ FLLNQ  S+ + +TL+ S +S+AVP++NSLTFV +AI G+ L  EK+   +++G+  VL G  +CC
Sbjct:    1 YIVDSVIYL--CFVAILWGVTNPFIKKGAQGLEAIRAKSVYGQFFKEQLFLITNLKYIVPFLLNQCGSVLYFLTLQSSDLSLAVPVSNSLTFVFTAITGWFLGEEKVHRNTYLGMILVLCGTMLCC 124          
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Match: A0A158NEG4 (Uncharacterized protein OS=Atta cephalotes OX=12957 GN=105619002 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.053e-15
Identity = 50/125 (40.00%), Postives = 74/125 (59.20%), Query Frame = 1
Query:   79 IMDLVIILIQCFVGIVWGLTNVLMK-----LFQTDDSPIY-----------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICC 405
            I+D VI L  CFV I+WG+TN  +K     L       +Y            NLK+++ FLLNQ  S+ + +TL+ S +S+AVP++NSLTFV +AI G+ L  EK+   +++G+  VL G  +CC
Sbjct:    4 IIDSVIYL--CFVAILWGVTNPFIKKGAQGLEDIRAKSVYGQFFKEQLFLITNLKYIVPFLLNQCGSVLYFLTLQNSDLSLAVPVSNSLTFVFTAITGWFLGEEKVHRNTYLGMILVLCGTMLCC 126          
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Match: A0A267DPK2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001788g2 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.216e-15
Identity = 39/115 (33.91%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   94 IILIQCFVGIVWGLTNVLMKL---FQTDDSPIY------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            ++L+   VG+VWG+TN LMK      T DS  +      +N K+L +   NQS S+ F+ +L  + +S+AVP+TN++TF+++++ G+ +N EKL+  + + +  +  G+++C T+
Sbjct:    1 MLLLCAAVGLVWGVTNALMKASTAADTSDSKAWSLGALLRNWKYLTALAANQSASLLFLWSLAEASLSIAVPLTNTVTFLATSLTGWLINGEKLAPTTLLAMALMSAGIYLCVTS 115          
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Match: A0A1I8G1R6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001788g1 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.376e-15
Identity = 38/115 (33.04%), Postives = 73/115 (63.48%), Query Frame = 1
Query:   94 IILIQCFVGIVWGLTNVLMKL---FQTDDSPIY------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            ++L+   VG+VWG+TN LMK      T DS  +      +N K+L +   NQS S+ F+ +L  + +S+AVP++N++TF+++++ G+ +N EKL+  + + +  +  G+++C T+
Sbjct:    1 MLLLCAAVGLVWGVTNALMKASTAADTSDSKAWSLGALLRNWKYLTALAANQSASLLFLWSLAEASLSIAVPLSNTVTFLATSLTGWLINGEKLAPTTLLAMALMSAGIYLCVTS 115          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Cavefish
Match: tmem234 (transmembrane protein 234 [Source:NCBI gene;Acc:103036571])

HSP 1 Score: 54.299 bits (129), Expect = 1.348e-9
Identity = 36/112 (32.14%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKL----------------FQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V  +WG TN L+K                 F  +   ++ NLK+L+ FLLNQS S+ F +TL  + +S+AVP  NSL+F+ + + G  L  +     + +G+   +LG+ +C
Sbjct:   13 VAALWGGTNPLLKRATVGIEHVKEGSRISQFLAEVKFLFLNLKYLLPFLLNQSGSVVFYITLATADLSLAVPTVNSLSFLFTMLTGKLLGEDFGGKRAVLGMVLTMLGVTLC 124          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Sea Lamprey
Match: tmem234 (transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GENE-090313-326])

HSP 1 Score: 49.2914 bits (116), Expect = 2.391e-8
Identity = 34/112 (30.36%), Postives = 56/112 (50.00%), Query Frame = 1
Query:  115 VGIVWGLTNVLMKLFQTDDSPIY----------------KNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V ++WG TN L+K        +                  N ++++ F+LNQS S+ +  TL  + +SVAVP+TNSLTF+ + I G  L        + +G+  + +GL +C
Sbjct:   15 VALLWGGTNPLLKRGAKGVETVRGRGRLRQLFAELCFLVSNPRYMVPFVLNQSGSLLYYFTLGSADLSVAVPLTNSLTFIFTLITGKLLGENIGGTRALLGMLLMGVGLTLC 126          
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Nematostella
Match: EDO37684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF34])

HSP 1 Score: 59.3066 bits (142), Expect = 5.034e-12
Identity = 38/112 (33.93%), Postives = 61/112 (54.46%), Query Frame = 1
Query:  115 VGIVWGLTNVLMK----------------LFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFIC 402
            V ++WG+TN  +K                 F  +   +  N K+++ FLLNQS S+ F +TL  + +S+AVPITNSLTF+ + + G  L  E     ++IG+  V+ G+ +C
Sbjct:   15 VALLWGVTNPFIKKGSAGIEDVKGKGAIRQFLAEIRYLIFNWKYMVPFLLNQSGSVLFYLTLGSADLSLAVPITNSLTFIMTTLTGRILGEESCKTETYIGMLLVVGGVSLC 126          
BLAST of UPF0546 membrane protein AGAP012180 vs. Planmine SMEST
Match: SMESG000012908.1 (SMESG000012908.1)

HSP 1 Score: 214.542 bits (545), Expect = 9.272e-73
Identity = 109/110 (99.09%), Postives = 109/110 (99.09%), Query Frame = 1
Query:   82 MDLVIILIQCFVGIVWGLTNVLMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            MDLVIILIQCFVGIVWGLTN LMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA
Sbjct:    1 MDLVIILIQCFVGIVWGLTNALMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 110          
BLAST of UPF0546 membrane protein AGAP012180 vs. Planmine SMEST
Match: SMESG000012908.1 (SMESG000012908.1)

HSP 1 Score: 174.096 bits (440), Expect = 3.653e-57
Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
Query:  148 MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA
Sbjct:    1 MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 88          
BLAST of UPF0546 membrane protein AGAP012180 vs. Planmine SMEST
Match: SMESG000012908.1 (SMESG000012908.1)

HSP 1 Score: 171.785 bits (434), Expect = 3.975e-56
Identity = 91/110 (82.73%), Postives = 91/110 (82.73%), Query Frame = 1
Query:   82 MDLVIILIQCFVGIVWGLTNVLMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            MDLVIILIQCFVGIVWGLTN LMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKF                 S IAGYALNNEKLSWISFIGIGFVLLGLFICCTA
Sbjct:    1 MDLVIILIQCFVGIVWGLTNALMKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKF-----------------STIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 93          
BLAST of UPF0546 membrane protein AGAP012180 vs. Planmine SMEST
Match: SMESG000012908.1 (SMESG000012908.1)

HSP 1 Score: 131.339 bits (329), Expect = 1.833e-40
Identity = 70/88 (79.55%), Postives = 70/88 (79.55%), Query Frame = 1
Query:  148 MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 411
            MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKF                 S IAGYALNNEKLSWISFIGIGFVLLGLFICCTA
Sbjct:    1 MKLFQTDDSPIYKNLKFLMSFLLNQSMSIAFMVTLKF-----------------STIAGYALNNEKLSWISFIGIGFVLLGLFICCTA 71          
The following BLAST results are available for this feature:
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TMEM2341.016e-629.73transmembrane protein 234 [Source:HGNC Symbol;Acc:... [more]
TMEM2341.441e-629.73transmembrane protein 234 [Source:HGNC Symbol;Acc:... [more]
TMEM2341.441e-629.73transmembrane protein 234 [Source:HGNC Symbol;Acc:... [more]
TMEM2341.441e-629.73transmembrane protein 234 [Source:HGNC Symbol;Acc:... [more]
TMEM2341.441e-629.73transmembrane protein 234 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG129297.827e-1134.21gene:FBgn0033429 transcript:FBtr0088541[more]
CG129292.006e-1035.79gene:FBgn0033429 transcript:FBtr0113060[more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tmem2342.941e-932.14transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem2343.617e-932.14transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GEN... [more]
tmem2343.617e-932.14transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem2344.499e-734.62transmembrane protein 234 [Source:MGI Symbol;Acc:M... [more]
Tmem2343.654e-634.62transmembrane protein 234 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q54ZG7|TM234_DICDI2.239e-932.54Transmembrane protein 234 homolog OS=Dictyostelium... [more]
sp|A0NGI1|TM234_ANOGA4.210e-930.08Transmembrane protein 234 homolog OS=Anopheles gam... [more]
sp|Q8R1E7|TM234_MOUSE3.147e-634.62Transmembrane protein 234 OS=Mus musculus OX=10090... [more]
sp|Q8WY98|TM234_HUMAN6.921e-629.73Transmembrane protein 234 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A151XJ062.681e-1638.89Uncharacterized protein OS=Trachymyrmex zeteki OX=... [more]
A0A195FLA54.072e-1639.68Uncharacterized protein (Fragment) OS=Trachymyrmex... [more]
A0A158NEG41.053e-1540.00Uncharacterized protein OS=Atta cephalotes OX=1295... [more]
A0A267DPK22.216e-1533.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G1R67.376e-1533.04Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2341.348e-932.14transmembrane protein 234 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem2342.391e-830.36transmembrane protein 234 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376845.034e-1233.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UPF0546 membrane protein AGAP012180 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000012908.19.272e-7399.09SMESG000012908.1[more]
SMESG000012908.13.653e-57100.00SMESG000012908.1[more]
SMESG000012908.13.975e-5682.73SMESG000012908.1[more]
SMESG000012908.11.833e-4079.55SMESG000012908.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013637 ID=SMED30013637|Name=UPF0546 membrane protein AGAP012180|organism=Schmidtea mediterranea sexual|type=transcript|length=501bp
GGAGATTGGTTTTACTAATATCACAAAAGATGAATTTTGGACTTCTTTAA
TTCTCGATGAAAACGGAATCGAAAATTTATTATGGATTTAGTAATTATTC
TAATTCAATGTTTCGTCGGAATTGTTTGGGGACTAACAAATGTACTAATG
AAATTATTTCAAACCGACGACTCTCCAATTTATAAAAATTTGAAGTTCTT
AATGTCATTTTTATTAAACCAGTCGATGTCAATTGCGTTTATGGTCACTC
TGAAATTTTCTATAATTTCTGTCGCTGTTCCTATTACGAATTCATTAACA
TTTGTATCTTCAGCAATTGCGGGTTACGCATTAAATAATGAGAAATTGAG
TTGGATAAGTTTTATTGGAATTGGATTTGTGTTGCTGGGGCTTTTTATTT
GTTGTACTGCATAAAGAAATGTAAATAATAAATCTTTATAGTAAATTTCG
TTATTTAAAATTGCAAAATCACGAAACAAAACAGCTGTAATGATTGTAGA
A
back to top

protein sequence of SMED30013637-orf-1

>SMED30013637-orf-1 ID=SMED30013637-orf-1|Name=SMED30013637-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MDLVIILIQCFVGIVWGLTNVLMKLFQTDDSPIYKNLKFLMSFLLNQSMS
IAFMVTLKFSIISVAVPITNSLTFVSSAIAGYALNNEKLSWISFIGIGFV
LLGLFICCTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR018908TMEM234
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018908Putative transmembrane family 234PFAMPF10639TMEM234coord: 11..108
e-value: 8.9E-17
score: 61.2
IPR018908Putative transmembrane family 234PANTHERPTHR28668FAMILY NOT NAMEDcoord: 34..109
NoneNo IPR availableSUPERFAMILYSSF103481Multidrug resistance efflux transporter EmrEcoord: 24..107
NoneNo IPR availableTMHMMTMhelixcoord: 47..69
NoneNo IPR availableTMHMMTMhelixcoord: 89..108
NoneNo IPR availableTMHMMTMhelixcoord: 4..26