Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3

Overview
NameArf-GAP with GTPase, ANK repeat and PH domain-containing protein 3
Smed IDSMED30013633
Length (bp)4420
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (SMED30013633) t-SNE clustered cells

Violin plots show distribution of expression levels for Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (SMED30013633) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (SMED30013633) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (SMED30013633) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013633

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30013633SMESG000048961.1 SMESG000028913.1 dd_Smed_v4_3934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013633SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013633SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013633SMESG000048961.1 SMESG000028913.1 dd_Smed_v4_3934_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013633SMESG000075717.1 dd_Smed_v4_4301_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 296.975 bits (759), Expect = 5.735e-85
Identity = 178/452 (39.38%), Postives = 248/452 (54.87%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  S+       ++M  +  S  + +          S+ + +S             K HRR KS           T ++  E++EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE S    +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + Q L+ A   +D R  IL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  284 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLSKDMSSLHISPNSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRT--KPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGC 719          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 296.975 bits (759), Expect = 1.815e-84
Identity = 178/452 (39.38%), Postives = 248/452 (54.87%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  S+       ++M  +  S  + +          S+ + +S             K HRR KS           T ++  E++EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE S    +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + Q L+ A   +D R  IL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLSKDMSSLHISPNSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRT--KPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGC 773          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Match: AGAP1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:HGNC Symbol;Acc:HGNC:16922])

HSP 1 Score: 297.745 bits (761), Expect = 7.260e-83
Identity = 178/452 (39.38%), Postives = 248/452 (54.87%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  S+       ++M  +  S  + +          S+ + +S             K HRR KS           T ++  E++EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE S    +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + Q L+ A   +D R  IL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  603 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLSKDMSSLHISPNSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRT--KPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGC 1038          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Match: AGAP3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:16923])

HSP 1 Score: 253.832 bits (647), Expect = 6.765e-74
Identity = 131/316 (41.46%), Postives = 185/316 (58.54%), Query Frame = 3
Query: 3030 KPHRRMKS-------NPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLA-LAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS        P    ++  ES+EF+++    + WHF+A + EER+ WV  +++ IL  LQ                 S      L     A+A   +R++ GN  C DC +P+P WASLNLG  +CIECSG+HR LG HLSRVRS  LD+W  E +AVM A+GN LANSVWE ++   S  KP  D+ R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A+   D R +++ LA  +++ VN  Y D D RTA+H+++ + N+V+ QLL+WY  +    D  G     YA  +G  +CA  LI++ C
Sbjct:   73 KKHRRKKSTGTPRPDGPSSATEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ--------------GCRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALGGYS--KPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGC 372          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Match: AGAP3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:HGNC Symbol;Acc:HGNC:16923])

HSP 1 Score: 249.21 bits (635), Expect = 3.186e-70
Identity = 124/291 (42.61%), Postives = 176/291 (60.48%), Query Frame = 3
Query: 3084 ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            ES+EF+++    + WHF+A + EER+ WV  +++ IL  LQ                 S      L     A+A   +R++ GN  C DC +P+P WASLNLG  +CIECSG+HR LG HLSRVRS  LD+W  E +AVM A+GN LANSVWE ++   S  KP  D+ R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A+   D R +++ LA  +++ VN  Y D D RTA+H+++ + N+V+ QLL+WY  +    D  G     YA  +G  +CA  LI++ C
Sbjct:  274 ESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ--------------GCRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALGGYS--KPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGC 548          

HSP 2 Score: 84.3445 bits (207), Expect = 8.304e-16
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            ++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:  166 VDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 236          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 214.542 bits (545), Expect = 3.659e-58
Identity = 119/316 (37.66%), Postives = 176/316 (55.70%), Query Frame = 3
Query: 3024 RSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIAN-----LIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSP 3956
            + +  R++ +N K  ND++ E +E  +I N   +W F AGSLEERD+W+  I   I   L     N                      +  A+AN      +RSI GN  C DCG+P   WAS+NLGI +CIECSG+HR LG+H+S+VR  +LD+W  EH+AVMQAIGN  AN +WE  +  +  +KP  +SSR +KE ++  KY +K FL P+   + P+  QLI A+  +D   + + LA          + +D RT +H+AA++G++   QLL+W+N +  + DN GR+  FYA  +G  +    L+    SP
Sbjct:  308 KKRESRKIGTNSK-HNDEEDECFE--VINNCLMRWEFCAGSLEERDEWIQAIGGEIEKSLGKEVANA-------------------KTNNRAVANRPDIAALRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGL-LNGERKPTPESSREEKERFIDRKYVQKAFLKPIASGE-PVTSQLISAVLARDVMSLNVLLANGMSVEEINTTTKDGRTVLHLAASIGSVELAQLLIWHNADAQILDNNGRSCLFYARSNGFREVFDMLVTAGLSP 599          

HSP 2 Score: 67.3958 bits (163), Expect = 5.741e-11
Identity = 35/71 (49.30%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 2834
            +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  163 LGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 232          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 214.927 bits (546), Expect = 9.301e-58
Identity = 119/316 (37.66%), Postives = 176/316 (55.70%), Query Frame = 3
Query: 3024 RSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIAN-----LIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSP 3956
            + +  R++ +N K  ND++ E +E  +I N   +W F AGSLEERD+W+  I   I   L     N                      +  A+AN      +RSI GN  C DCG+P   WAS+NLGI +CIECSG+HR LG+H+S+VR  +LD+W  EH+AVMQAIGN  AN +WE  +  +  +KP  +SSR +KE ++  KY +K FL P+   + P+  QLI A+  +D   + + LA          + +D RT +H+AA++G++   QLL+W+N +  + DN GR+  FYA  +G  +    L+    SP
Sbjct:  384 KKRESRKIGTNSK-HNDEEDECFE--VINNCLMRWEFCAGSLEERDEWIQAIGGEIEKSLGKEVANA-------------------KTNNRAVANRPDIAALRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGL-LNGERKPTPESSREEKERFIDRKYVQKAFLKPIASGE-PVTSQLISAVLARDVMSLNVLLANGMSVEEINTTTKDGRTVLHLAASIGSVELAQLLIWHNADAQILDNNGRSCLFYARSNGFREVFDMLVTAGLSP 675          

HSP 2 Score: 67.3958 bits (163), Expect = 5.958e-11
Identity = 35/71 (49.30%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 2834
            +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  239 LGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 308          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 214.542 bits (545), Expect = 5.107e-57
Identity = 119/316 (37.66%), Postives = 176/316 (55.70%), Query Frame = 3
Query: 3024 RSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIAN-----LIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSP 3956
            + +  R++ +N K  ND++ E +E  +I N   +W F AGSLEERD+W+  I   I   L     N                      +  A+AN      +RSI GN  C DCG+P   WAS+NLGI +CIECSG+HR LG+H+S+VR  +LD+W  EH+AVMQAIGN  AN +WE  +  +  +KP  +SSR +KE ++  KY +K FL P+   + P+  QLI A+  +D   + + LA          + +D RT +H+AA++G++   QLL+W+N +  + DN GR+  FYA  +G  +    L+    SP
Sbjct:  515 KKRESRKIGTNSK-HNDEEDECFE--VINNCLMRWEFCAGSLEERDEWIQAIGGEIEKSLGKEVANA-------------------KTNNRAVANRPDIAALRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGL-LNGERKPTPESSREEKERFIDRKYVQKAFLKPIASGE-PVTSQLISAVLARDVMSLNVLLANGMSVEEINTTTKDGRTVLHLAASIGSVELAQLLIWHNADAQILDNNGRSCLFYARSNGFREVFDMLVTAGLSP 806          

HSP 2 Score: 67.3958 bits (163), Expect = 6.777e-11
Identity = 35/71 (49.30%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 2834
            +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  370 LGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 439          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 214.927 bits (546), Expect = 6.313e-57
Identity = 119/316 (37.66%), Postives = 176/316 (55.70%), Query Frame = 3
Query: 3024 RSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIAN-----LIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSP 3956
            + +  R++ +N K  ND++ E +E  +I N   +W F AGSLEERD+W+  I   I   L     N                      +  A+AN      +RSI GN  C DCG+P   WAS+NLGI +CIECSG+HR LG+H+S+VR  +LD+W  EH+AVMQAIGN  AN +WE  +  +  +KP  +SSR +KE ++  KY +K FL P+   + P+  QLI A+  +D   + + LA          + +D RT +H+AA++G++   QLL+W+N +  + DN GR+  FYA  +G  +    L+    SP
Sbjct:  545 KKRESRKIGTNSK-HNDEEDECFE--VINNCLMRWEFCAGSLEERDEWIQAIGGEIEKSLGKEVANA-------------------KTNNRAVANRPDIAALRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGL-LNGERKPTPESSREEKERFIDRKYVQKAFLKPIASGE-PVTSQLISAVLARDVMSLNVLLANGMSVEEINTTTKDGRTVLHLAASIGSVELAQLLIWHNADAQILDNNGRSCLFYARSNGFREVFDMLVTAGLSP 836          

HSP 2 Score: 67.781 bits (164), Expect = 6.009e-11
Identity = 35/71 (49.30%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 2834
            +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  400 LGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 469          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Match: cnt-2 (Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XX14])

HSP 1 Score: 214.542 bits (545), Expect = 1.217e-56
Identity = 119/316 (37.66%), Postives = 176/316 (55.70%), Query Frame = 3
Query: 3024 RSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIAN-----LIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSP 3956
            + +  R++ +N K  ND++ E +E  +I N   +W F AGSLEERD+W+  I   I   L     N                      +  A+AN      +RSI GN  C DCG+P   WAS+NLGI +CIECSG+HR LG+H+S+VR  +LD+W  EH+AVMQAIGN  AN +WE  +  +  +KP  +SSR +KE ++  KY +K FL P+   + P+  QLI A+  +D   + + LA          + +D RT +H+AA++G++   QLL+W+N +  + DN GR+  FYA  +G  +    L+    SP
Sbjct:  593 KKRESRKIGTNSK-HNDEEDECFE--VINNCLMRWEFCAGSLEERDEWIQAIGGEIEKSLGKEVANA-------------------KTNNRAVANRPDIAALRSIPGNGRCADCGNPSSEWASINLGIIICIECSGIHRNLGSHISKVRGLELDQWPVEHLAVMQAIGNDKANEMWEFGL-LNGERKPTPESSREEKERFIDRKYVQKAFLKPIASGE-PVTSQLISAVLARDVMSLNVLLANGMSVEEINTTTKDGRTVLHLAASIGSVELAQLLIWHNADAQILDNNGRSCLFYARSNGFREVFDMLVTAGLSP 884          

HSP 2 Score: 67.781 bits (164), Expect = 5.990e-11
Identity = 35/71 (49.30%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSS-NQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQ-VRGKEVDLKLTSIKIPG 2834
            +G GR IP+KQ  L+KKSS + +N++ K +KYV L  D +LTY+ N+ +YM++   GKE+DLKL +I+I G
Sbjct:  448 LGIGRAIPIKQGNLYKKSSKSALNREWK-KKYVCLYSDGRLTYHTNLKEYMDKTAHGKEMDLKLATIRITG 517          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080548)

HSP 1 Score: 240.35 bits (612), Expect = 4.631e-66
Identity = 128/297 (43.10%), Postives = 176/297 (59.26%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTND-DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPL-----PYLDAPIQQQLIDAITRQDTRQVILCLA-LAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYA 3899
            K HRRMKS+    N+ DD + YEF ++  D++QWHF+A + EERD+WV  +E  I   LQ              +  S+      +  + A+  + + + GN  C DCG+P+P WASLNLG+ +CIECSGVHR LG+H+S+VRS  LD+W   H++VM AIGN+LANSVWE++       KP + +SR DKE WVRSKYE K FL PL      +      QQLI+A+ R D + ++  LA    +  NA  S +D RT + +A  +GN+   QLL+W   N   TD+EGR    YA
Sbjct:  395 KRHRRMKSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQ--------------SIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV--KPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYA 675          

HSP 2 Score: 88.5817 bits (218), Expect = 2.825e-17
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 2852
            +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  215 LGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 288          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080547)

HSP 1 Score: 240.35 bits (612), Expect = 4.580e-65
Identity = 128/297 (43.10%), Postives = 176/297 (59.26%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTND-DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPL-----PYLDAPIQQQLIDAITRQDTRQVILCLA-LAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYA 3899
            K HRRMKS+    N+ DD + YEF ++  D++QWHF+A + EERD+WV  +E  I   LQ              +  S+      +  + A+  + + + GN  C DCG+P+P WASLNLG+ +CIECSGVHR LG+H+S+VRS  LD+W   H++VM AIGN+LANSVWE++       KP + +SR DKE WVRSKYE K FL PL      +      QQLI+A+ R D + ++  LA    +  NA  S +D RT + +A  +GN+   QLL+W   N   TD+EGR    YA
Sbjct:  559 KRHRRMKSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQ--------------SIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV--KPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYA 839          

HSP 2 Score: 88.1965 bits (217), Expect = 4.394e-17
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 2852
            +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  379 LGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 452          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Match: CenG1A (gene:FBgn0028509 transcript:FBtr0080546)

HSP 1 Score: 240.35 bits (612), Expect = 1.168e-64
Identity = 128/297 (43.10%), Postives = 176/297 (59.26%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTND-DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPL-----PYLDAPIQQQLIDAITRQDTRQVILCLA-LAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYA 3899
            K HRRMKS+    N+ DD + YEF ++  D++QWHF+A + EERD+WV  +E  I   LQ              +  S+      +  + A+  + + + GN  C DCG+P+P WASLNLG+ +CIECSGVHR LG+H+S+VRS  LD+W   H++VM AIGN+LANSVWE++       KP + +SR DKE WVRSKYE K FL PL      +      QQLI+A+ R D + ++  LA    +  NA  S +D RT + +A  +GN+   QLL+W   N   TD+EGR    YA
Sbjct:  627 KRHRRMKSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQ--------------SIESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV--KPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYA 907          

HSP 2 Score: 88.5817 bits (218), Expect = 3.446e-17
Identity = 39/75 (52.00%), Postives = 58/75 (77.33%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNS 2852
            +GSGR IP+KQ YL+K+SS  +NK+ K +KYVTL +D +LTY+P+++DYM+ V GKE+ L+  ++K+PG   R S
Sbjct:  447 LGSGRSIPIKQGYLYKRSSKSLNKEWK-KKYVTLCDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGS 520          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084369)

HSP 1 Score: 126.331 bits (316), Expect = 2.141e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 3
Query: 3321 IAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHAS-SLKKPEADSSRSDKEAWVRSKYEKKMFLPPLP 3653
            I GN  CCDC SP+P WAS+NLGI++CIECSGVHR LG H S+VRS  LD W  E++ VM  +GN + N ++EA +     LKKP        +EAW+++KY ++ F+  +P
Sbjct:  160 IPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMP 271          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Match: CenB1A (gene:FBgn0039056 transcript:FBtr0084368)

HSP 1 Score: 127.102 bits (318), Expect = 3.229e-29
Identity = 55/112 (49.11%), Postives = 75/112 (66.96%), Query Frame = 3
Query: 3321 IAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHAS-SLKKPEADSSRSDKEAWVRSKYEKKMFLPPLP 3653
            I GN  CCDC SP+P WAS+NLGI++CIECSGVHR LG H S+VRS  LD W  E++ VM  +GN + N ++EA +     LKKP        +EAW+++KY ++ F+  +P
Sbjct:  390 IPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMMELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCGMP 501          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 234.572 bits (597), Expect = 2.123e-63
Identity = 136/325 (41.85%), Postives = 187/325 (57.54%), Query Frame = 3
Query: 3030 KPHRRMKS--NPKV-----TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS  N KV     T ++  +++EF+++    + W+F+A S EERD WV  IES IL  LQ              +  S+   + L+    AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K+FL  L   +  + QQL+ A   +D R V++ LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D     A  YA  +   +C   L++  C    +P+++
Sbjct:  527 KKHRRKKSTSNFKVDGFSGTAEEQEDNFEFVIVSLTGQTWNFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLSSQSEAIALQSVRNMRGNTRCVDCEAQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKLFLASLTCTELSLGQQLLRATAEEDLRLVVILLAHGSRDEVNETCGEGDGRTALHLACRKGNVVITQLLVWYGVDIMARDAHSNTALAYARQANSQECMDVLLQYGCPDERYPLMA 835          

HSP 2 Score: 83.1889 bits (204), Expect = 1.953e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 234.187 bits (596), Expect = 2.213e-63
Identity = 136/325 (41.85%), Postives = 187/325 (57.54%), Query Frame = 3
Query: 3030 KPHRRMKS--NPKV-----TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS  N KV     T ++  +++EF+++    + W+F+A S EERD WV  IES IL  LQ              +  S+   + L+    AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K+FL  L   +  + QQL+ A   +D R V++ LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D     A  YA  +   +C   L++  C    +P+++
Sbjct:  497 KKHRRKKSTSNFKVDGFSGTAEEQEDNFEFVIVSLTGQTWNFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLSSQSEAIALQSVRNMRGNTRCVDCEAQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKLFLASLTCTELSLGQQLLRATAEEDLRLVVILLAHGSRDEVNETCGEGDGRTALHLACRKGNVVITQLLVWYGVDIMARDAHSNTALAYARQANSQECMDVLLQYGCPDERYPLMA 805          

HSP 2 Score: 83.1889 bits (204), Expect = 1.937e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  308 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 377          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:ZFIN;Acc:ZDB-GENE-130405-1])

HSP 1 Score: 234.572 bits (597), Expect = 2.325e-63
Identity = 136/325 (41.85%), Postives = 187/325 (57.54%), Query Frame = 3
Query: 3030 KPHRRMKS--NPKV-----TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS  N KV     T ++  +++EF+++    + W+F+A S EERD WV  IES IL  LQ              +  S+   + L+    AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K+FL  L   +  + QQL+ A   +D R V++ LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D     A  YA  +   +C   L++  C    +P+++
Sbjct:  532 KKHRRKKSTSNFKVDGFSGTAEEQEDNFEFVIVSLTGQTWNFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLSSQSEAIALQSVRNMRGNTRCVDCEAQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKLFLASLTCTELSLGQQLLRATAEEDLRLVVILLAHGSRDEVNETCGEGDGRTALHLACRKGNVVITQLLVWYGVDIMARDAHSNTALAYARQANSQECMDVLLQYGCPDERYPLMA 840          

HSP 2 Score: 83.1889 bits (204), Expect = 1.945e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  343 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 412          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:ZFIN;Acc:ZDB-GENE-110927-1])

HSP 1 Score: 235.343 bits (599), Expect = 1.340e-62
Identity = 138/317 (43.53%), Postives = 184/317 (58.04%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTNDDDLES--------YEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS   +T  D L +        +EFI++    + WHF+A + EER+ WV  IES IL  LQ              +  S+   + L     A+A   IR++ GN  C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E   VM AIGN +ANSVWEA V      KP  DS+R +KE W+R+KYE+K+F+  LP  D P+ QQL+ A+   D R V+L LA   ++ VN  Y D D RTA+H++  + N+V  QLL+WY  +    D  G+    YA  +G  +CA  LI++ C
Sbjct:  799 KKHRRKKST-GITKPDSLSAGSEEPEESFEFIIVSLTGQMWHFEASTFEERELWVQAIESQILASLQ--------------SCESSKNKSRLGSQSDALAIQSIRNVRGNSFCADCDAPNPDWASLNLGALICIECSGMHRNLGTHLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEACVDG--YNKPGVDSTREEKERWIRAKYEQKLFVVALPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYAQRAGSQECADILIQHGC 1098          

HSP 2 Score: 83.1889 bits (204), Expect = 2.154e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  611 DSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 680          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Match: agap2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 [Source:ZFIN;Acc:ZDB-GENE-061103-343])

HSP 1 Score: 205.297 bits (521), Expect = 7.061e-54
Identity = 116/299 (38.80%), Postives = 166/299 (55.52%), Query Frame = 3
Query: 3087 SYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYL--DAPIQQQLIDAITRQDTRQVILCLALA-EDAVNAC--YSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHP 3968
            S +FI+I +  + WHF+A S E+RD WV  IES IL  LQ              +  S N     + S       IR+  GN++C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD W  E   V+ AIGN +AN +WE          PEA  +R  +E+W+R+KYE++ F+ PLP    +  +   L+ A+  +D   ++L LA + ++ +N     + Q   +A+H A  LG++V  QLL+WY  +    D +GR A   A  +G  +CA  L+++ C   T P
Sbjct:  519 SVDFIIISSTGQSWHFEAQSQEDRDAWVQAIESQILASLQ--------------SCESRNKARRNSQSEAVALQAIRNAKGNDLCVDCAAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDVWPSELTKVLSAIGNHMANHIWETCTQGCQKLTPEA--TREQRESWIRAKYEQRAFVSPLPAQCSEDTMSTWLLKAVINRDLPNLLLLLAHSTKELINIPPEGAGQQHHSALHAACQLGDVVMTQLLVWYGSDVKSKDPQGRTALTLARQAGSKECAEILVQHGCPSETSP 801          

HSP 2 Score: 63.929 bits (154), Expect = 1.341e-9
Identity = 27/63 (42.86%), Postives = 45/63 (71.43%), Query Frame = 3
Query: 2646 IPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            +P+KQ  L+K+S   +NK+ K +KYVTL+    LTY+ N+N+++   +GKE+DL   ++K+PG
Sbjct:  333 VPIKQGTLWKRSERSLNKEWK-KKYVTLSNSGMLTYHSNINEFLQNAQGKEMDLLRVTVKVPG 394          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 295.819 bits (756), Expect = 1.311e-82
Identity = 177/452 (39.16%), Postives = 249/452 (55.09%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  ++       + +  +  S    +          S+ + +S             K HRR KS           T ++  E++EFI++   ++ WHF+A S EERD WV  IES IL  LQ               ++S N +   + +       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN LANSVWE S       KP ++S R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A   +D R VIL LA  + + VN    + D RT++H+A   GN+V +QLL+WY  +    D  G  A  YA  +   +    L++  C
Sbjct:  553 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSSCAPVASPKTNGLTKEVSGLQISPNTDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSSTAEEQEENFEFIIVSLTSQSWHFEATSYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQNEALALQSIRNLPGNSHCVDCDAQNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPELIKVMSAIGNELANSVWEGSSQGHV--KPCSESPREEKERWIRAKYEQKLFLSPLPCRDLPLGQQLLRATAEEDLRAVILLLAHGSREEVNETCGEGDRRTSLHLACRKGNVVLVQLLIWYGVDVMARDFHGNTALAYAKQAVTSEVRELLLQYGC 988          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 295.819 bits (756), Expect = 1.645e-82
Identity = 177/452 (39.16%), Postives = 249/452 (55.09%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  ++       + +  +  S    +          S+ + +S             K HRR KS           T ++  E++EFI++   ++ WHF+A S EERD WV  IES IL  LQ               ++S N +   + +       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN LANSVWE S       KP ++S R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A   +D R VIL LA  + + VN    + D RT++H+A   GN+V +QLL+WY  +    D  G  A  YA  +   +    L++  C
Sbjct:  569 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSSCAPVASPKTNGLTKEVSGLQISPNTDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSSTAEEQEENFEFIIVSLTSQSWHFEATSYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQNEALALQSIRNLPGNSHCVDCDAQNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPELIKVMSAIGNELANSVWEGSSQGHV--KPCSESPREEKERWIRAKYEQKLFLSPLPCRDLPLGQQLLRATAEEDLRAVILLLAHGSREEVNETCGEGDRRTSLHLACRKGNVVLVQLLIWYGVDVMARDFHGNTALAYAKQAVTSEVRELLLQYGC 1004          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Match: AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 [Source:NCBI gene;Acc:100496997])

HSP 1 Score: 300.056 bits (767), Expect = 6.634e-82
Identity = 172/456 (37.72%), Postives = 256/456 (56.14%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG--VPYRNSC---------LXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            +G G GR +P+KQ++L K+S N +NK+ K +KYVTLT +  L Y+P++NDY++   GKE+DL  T++K+PG   P   S          L     ++P      N  Q  KSK   S   +I    S+    SS    + K+   ++    + + +    ++++ E   FI++ +  + WHF+  S EERD WV  IES IL  LQ                 S+     ++    A+A   IR+  GN  C DCG+P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E   V+ +IGN +ANS+WE + H  +  KP  DSSR ++E+W+R+KYE+++FL PL     P+ +QL  A+  ++   V+L LA + ++ +N    D+D RTA+H+A  LG +V  QLL+WY  +    D+ G  A FYA  S   +C   L+++ C
Sbjct: 1553 DGAGGGRALPIKQSFLMKRSGNSLNKEWK-KKYVTLTSNGVLLYHPSINDYLHSTHGKEMDLLRTTVKVPGKRPPIAMSACGPSNSINGLLKDVGSSPGGDTASNKAQSTKSK---STGDVISSPTSNKDPPSSPMSDKKKNRRKKNMTPSKTEGSAGQADEENFE---FIIVSSTGQTWHFETSSFEERDSWVQAIESQILASLQCC--------------ESSKNKARMDSQSEAVAIQAIRNAKGNSFCVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPLELTLVLTSIGNEMANSIWEMTTHGRT--KPAPDSSREERESWIRAKYEQRLFLAPLKSPGVPLVKQLFKAVHEKNLGNVLLLLAHSNKEQINGITGDRDRRTALHVACELGEVVTTQLLVWYGIDVKSRDSNGHTAVFYAKKSNSQECVDILLQHGC 1985          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 292.352 bits (747), Expect = 2.748e-81
Identity = 182/455 (40.00%), Postives = 257/455 (56.48%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYR--NSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKP--------HRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R  +SC P     T   T   +  Q++ +  N + +  +    S     S  S SR+     RS             + +N  ++++ + E++EFI++   ++ WHF+A S EERD WV  IES IL  LQ               ++S N +   + +       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN LANSVWE S       KP ++S R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A   +D R VIL LA  + + VN    + D RT++H+A   GN+V +QLL+WY  +    D  G  A  YA  +   +    L++  C
Sbjct:  569 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSSCAPVASPKTNGLTKEVSGLQISPNTGNVTSSTSVTQMASGPSGISLGSFSRMDGMHQRSYSVSSADQWSEGAVIANSAISSEQE-ENFEFIIVSLTSQSWHFEATSYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQNEALALQSIRNLPGNSHCVDCDAQNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPELIKVMSAIGNELANSVWEGSSQGHV--KPCSESPREEKERWIRAKYEQKLFLSPLPCRDLPLGQQLLRATAEEDLRAVILLLAHGSREEVNETCGEGDRRTSLHLACRKGNVVLVQLLIWYGVDVMARDFHGNTALAYAKQAVTSEVRELLLQYGC 1006          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Match: stmn4 (stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072])

HSP 1 Score: 278.485 bits (711), Expect = 2.008e-77
Identity = 181/483 (37.47%), Postives = 249/483 (51.55%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSI--------------------KIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVR------------SKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++                    K  G+    S L  +P+     + F  M  M +   + S A     G     +  S+  +    S+               K HRR KS           T ++  E++EFI++   ++ WHF+A S EERD WV  IES IL  LQ               ++S N +   + +       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN LANSVWE S       KP    S  +KE W+R+KYE+K+FL PLP  D P+ QQL+ A   +D R VIL LA  + + VN    + D RT++H+A   GN+V +QLL+WY  +    D  G  A  YA  +   +    L++  C
Sbjct:  414 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSSCAPVASPKTNGLTKEVSGLQISPNTGVWFSSFSRMDGMHQRSYSVSSADQWSEGAVIANSAISSGKNPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSSTAEEQEENFEFIIVSLTSQSWHFEATSYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQNEALALQSIRNLPGNSHCVDCDAQNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPELIKVMSAIGNELANSVWEGSSQGHV--KP---CSEKEKERWIRAKYEQKLFLSPLPCRDLPLGQQLLRATAEEDLRAVILLLAHGSREEVNETCGEGDRRTSLHLACRKGNVVLVQLLIWYGVDVMARDFHGNTALAYAKQAVTSEVRELLLQYGC 877          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Match: Agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:2653690])

HSP 1 Score: 297.36 bits (760), Expect = 8.120e-85
Identity = 179/452 (39.60%), Postives = 248/452 (54.87%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  S+       ++M  +  S  + +          S+ + +S             K HRR KS           T ++  E+ EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE      +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + QQL+ A   +D R VIL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLAKDMSSLHISPNSDTGLGDSVCSSPSISSSTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPMELIKVMSSIGNELANSVWEEGSQGRT--KPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLRATAEEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGC 773          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Match: Agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:2653690])

HSP 1 Score: 297.745 bits (761), Expect = 3.987e-83
Identity = 179/452 (39.60%), Postives = 248/452 (54.87%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R +   +  S+       ++M  +  S  + +          S+ + +S             K HRR KS           T ++  E+ EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE      +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + QQL+ A   +D R VIL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  590 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLAKDMSSLHISPNSDTGLGDSVCSSPSISSSTSPKLDPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPMELIKVMSSIGNELANSVWEEGSQGRT--KPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLRATAEEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGC 1025          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 247.284 bits (630), Expect = 3.435e-71
Identity = 120/290 (41.38%), Postives = 177/290 (61.03%), Query Frame = 3
Query: 3084 ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            ES+EF+++    + WHF+A + EER+ WV  +++ IL  LQ                ++ +     N +       +R++ GN +C DC +P+P WASLNLG  +CIECSG+HR LG HLSRVRS  LD+W  E +AVM A+GN LANSVWE ++   S  KP  ++ R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A+   D R +++ LA  +++ VN  Y D D RTA+H+++ + N+V+ QLL+WY  +    D  G     YA  +G  +CA  LI++ C
Sbjct:  139 ESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ-------------GCRSAKDKTRLGNQNTALAVQAVRTVRGNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDGYS--KPGPEACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGC 413          

HSP 2 Score: 84.3445 bits (207), Expect = 3.013e-16
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            ++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:   31 VDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 101          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Match: Agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:MGI Symbol;Acc:MGI:2653690])

HSP 1 Score: 241.121 bits (614), Expect = 1.568e-65
Identity = 135/315 (42.86%), Postives = 177/315 (56.19%), Query Frame = 3
Query: 3030 KPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS           T ++  E+ EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE      +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + QQL+ A   +D R VIL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  527 KKHRRKKSTSNFKADGLSGTAEEQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPMELIKVMSSIGNELANSVWEEGSQGRT--KPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLRATAEEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGC 826          

HSP 2 Score: 83.1889 bits (204), Expect = 1.968e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Match: Agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:MGI Symbol;Acc:MGI:2183446])

HSP 1 Score: 238.81 bits (608), Expect = 1.941e-64
Identity = 116/285 (40.70%), Postives = 172/285 (60.35%), Query Frame = 3
Query: 3099 ILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            +++    + WHF+A + EER+ WV  +++ IL  LQ                ++ +     N +       +R++ GN +C DC +P+P WASLNLG  +CIECSG+HR LG HLSRVRS  LD+W  E +AVM A+GN LANSVWE ++   S  KP  ++ R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A+   D R +++ LA  +++ VN  Y D D RTA+H+++ + N+V+ QLL+WY  +    D  G     YA  +G  +CA  LI++ C
Sbjct:  609 VVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ-------------GCRSAKDKTRLGNQNTALAVQAVRTVRGNSLCIDCEAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALDGYS--KPGPEACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGC 878          

HSP 2 Score: 84.3445 bits (207), Expect = 7.770e-16
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            ++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:  393 VDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 463          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q96P47|AGAP3_HUMAN (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=AGAP3 PE=1 SV=2)

HSP 1 Score: 255.758 bits (652), Expect = 2.119e-69
Identity = 131/316 (41.46%), Postives = 185/316 (58.54%), Query Frame = 3
Query: 3030 KPHRRMKSN-------PKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS        P    ++  ES+EF+++    + WHF+A + EER+ WV  +++ IL  LQ                 S      L     A+A   +R++ GN  C DC +P+P WASLNLG  +CIECSG+HR LG HLSRVRS  LD+W  E +AVM A+GN LANSVWE ++   S  KP  D+ R +KE W+R+KYE+K+FL PLP  D P+ QQL+ A+   D R +++ LA  +++ VN  Y D D RTA+H+++ + N+V+ QLL+WY  +    D  G     YA  +G  +CA  LI++ C
Sbjct:  544 KKHRRKKSTGTPRPDGPSSATEEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQ--------------GCRSAKDKTRLGNQNAALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLDDWPPELLAVMTAMGNALANSVWEGALGGYS--KPGPDACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQLLIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGC 843          

HSP 2 Score: 84.3445 bits (207), Expect = 5.812e-15
Identity = 36/72 (50.00%), Postives = 54/72 (75.00%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            ++ IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  + GKE+DL  T++K+PG
Sbjct:  358 VDSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPG 428          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q99490|AGAP2_HUMAN (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2)

HSP 1 Score: 248.825 bits (634), Expect = 8.105e-66
Identity = 126/291 (43.30%), Postives = 175/291 (60.14%), Query Frame = 3
Query: 3084 ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDA-VNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            E++EF+++ +  + WHF+A S EERD WV  IES IL  LQ    +    + DS ++              A+A   IR+  GN +C DCG+P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W +E   V+ AIGN  AN VWE+     +  KP  DSSR ++E+W+R+KYE+ +FL PL   + P+ +QL  A+  QD   V+L LA A    ++    D   R+ +H+AA L ++V  QLLLWY  +    D +GR A FYA  +G   CA  L+++ C
Sbjct:  874 ENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSKVKLRTDSQSE--------------AVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRA--KPSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCADILLQHGC 1148          

HSP 2 Score: 80.8777 bits (198), Expect = 7.129e-14
Identity = 35/68 (51.47%), Postives = 53/68 (77.94%), Query Frame = 3
Query: 2631 GSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            GSGR IP+KQ++L K+S N +NK+ K +KYVTL+ +  L Y+P++NDY++   GKE+DL  T++K+PG
Sbjct:  671 GSGRAIPIKQSFLLKRSGNSLNKEWK-KKYVTLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPG 737          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q8BXK8|AGAP1_MOUSE (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Agap1 PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.097e-64
Identity = 135/315 (42.86%), Postives = 177/315 (56.19%), Query Frame = 3
Query: 3030 KPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS           T ++  E+ EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE      +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + QQL+ A   +D R VIL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  527 KKHRRKKSTSNFKADGLSGTAEEQEENLEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPMELIKVMSSIGNELANSVWEEGSQGRT--KPSLDSTREEKERWIRAKYEQKLFLAPLPCTEFSLGQQLLRATAEEDLRTVILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDVLLQYGC 826          

HSP 2 Score: 83.1889 bits (204), Expect = 1.376e-14
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q6NRL1|AGAP1_XENLA (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=agap1 PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.261e-64
Identity = 137/315 (43.49%), Postives = 182/315 (57.78%), Query Frame = 3
Query: 3030 KPHRRMKS--NPKV-----TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS  N KV     T ++  E++EFI++   ++ WHF+A S EERD WV  IES IL  LQ               ++S N +   + +       IR++ GN  C DC +  P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN LANSVWE S       KP ++S R +KE W+R+KYE+++FL PLP  D P+ QQL+ A   +D R VIL LA  + + VN    + D RT++H+A   GN+V +QLL+WY  +    D  G  A  YA  +   +    L++  C
Sbjct:  530 KKHRRKKSTSNFKVDGLSSTAEEQEENFEFIIVSLTSQSWHFEATSYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQNEALALQSIRNLPGNSHCVDCDAQSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPPELIKVMSAIGNELANSVWEGSSQGHV--KPCSESPREEKERWIRAKYEQRLFLSPLPCRDLPLGQQLLRATAEEDLRAVILLLAHGSREEVNETCGEGDRRTSLHLACRKGNVVLVQLLIWYGVDVMARDFHGNTALAYAKQAVTSEVRELLLQYGC 829          

HSP 2 Score: 83.9593 bits (206), Expect = 7.629e-15
Identity = 37/71 (52.11%), Postives = 54/71 (76.06%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL+++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLSDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Match: sp|Q9UPQ3|AGAP1_HUMAN (Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4)

HSP 1 Score: 240.736 bits (613), Expect = 1.497e-64
Identity = 134/315 (42.54%), Postives = 177/315 (56.19%), Query Frame = 3
Query: 3030 KPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS           T ++  E++EFI++    + WHF+A + EERD WV  IES IL  LQ               ++S N +   + S       IR++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM +IGN LANSVWE S    +  KP  DS+R +KE W+R+KYE+K+FL PLP  +  + Q L+ A   +D R  IL LA  + D VN    + D RTA+H+A   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C
Sbjct:  527 KKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQ-------------SCESSKNKSRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRT--KPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGC 826          

HSP 2 Score: 83.1889 bits (204), Expect = 1.264e-14
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Match: G7YDH8 (Arf-GAP GTPase ANK repeat and PH domain-containing protein 1/2/3 OS=Clonorchis sinensis OX=79923 GN=CLF_105407 PE=4 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 1.980e-138
Identity = 249/478 (52.09%), Postives = 315/478 (65.90%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPK--VTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQ-----------------------VSPQN---GFXXXXXXXXXXXXXXXXXXXXXXGAIANLI---RSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEAS--VHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            +NGIGSGR IP+KQ +L+K+SS  + K+ K +KYVTLT+DA+LTY+P+++DYM+   GKE+DL  T++KIPGV +R                    Q    S   S+QA  I      V + + ++ S ++D++   K HRR++SNPK  V + +D E YEF LI  D RQWHF+A   EERDDWVM IE  I+ +LQ                       VS  N   G     D+ +  S       +  +    +LI   RS+AGN+ C DCG+ DP WASLNLG  VCI CSG+HRQLGTH+SRVRS  LDEWS E  AVM AIGNTLANSVWEA+  V+A + KKPE +SSR +KE W+R+KY+++ FLPPLPY DAP+QQQLIDAI RQDTRQV+LCLALA  + VNA YS QDPR AIHIAATLGN+VYLQLLLWYNG+P VTD+EGRNA +YA+ S + DCA FL ++ C
Sbjct:  153 LNGIGSGRAIPLKQGFLYKRSSKPLGKEWKTKKYVTLTDDARLTYHPSIHDYMDNTHGKEIDLSRTTVKIPGVAFRQ------VGGRITSNGLLRSQLSEPSSGVSNQAGKISSSTDMVPSANDSASSGLRDATSVKKRHRRIRSNPKSSVGDAEDSEGYEFQLISMD-RQWHFEAKGPEERDDWVMFIERAIMTRLQLNESTKRTRAMNNSGSASSNTGLVSTSNLTGGVHSGGDNTSLTSGRSGAGDSSELATTEHLIESIRSVAGNQYCADCGACDPDWASLNLGAMVCISCSGIHRQLGTHISRVRSLHLDEWSSESAAVMCAIGNTLANSVWEAAVPVNAGNRKKPEPNSSREEKEIWIRAKYDRQEFLPPLPYPDAPLQQQLIDAIARQDTRQVVLCLALATPETVNAPYSRQDPRAAIHIAATLGNLVYLQLLLWYNGDPTVTDHEGRNAYYYAHCSQKYDCAEFLRRSGC 623          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Match: A0A4Z2DNS7 (Centaurin-gamma-1A isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010594 PE=4 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 1.082e-134
Identity = 257/524 (49.05%), Postives = 330/524 (62.98%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKVTNDD--DLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLIL--LQLQVSPQ----------------------NGFXXXXXXXXXXXXXXXXXXXXXXGAIANL----------IRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEAS--VHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAE-DAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSI 4073
            +NGIGSGR IP+KQ +L+K++   ++K+ K +KYVTLT+DA+LTY+P+++DYM+   GKE+DL  T++KIPGV +R        S        +N    A S   S+   +     +S     +        SSV+ K HRR+KSNPK  N D  D E YEF LI  D RQWHF+A   +ERD+WVM IE  I+  LQL  S +                      +G +   +S +  +++ + N +      AN           IRS AGN+ C DCG+P+P WASLNLG  VCI CSG+HRQLGTH+SR+RS  LDEWS E +AVM AIGNTLANSVWEA+  V+A + +KP+  SSR +KE W+R+KYE++ FLPPLPY DAP+QQQLIDAI RQDTRQVILCLALA  + VNA YS QDPR A+HIAATLGN+VYLQLLLWYNG+P VTD+EGRNA +YA+ S + DCA FL++N C     P +     + +  LRS     T N  QQ     HSI
Sbjct:  309 LNGIGSGRAIPLKQGFLYKRTCKPLSKEWKTKKYVTLTDDARLTYHPSIHDYMDNTHGKEIDLSRTTVKIPGVAFRQ-----VGSRITSNGLLRNQLNEAGSDRRSTGIDVKNSAENSAPPNDNPGSGGKDSSSVK-KRHRRIKSNPKGNNADGSDSEGYEFQLISMD-RQWHFEASGPDERDEWVMHIERAIMTRLQLNESSKRTRAIATGCLAGIGGPNHLTNISGLVSGGNSRHGAADSNSLNSSRCGAGDANELAVTEHLIQNIRSAAGNDFCADCGAPEPDWASLNLGAMVCISCSGIHRQLGTHISRIRSLHLDEWSTESVAVMVAIGNTLANSVWEAAVPVNAGNRRKPDPSSSREEKEIWIRAKYERQEFLPPLPYPDAPLQQQLIDAIARQDTRQVILCLALATPETVNAAYSRQDPRAAMHIAATLGNLVYLQLLLWYNGDPTVTDHEGRNAFYYAHCSQKYDCADFLLRNGCPKQLVPPIPSSTNNVAPTLRS-----TQNMSQQQIVQSHSI 820          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Match: A0A4Z2DP14 (Centaurin-gamma-1A isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_010594 PE=4 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 3.257e-134
Identity = 257/524 (49.05%), Postives = 330/524 (62.98%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKVTNDD--DLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLIL--LQLQVSPQ----------------------NGFXXXXXXXXXXXXXXXXXXXXXXGAIANL----------IRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEAS--VHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAE-DAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSI 4073
            +NGIGSGR IP+KQ +L+K++   ++K+ K +KYVTLT+DA+LTY+P+++DYM+   GKE+DL  T++KIPGV +R        S        +N    A S   S+   +     +S     +        SSV+ K HRR+KSNPK  N D  D E YEF LI  D RQWHF+A   +ERD+WVM IE  I+  LQL  S +                      +G +   +S +  +++ + N +      AN           IRS AGN+ C DCG+P+P WASLNLG  VCI CSG+HRQLGTH+SR+RS  LDEWS E +AVM AIGNTLANSVWEA+  V+A + +KP+  SSR +KE W+R+KYE++ FLPPLPY DAP+QQQLIDAI RQDTRQVILCLALA  + VNA YS QDPR A+HIAATLGN+VYLQLLLWYNG+P VTD+EGRNA +YA+ S + DCA FL++N C     P +     + +  LRS     T N  QQ     HSI
Sbjct:  381 LNGIGSGRAIPLKQGFLYKRTCKPLSKEWKTKKYVTLTDDARLTYHPSIHDYMDNTHGKEIDLSRTTVKIPGVAFRQ-----VGSRITSNGLLRNQLNEAGSDRRSTGIDVKNSAENSAPPNDNPGSGGKDSSSVK-KRHRRIKSNPKGNNADGSDSEGYEFQLISMD-RQWHFEASGPDERDEWVMHIERAIMTRLQLNESSKRTRAIATGCLAGIGGPNHLTNISGLVSGGNSRHGAADSNSLNSSRCGAGDANELAVTEHLIQNIRSAAGNDFCADCGAPEPDWASLNLGAMVCISCSGIHRQLGTHISRIRSLHLDEWSTESVAVMVAIGNTLANSVWEAAVPVNAGNRRKPDPSSSREEKEIWIRAKYERQEFLPPLPYPDAPLQQQLIDAIARQDTRQVILCLALATPETVNAAYSRQDPRAAMHIAATLGNLVYLQLLLWYNGDPTVTDHEGRNAFYYAHCSQKYDCADFLLRNGCPKQLVPPIPSSTNNVAPTLRS-----TQNMSQQQIVQSHSI 892          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Match: A0A4S2LHF1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007253 PE=4 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 3.394e-134
Identity = 248/478 (51.88%), Postives = 316/478 (66.11%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPK--VTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQ-----------------------VSPQN---GFXXXXXXXXXXXXXXXXXXXXXXGAIANLI---RSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEAS--VHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAE-DAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            +NGIGSGR IP+KQ +L+K+SS  + K+ K +KYVTLT+DA+LTY+P+++DYM+   GKE+DL  T++KIPGV +R                  +   +    + S+QA  I     +V + + +  S ++DS+   K HRR++SNPK  V + +D E YEF LI  D RQWHF+A   EERDDWVM IE  I+ +LQ                       VS  N   G     D+ +  S       +  +    +LI   RS+AGN+ C DCG+ DP WASLNLG  VCI CSG+HRQLGTH+SRVRS  LDEWS E  AVM AIGNTLANSVWEA+  V+A + KKPE +SSR +KE W+R+KY+++ FLPPLPY DAP+QQQLIDAI RQDTRQV+LCLALA  + VNA YS QDPR AIHIAATLGN+VYLQLLLWYNG+P VTD+EGRNA +YA+ S + DCA FL ++ C
Sbjct:  350 LNGIGSGRAIPLKQGFLYKRSSKPLGKEWKTKKYVTLTDDARLTYHPSIHDYMDNTHGKEIDLSRTTVKIPGVAFRQ-----------VGGRITSNGLLRSQLSVSNQAGKISASTDTVPSANDSVSSGVRDSTSVKKRHRRIRSNPKSSVGDAEDSEGYEFQLISMD-RQWHFEAKGPEERDDWVMYIERAIMTRLQLNESTKRTRAMNNSGSASSNTGLVSSSNLTGGVHSGGDNNSLTSGRSGAGDSSELATTEHLIESIRSVAGNQYCADCGACDPDWASLNLGAMVCISCSGIHRQLGTHISRVRSLHLDEWSSESAAVMCAIGNTLANSVWEAAVPVNAGNRKKPEPNSSREEKEIWIRAKYDRQEFLPPLPYPDAPLQQQLIDAIARQDTRQVVLCLALATPETVNAPYSRQDPRAAIHIAATLGNLVYLQLLLWYNGDPTVTDHEGRNAYYYAHCSQKYDCAEFLRRSGC 815          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Match: A0A4Z2DP55 (Centaurin-gamma-1A isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_010594 PE=4 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 3.415e-134
Identity = 257/524 (49.05%), Postives = 330/524 (62.98%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKVTNDD--DLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLIL--LQLQVSPQ----------------------NGFXXXXXXXXXXXXXXXXXXXXXXGAIANL----------IRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEAS--VHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAE-DAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSI 4073
            +NGIGSGR IP+KQ +L+K++   ++K+ K +KYVTLT+DA+LTY+P+++DYM+   GKE+DL  T++KIPGV +R        S        +N    A S   S+   +     +S     +        SSV+ K HRR+KSNPK  N D  D E YEF LI  D RQWHF+A   +ERD+WVM IE  I+  LQL  S +                      +G +   +S +  +++ + N +      AN           IRS AGN+ C DCG+P+P WASLNLG  VCI CSG+HRQLGTH+SR+RS  LDEWS E +AVM AIGNTLANSVWEA+  V+A + +KP+  SSR +KE W+R+KYE++ FLPPLPY DAP+QQQLIDAI RQDTRQVILCLALA  + VNA YS QDPR A+HIAATLGN+VYLQLLLWYNG+P VTD+EGRNA +YA+ S + DCA FL++N C     P +     + +  LRS     T N  QQ     HSI
Sbjct:  381 LNGIGSGRAIPLKQGFLYKRTCKPLSKEWKTKKYVTLTDDARLTYHPSIHDYMDNTHGKEIDLSRTTVKIPGVAFRQ-----VGSRITSNGLLRNQLNEAGSDRRSTGIDVKNSAENSAPPNDNPGSGGKDSSSVK-KRHRRIKSNPKGNNADGSDSEGYEFQLISMD-RQWHFEASGPDERDEWVMHIERAIMTRLQLNESSKRTRAIATGCLAGIGGPNHLTNISGLVSGGNSRHGAADSNSLNSSRCGAGDANELAVTEHLIQNIRSAAGNDFCADCGAPEPDWASLNLGAMVCISCSGIHRQLGTHISRIRSLHLDEWSTESVAVMVAIGNTLANSVWEAAVPVNAGNRRKPDPSSSREEKEIWIRAKYERQEFLPPLPYPDAPLQQQLIDAIARQDTRQVILCLALATPETVNAAYSRQDPRAAMHIAATLGNLVYLQLLLWYNGDPTVTDHEGRNAFYYAHCSQKYDCADFLLRNGCPKQLVPPIPSSTNNVAPTLRS-----TQNMSQQQIVQSHSI 892          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 297.36 bits (760), Expect = 2.487e-82
Identity = 189/462 (40.91%), Postives = 261/462 (56.49%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYR--NSCLXXXXXXXXXXXXFQNMQ--QMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPH---RRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG  P R  ++C    P          N+Q  Q   S ++SS A  +  GIS V   S       +  SV S        + +N  V+ + + E++EFI++    + WHF+A S EERD WV  IES IL  LQ              +  S+   + L     AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K FL  L   D P+ QQL+ A   +D R V++ LA  + D VN    + D RTA+H++   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C    +P+++
Sbjct:  761 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRAISTCAVPGPKTNGLTKDMSNLQLGQAPGSVSSSSSASQMASGISLVSFNSRPDGMHQRSYSVSSADQWSDATVIANSGVSTEQE-ENFEFIIVSLTGQTWHFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLTSQSEAIALQSVRNMRGNSRCVDCEALNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKFFLASLVCTDLPLGQQLLQATAGEDLRSVVVLLAHGSRDEVNETCGEGDGRTALHLSCRKGNVVLTQLLIWYGVDIMARDAHGNTALAYARQANSQECVDILLQYGCPDERYPLIA 1204          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 244.202 bits (622), Expect = 1.329e-66
Identity = 138/325 (42.46%), Postives = 183/325 (56.31%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTND-------DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS      D       +  E++EFI++    + WHF+A S EERD WV  IES IL  LQ              +  S+   + L     AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K FL  L   D P+ QQL+ A   +D R V++ LA  + D VN    + D RTA+H++   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C    +P+++
Sbjct:  527 KKHRRKKSTSNFKADGFSGAAEEQEENFEFIIVSLTGQTWHFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLTSQSEAIALQSVRNMRGNSRCVDCEALNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKFFLASLVCTDLPLGQQLLQATAGEDLRSVVVLLAHGSRDEVNETCGEGDGRTALHLSCRKGNVVLTQLLIWYGVDIMARDAHGNTALAYARQANSQECVDILLQYGCPDERYPLIA 835          

HSP 2 Score: 83.1889 bits (204), Expect = 1.574e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Match: agap1 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [Source:NCBI gene;Acc:103044997])

HSP 1 Score: 246.128 bits (627), Expect = 9.561e-66
Identity = 138/325 (42.46%), Postives = 183/325 (56.31%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTND-------DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS      D       +  E++EFI++    + WHF+A S EERD WV  IES IL  LQ              +  S+   + L     AIA   +R++ GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LDEW  E I VM AIGN LANSVWEA  +A    KP  D+SR ++E W+R+KYE+K FL  L   D P+ QQL+ A   +D R V++ LA  + D VN    + D RTA+H++   GN+V  QLL+WY  +    D  G  A  YA  +   +C   L++  C    +P+++
Sbjct:  950 KKHRRKKSTSNFKADGFSGAAEEQEENFEFIIVSLTGQTWHFEATSYEERDAWVQAIESQILASLQ--------------SCESSKQKSRLTSQSEAIALQSVRNMRGNSRCVDCEALNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDEWPLELIKVMSAIGNELANSVWEA--NAQGRLKPAPDASREERERWIRAKYEQKFFLASLVCTDLPLGQQLLQATAGEDLRSVVVLLAHGSRDEVNETCGEGDGRTALHLSCRKGNVVLTQLLIWYGVDIMARDAHGNTALAYARQANSQECVDILLQYGCPDERYPLIA 1258          

HSP 2 Score: 82.8037 bits (203), Expect = 2.334e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  761 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 830          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:103021555])

HSP 1 Score: 242.276 bits (617), Expect = 1.881e-64
Identity = 136/317 (42.90%), Postives = 184/317 (58.04%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTNDDDL--------ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS   +T  D L        ES+EFI++    + WHF+A + EER+ WV  IES I   LQ              +  S+   + L     A+A   IR++ GN  C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E   VM AIGN +ANSVWE ++   +  KP  DS+R +KE W+R+KYE+K+FL  LP  D P+ QQL+ A+   D R V+L LA   ++ VN  Y D D RTA+H++  + N+V  QLL+WY  +    D  G+    YA  +G  +C   L+++ C
Sbjct:  962 KKHRRKKST-GITKPDGLSAGNEEQEESFEFIIVSLTGQMWHFEASTYEERELWVQAIESQIFASLQ--------------SCESSKNKSRLGSQSDAVAIQSIRNVRGNSFCVDCDAPNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALEGYT--KPGVDSTREEKERWIRAKYEQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGTQECVDILVQHGC 1261          

HSP 2 Score: 83.1889 bits (204), Expect = 1.995e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  770 DSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 839          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:103021555])

HSP 1 Score: 242.276 bits (617), Expect = 1.936e-64
Identity = 136/317 (42.90%), Postives = 184/317 (58.04%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTNDDDL--------ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS   +T  D L        ES+EFI++    + WHF+A + EER+ WV  IES I   LQ              +  S+   + L     A+A   IR++ GN  C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E   VM AIGN +ANSVWE ++   +  KP  DS+R +KE W+R+KYE+K+FL  LP  D P+ QQL+ A+   D R V+L LA   ++ VN  Y D D RTA+H++  + N+V  QLL+WY  +    D  G+    YA  +G  +C   L+++ C
Sbjct:  990 KKHRRKKST-GITKPDGLSAGNEEQEESFEFIIVSLTGQMWHFEASTYEERELWVQAIESQIFASLQ--------------SCESSKNKSRLGSQSDAVAIQSIRNVRGNSFCVDCDAPNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPVELSMVMTAIGNAMANSVWEGALEGYT--KPGVDSTREEKERWIRAKYEQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGTQECVDILVQHGC 1289          

HSP 2 Score: 83.1889 bits (204), Expect = 1.944e-15
Identity = 37/71 (52.11%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  798 DSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCDNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 867          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006444.1 (pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 gene:ENSPMAG00000005792.1 transcript:ENSPMAT00000006444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 5.531e-39
Identity = 87/194 (44.85%), Postives = 107/194 (55.15%), Query Frame = 3
Query: 3030 KPHRRMKS--NPKV-----TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSR 3590
            K HRR KS  NP+      + +D+ E +EF+++    + WHF+A   EER+ WV  +ES I   LQ                +S N     + S       IR+I GN  C DC +P P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E  AVM AIGN  AN VWEA      L KP+ DS R
Sbjct:  480 KKHRRKKSTANPRADGPANSAEDNDEPFEFLIVSLTGQSWHFEASCAEERESWVQAVESQIFASLQ-------------SCHSSKNKTRTGSHSDAVTIQSIRNIRGNAFCVDCDAPSPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPLELAAVMLAIGNATANGVWEADTQG--LGKPQPDSPR 658          

HSP 2 Score: 82.8037 bits (203), Expect = 3.305e-16
Identity = 37/69 (53.62%), Postives = 52/69 (75.36%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  292 IGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGILTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 359          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009914.1 (pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1 gene:ENSPMAG00000008958.1 transcript:ENSPMAT00000009914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.443 bits (376), Expect = 1.954e-37
Identity = 76/174 (43.68%), Postives = 100/174 (57.47%), Query Frame = 3
Query: 3069 NDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSR 3590
            ++D  E++EF+L+    + WHF+A S EERD WV  IE  IL  LQ               D+        +      A  IR + GN+VC DCG+P+P WASLNLG  +CIECSG+HR LG+H+SRVRS  LDEW  E   VM ++GN ++  VWE S+   +  KP   SSR
Sbjct:  470 SEDPEETFEFVLVSLSGQTWHFEAPSWEERDAWVQAIEGRILASLQ-------------SCDSRKTKTRLGSQGSAVAAQNIRDVQGNDVCIDCGAPNPDWASLNLGALICIECSGIHRNLGSHVSRVRSLDLDEWPDELAQVMVSVGNAMSRGVWEGSLAGHA--KPGPRSSR 628          

HSP 2 Score: 83.5741 bits (205), Expect = 1.913e-16
Identity = 37/69 (53.62%), Postives = 52/69 (75.36%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            IGSGR IP+KQ +L K+SS+ +NK+ K +KYVTL +   LTY+P++ DYM  V GK +DL  T++K+PG
Sbjct:  264 IGSGREIPIKQGFLMKRSSSSLNKEWK-KKYVTLCDSGTLTYHPSLQDYMQNVHGKAIDLLRTTVKVPG 331          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: acap3b (ArfGAP with coiled-coil, ankyrin repeat and PH domains 3b [Source:ZFIN;Acc:ZDB-GENE-070209-274])

HSP 1 Score: 140.584 bits (353), Expect = 7.200e-36
Identity = 61/114 (53.51%), Postives = 79/114 (69.30%), Query Frame = 3
Query: 3312 IRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLP 3653
            +++I GNE CCDCG PDP WAS+NLGI++CIECSG+HR LG H S+VRS  LD W  E + +M  +GN + N ++EAS      KKP   SSR +KE W+R+KY  + FL P P
Sbjct:   73 VQAIRGNERCCDCGQPDPRWASINLGIALCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNHVINDIYEASADDVGGKKPTPSSSRQEKEMWIRAKYVDRKFLRPFP 186          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002363.1 (pep scaffold:Pmarinus_7.0:GL476468:219091:252970:1 gene:ENSPMAG00000002151.1 transcript:ENSPMAT00000002363.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 4.572e-23
Identity = 65/200 (32.50%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 3363 PCWASLNL---GISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            P W S +L      +CI    V   LG  L RV S  L           + IG     + W   +     + P  +S   +KE W+R+KYE + FL   P  + P+ QQL+ A+   D R  +L LA  + D VN  Y D D R+A+H+A  + N+V  QLL+WY  +    D  G  A  +A  +   +CA  LI++ C
Sbjct:  233 PSWGSRHLPPLSTLLCIAFQVVLHVLGLGL-RVSSLALTSGPVCLRREREEIGQHCRVNAW---LGGDGGRTPAIESIGEEKERWIRTKYESRAFLGAAPACEVPLGQQLLRAVVEDDLRTAVLLLAHGSRDDVNDTYGDGDGRSALHLACAMANVVLAQLLIWYGVDVAARDARGHTALVHARRANSAECAELLIQHGC 428          

HSP 2 Score: 68.9366 bits (167), Expect = 3.707e-12
Identity = 29/62 (46.77%), Postives = 45/62 (72.58%), Query Frame = 3
Query: 2649 PVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            P+ +  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:    1 PISKGVLLKRSGKSLNKEWK-KKYVTLCDNGILTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 61          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Match: smap1 (small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2])

HSP 1 Score: 102.834 bits (255), Expect = 6.934e-23
Identity = 46/104 (44.23%), Postives = 70/104 (67.31%), Query Frame = 3
Query: 3330 NEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFL 3641
            N+ C DC +  P WAS NLG+ VCI C+G+HR LG H+SRV+S  LD+W+ E I  +Q +GN  A  ++EA++   S ++P++D +    E ++R KYEKK ++
Sbjct:   30 NKYCADCEAKGPRWASWNLGVFVCIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQNIQEMGNRKARRLYEANL-PDSFRRPQSDHAV---EIFIREKYEKKKYM 129          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Match: AGE2 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in Trans-Golgi-Network (TGN) transport; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000001306])

HSP 1 Score: 88.1965 bits (217), Expect = 3.292e-19
Identity = 48/125 (38.40%), Postives = 80/125 (64.00%), Query Frame = 3
Query: 3297 AIANLIRSIAGNEVCCDCGSP-DPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEH-IAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDA 3665
            A++ L+R   GN  C DC +   P WAS +LG+ +CI+C+G+HR LGTH+S+V+S  LD W +EH + ++Q   N  ANS +EA++ A  LK+ +   + S  + ++++KYE K ++  L  ++ 
Sbjct:   10 ALSALLRD-PGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATL-ADELKQRKITDT-SSLQNFIKNKYEYKKWIGDLSSIEG 131          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Match: GCS1 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; required for prospore membrane formation; regulates phospholipase Spo14p; shares functional similarity with Glo3p; GCS1 has a paralog, SPS18, that arose from the whole genome duplication [Source:SGD;Acc:S000002385])

HSP 1 Score: 78.1814 bits (191), Expect = 1.610e-15
Identity = 29/68 (42.65%), Postives = 45/68 (66.18%), Query Frame = 3
Query: 3312 IRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGN 3515
            ++ I  N+ C DCG+P+P WA+   G  +C+EC+G+HR LG H+S VRS  +D++  E +  M+  GN
Sbjct:   17 LQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEELLRMEKGGN 84          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Match: AGE1 (ADP-ribosylation factor (ARF) GTPase activating protein (GAP) effector; involved in the secretory and endocytic pathways; contains C2C2H2 cysteine/histidine motif [Source:SGD;Acc:S000002932])

HSP 1 Score: 77.0258 bits (188), Expect = 8.486e-15
Identity = 44/118 (37.29%), Postives = 75/118 (63.56%), Query Frame = 3
Query: 3300 IANLIRSI-AGNEVCCDCGSPDPC-WASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEW-SKEHIAVMQ-AIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFL 3641
            + +++R I   N  CCDCGS     W S+NL   +CI+CSGVHR LG+H+S++RS  LD + S E + ++Q  + N+  N+++E+++    +KK  A+S  S++  ++  KY+ K F+
Sbjct:  172 LLSIVRKIDKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFV 289          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Match: GLO3 (ADP-ribosylation factor GTPase activating protein (ARF GAP); involved in ER-Golgi transport; shares functional similarity with Gcs1p [Source:SGD;Acc:S000000924])

HSP 1 Score: 71.633 bits (174), Expect = 3.616e-13
Identity = 27/69 (39.13%), Postives = 43/69 (62.32%), Query Frame = 3
Query: 3330 NEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVW 3536
            N VC DCG+ +P W S+  G+ +CI+CS VHR +G H++ V+S  LD+W+  ++   +  GN  A   +
Sbjct:   28 NRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNMGVHITFVKSSTLDKWTINNLRRFKLGGNHKARDFF 96          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Match: GTS1 (Protein involved in Arf3p regulation and in transcription regulation; localizes to the nucleus and to endocytic patches; contains an N-terminal Zn-finger and ArfGAP homology domain, a C-terminal glutamine-rich region, and a UBA (ubiquitin associated) domain; gts1 mutations affect budding, cell size, heat tolerance, sporulation, life span, ultradian rhythms, endocytosis; expression oscillates in a pattern similar to metabolic oscillations [Source:SGD;Acc:S000003149])

HSP 1 Score: 60.077 bits (144), Expect = 1.245e-9
Identity = 34/115 (29.57%), Postives = 59/115 (51.30%), Query Frame = 3
Query: 3300 IANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQ-LGTH----LSRVRSFQLDEWSKEHIAVMQAIGNTLANS-VWEASVHASSLKKP-EADSSRSDKEAWVRSKY 3623
            +  LI S      C +CG+  P W S+NLG+ +C  C+ VHR+  G+      S V+S  +D W++E I  + ++G    N+  W    +  ++  P + D  ++  E ++R KY
Sbjct:   17 LKELINSSENANKCGECGNFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSNVKSLSMDRWTREDIDELVSLGGNKGNARFW----NPKNVPFPFDGDDDKAIVEHYIRDKY 127          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO42956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S052])

HSP 1 Score: 254.603 bits (649), Expect = 5.235e-71
Identity = 139/316 (43.99%), Postives = 189/316 (59.81%), Query Frame = 3
Query: 3024 RSKPHRRMKSNP---KVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAE-DAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPM 3959
            R+K HRR+KS     K   D +   YEF +I  + + W ++AG  EERD WV  IE  IL  LQ S  +G             +   + N + G     IR+I GN +C DCG+P+P WASLNLG  +CIECSGVHR +GTH+SRVRS  LD+W  E  AVM +IGN+LANS+WE  +   + +KP   SSR +KE W+RSKYE K FL  LP  D  + +QL +A+ ++D    IL LA    D VNA   D +  TA+H+++ LGNIV  QLL+WY  +  + D +GR+A ++A  SG  +C+  L  N C+ +
Sbjct:  467 RNKGHRRVKSGGGGGKFDTDTESLEYEFTIISLEGKSWQYEAGGAEERDSWVQAIEQQILNSLQ-SNDSG----------REKSRMQSTNSNEGNDIQAIRAIPGNNICVDCGAPNPDWASLNLGALMCIECSGVHRNIGTHVSRVRSLDLDDWPSEVTAVMCSIGNSLANSIWEGRI--GNREKPTPSSSREEKERWIRSKYENKDFLSELPSCDFSLGEQLYEAVDKEDLPLCILLLAYCTPDDVNAVNDDVNRYTALHVSSILGNIVITQLLIWYFADVKILDAKGRSALWHANSSGSKECSDILRHNGCNDL 769          

HSP 2 Score: 88.1965 bits (217), Expect = 1.457e-17
Identity = 40/69 (57.97%), Postives = 54/69 (78.26%), Query Frame = 3
Query: 2628 IGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            +GSGR IP+KQ YL+K+SSN I ++ K +KYVTL +D  L YYPNM+DYM+ V  K ++LK T++KIPG
Sbjct:  267 VGSGRAIPIKQGYLYKRSSNSIKQEWK-KKYVTLLDDGSLVYYPNMHDYMDDVHAKVLNLKHTTVKIPG 334          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO37809 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEL6])

HSP 1 Score: 136.732 bits (343), Expect = 1.390e-33
Identity = 59/109 (54.13%), Postives = 79/109 (72.48%), Query Frame = 3
Query: 3297 AIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKY 3623
            +I   +RS+ GNEVC DC   DP WAS+NLG+ +CIECSG+HR LG H+S+VRS  LD W  EH+ +M  +GN+L NS++EA + A   KK    S+RSD+EAW++SKY
Sbjct:  406 SILEAVRSVPGNEVCADCNHNDPKWASINLGVVLCIECSGIHRSLGVHVSKVRSLTLDAWEPEHLKLMSELGNSLINSIYEAKI-AGDHKKINHLSNRSDREAWIKSKY 513          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO43007 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZU7])

HSP 1 Score: 127.872 bits (320), Expect = 5.895e-30
Identity = 58/130 (44.62%), Postives = 87/130 (66.92%), Query Frame = 3
Query: 3303 ANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPY--LDAPIQQQLI 3686
            A  IR + GN+ C DC +P P WAS+NLGI+VCIECSGVHR +G H+S+VRS  LD+W  + +  M+A+GNT  N ++EA+++     K   DS + D++A+++ KY ++ F  P+P   LD  + + LI
Sbjct:  512 AERIRKVEGNKYCADCSAPRPDWASINLGITVCIECSGVHRSMGVHVSKVRSLTLDKWDGDTVEFMEAMGNTKVNKIFEANLN--DFPKLTRDSGKHDRQAFIKLKYVEQKFYSPIPAEGLDPEVAEALI 639          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO34178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ28])

HSP 1 Score: 116.701 bits (291), Expect = 3.504e-26
Identity = 69/226 (30.53%), Postives = 112/226 (49.56%), Query Frame = 3
Query: 3297 AIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLL--LWYNGN-PDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTH 3965
            +I   ++ + GN+ C DC S DP W S NLG+  CIECSGVHR +G H+SRV+S  LD      + + +AIGN   N + EA++     +KP A+S   +K+ ++ +KY K  +          + Q+L  A+  +D   V+       D            TA+H A    ++  L ++  L  NGN  +V + EG     +A  +G+ + A  L+++  +   H
Sbjct:  416 SIVKQVQRLPGNDTCADCTSKDPTWLSTNLGVLTCIECSGVHRGMGVHVSRVQSITLDNIGTAELLLAKAIGNGGFNEIMEATLDID--QKPTANSKMDEKKEFIHAKYIKHQYAQKSGESPEKVLQELHQAVKSRDILAVLQGFGEGVDLSATLPGSTKWNTALHEAVEQEDLTSLHIVDFLAQNGNDANVVNMEGNTPLHFAGQAGKTEVAKVLLRSGAAESIH 639          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Match: EDO33091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST58])

HSP 1 Score: 102.449 bits (254), Expect = 2.284e-25
Identity = 45/104 (43.27%), Postives = 68/104 (65.38%), Query Frame = 3
Query: 3330 NEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFL 3641
            N+ C DC +  P WAS NLG+ +CI C+G+HR LG H+S+V+S  LD W++E +A +Q+ GN  A   WE  +     ++P+ DS+    EA++R KYE+K F+
Sbjct:   29 NKYCADCAAKGPRWASWNLGVFICIRCAGIHRNLGVHISKVKSVNLDSWTEEQMASIQSWGNRRAGLYWECYL-PEDFRRPQTDSAM---EAFIRKKYEQKKFI 128          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 293.123 bits (749), Expect = 1.619e-83
Identity = 177/467 (37.90%), Postives = 250/467 (53.53%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGV-PYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPH------RRMKSNPKVTND-------DDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG  P R     +   +       + M  +            ++ G+      S +  S          PH      RR KS      D       +  E++EFI++    + WHF+A S EERD WV  IES IL  LQ    +    +  S N+     +             IRSI GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN +ANSVWEA  +A    KP  D++R ++E W+R+KYE+++FL PLP  D  + QQL+ A   +D R V+L LA  +   VN    + D R A+H+A+  GN++  QLL+WY  +    D  G +A  YA  +   +C   L +  C+   HP+++
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPGKRPPRAISTSAAGPSPNANGLSKEMSGLQ-----------LDTGLGDSNCSSPSISSTSPKMEPPPSPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATSYEERDAWVQVIESQILASLQSCESSKIKSRLSSQNEALALQS-------------IRSIRGNGRCADCDTQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPLELIKVMSAIGNEVANSVWEA--NAQGRMKPGPDATREERERWIRAKYEQRLFLEPLPSTDLSLGQQLLRATAEEDQRSVVLLLAHGSRQQVNETCGEGDGRNALHLASGKGNVIIAQLLIWYGVDLMARDACGNSALAYARQANCQECVDILAQYGCTDERHPLVA 777          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 246.128 bits (627), Expect = 3.449e-67
Identity = 135/324 (41.67%), Postives = 184/324 (56.79%), Query Frame = 3
Query: 3030 KPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS           T ++  E++EFI++    + WHF+A S EERD WV  IES IL  LQ    +    +  S N+     +             IRSI GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN +ANSVWEA  +A    KP  D++R ++E W+R+KYE+++FL PLP  D  + QQL+ A   +D R V+L LA  +   VN    + D R A+H+A+  GN++  QLL+WY  +    D  G +A  YA  +   +C   L +  C+   HP+++
Sbjct:  528 KKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATSYEERDAWVQVIESQILASLQSCESSKIKSRLSSQNEALALQS-------------IRSIRGNGRCADCDTQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPLELIKVMSAIGNEVANSVWEA--NAQGRMKPGPDATREERERWIRAKYEQRLFLEPLPSTDLSLGQQLLRATAEEDQRSVVLLLAHGSRQQVNETCGEGDGRNALHLASGKGNVIIAQLLIWYGVDLMARDACGNSALAYARQANCQECVDILAQYGCTDERHPLVA 836          

HSP 2 Score: 81.2629 bits (199), Expect = 6.376e-15
Identity = 36/71 (50.70%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG
Sbjct:  338 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPG 407          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Match: agap1 (arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 [Source:NCBI gene;Acc:101165954])

HSP 1 Score: 245.743 bits (626), Expect = 4.357e-67
Identity = 135/324 (41.67%), Postives = 184/324 (56.79%), Query Frame = 3
Query: 3030 KPHRRMKSNPKV-------TNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLAL-AEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLS 3977
            K HRR KS           T ++  E++EFI++    + WHF+A S EERD WV  IES IL  LQ    +    +  S N+     +             IRSI GN  C DC + +P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD+W  E I VM AIGN +ANSVWEA  +A    KP  D++R ++E W+R+KYE+++FL PLP  D  + QQL+ A   +D R V+L LA  +   VN    + D R A+H+A+  GN++  QLL+WY  +    D  G +A  YA  +   +C   L +  C+   HP+++
Sbjct:  533 KKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATSYEERDAWVQVIESQILASLQSCESSKIKSRLSSQNEALALQS-------------IRSIRGNGRCADCDTQNPDWASLNLGALICIECSGIHRNLGTHLSRVRSLDLDDWPLELIKVMSAIGNEVANSVWEA--NAQGRMKPGPDATREERERWIRAKYEQRLFLEPLPSTDLSLGQQLLRATAEEDQRSVVLLLAHGSRQQVNETCGEGDGRNALHLASGKGNVIIAQLLIWYGVDLMARDACGNSALAYARQANCQECVDILAQYGCTDERHPLVA 841          

HSP 2 Score: 81.2629 bits (199), Expect = 6.622e-15
Identity = 36/71 (50.70%), Postives = 53/71 (74.65%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL ++  LTY+P+++DYM  V GKE++L  T++K+PG
Sbjct:  343 DSIGSGRAIPIKQGMLLKRSGKSLNKEWK-KKYVTLCDNGVLTYHPSLHDYMQNVHGKEINLLRTTVKVPG 412          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101174700])

HSP 1 Score: 229.565 bits (584), Expect = 3.195e-62
Identity = 125/298 (41.95%), Postives = 176/298 (59.06%), Query Frame = 3
Query: 3063 VTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            + N +  +S+EF+++    + W+F+A + EER+ WV  IES I   LQ              +       + L     A+A   IR++ GN  C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD W  E   VM AIGN +ANSVWE ++   +  KP +DS+R +KE W+R+KYE+K+FL  LP  D P+ QQL+ A+   D R V+L LA   ++ VN  Y D D RTA+H++  + N+V  QLL+WY  +    D  G+    YA  +G  +CA  L+++ C
Sbjct:  466 IGNTEQEDSFEFVIVSLTGQTWNFEASTYEERELWVQLIESQIFASLQ--------------SCEVIKNKSRLGSQSDALAIQSIRNVRGNSFCVDCDAPNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDSWPVELSMVMTAIGNAMANSVWEGALEGYA--KPGSDSTREEKERWIRAKYEQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGSQECADILLQHGC 747          

HSP 2 Score: 82.4185 bits (202), Expect = 2.356e-15
Identity = 37/71 (52.11%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL  +  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  365 DSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCSNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 434          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Match: agap3 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [Source:NCBI gene;Acc:101174700])

HSP 1 Score: 233.802 bits (595), Expect = 8.194e-62
Identity = 132/317 (41.64%), Postives = 183/317 (57.73%), Query Frame = 3
Query: 3030 KPHRRMKSNPKVTNDDDL--------ESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIA-NLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALA-EDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSC 3950
            K HRR KS   +T  D +        +S+EF+++    + W+F+A + EER+ WV  IES I   LQ              +       + L     A+A   IR++ GN  C DC +P+P WASLNLG  +CIECSG+HR LGTHLSRVRS  LD W  E   VM AIGN +ANSVWE ++   +  KP +DS+R +KE W+R+KYE+K+FL  LP  D P+ QQL+ A+   D R V+L LA   ++ VN  Y D D RTA+H++  + N+V  QLL+WY  +    D  G+    YA  +G  +CA  L+++ C
Sbjct:  977 KKHRRKKST-GITKPDGVSAGFEEQEDSFEFVIVSLTGQTWNFEASTYEERELWVQLIESQIFASLQ--------------SCEVIKNKSRLGSQSDALAIQSIRNVRGNSFCVDCDAPNPDWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDSWPVELSMVMTAIGNAMANSVWEGALEGYA--KPGSDSTREEKERWIRAKYEQKLFLVGLPQSDVPLGQQLLRAVVEDDLRLVVLLLAHGTKEEVNETYGDGDGRTALHLSCAMANVVITQLLIWYGVDVKSRDARGQTPLSYARRAGSQECADILLQHGC 1276          

HSP 2 Score: 82.0333 bits (201), Expect = 3.888e-15
Identity = 37/71 (52.11%), Postives = 52/71 (73.24%), Query Frame = 3
Query: 2622 NGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPG 2834
            + IGSGR IP+KQ  L K+S   +NK+ K +KYVTL  +  LTY+P+++DYM  V GKE+DL  T++K+PG
Sbjct:  792 DSIGSGRAIPIKQGILLKRSGKSLNKEWK-KKYVTLCSNGLLTYHPSLHDYMQNVHGKEIDLLRTTVKVPG 861          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 853/853 (100.00%), Postives = 853/853 (100.00%), Query Frame = 3
Query:   30 MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFAXXXXXXXXXXXXXXXXXCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 2588
            MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL
Sbjct:    1 MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 853          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 853/853 (100.00%), Postives = 853/853 (100.00%), Query Frame = 3
Query:   30 MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFAXXXXXXXXXXXXXXXXXCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 2588
            MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL
Sbjct:    1 MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 853          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 1735.31 bits (4493), Expect = 0.000e+0
Identity = 851/851 (100.00%), Postives = 851/851 (100.00%), Query Frame = 3
Query:   36 MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFAXXXXXXXXXXXXXXXXXCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 2588
            MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL
Sbjct:    1 MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 851          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 1734.54 bits (4491), Expect = 0.000e+0
Identity = 851/851 (100.00%), Postives = 851/851 (100.00%), Query Frame = 3
Query:   36 MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFAXXXXXXXXXXXXXXXXXCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 2588
            MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL
Sbjct:    1 MGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGVSHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAPGYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKVTKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQRKMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPSIVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNPRFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPLDIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLRTLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNIDNEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTWSAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPVLFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRNATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNTSTKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFALTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINNSSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAMETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQHYL 851          
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Match: SMESG000075717.1 (SMESG000075717.1)

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 574/574 (100.00%), Postives = 574/574 (100.00%), Query Frame = 3
Query: 2619 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLXXXXXXXXXXXXFQNMQQMAKSKANSSQAYLIEHGXXXXXXXXXXXXXXXXXXXVRSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFXXXXXXXXXXXXXXXXXXXXXXGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSIGATLPRRRNNVEPLRFIQKSQMSTXXXXXXXXXXXXXXXXXXPMSGVLNNNNYIDYGSSVFHNNSANGMSGSRGHPTLGAGYTRDTGPI 4340
            INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQAYLIEHGISSVINYSSNSDSRIKDSSVRSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFIQQQDSPNDNSNNINNNLNMSIGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSIGATLPRRRNNVEPLRFIQKSQMSTNNSILNYNNNHVVHENVVPMSGVLNNNNYIDYGSSVFHNNSANGMSGSRGHPTLGAGYTRDTGPI
Sbjct:  482 INGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTLTEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSATPQQTPFQNMQQMAKSKANSSQAYLIEHGISSVINYSSNSDSRIKDSSVRSKPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKIESLILLQLQVSPQNGFIQQQDSPNDNSNNINNNLNMSIGAIANLIRSIAGNEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWSKEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEKKMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDPRTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCALFLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSIGATLPRRRNNVEPLRFIQKSQMSTNNSILNYNNNHVVHENVVPMSGVLNNNNYIDYGSSVFHNNSANGMSGSRGHPTLGAGYTRDTGPI 1055          
The following BLAST results are available for this feature:
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGAP15.735e-8539.38ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP11.815e-8439.38ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP17.260e-8339.38ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP36.765e-7441.46ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
AGAP33.186e-7042.61ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnt-23.659e-5837.66Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-29.301e-5837.66Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-25.107e-5737.66Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-26.313e-5737.66Arf-GAP with ANK repeat and PH domain-containing p... [more]
cnt-21.217e-5637.66Arf-GAP with ANK repeat and PH domain-containing p... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CenG1A4.631e-6643.10gene:FBgn0028509 transcript:FBtr0080548[more]
CenG1A4.580e-6543.10gene:FBgn0028509 transcript:FBtr0080547[more]
CenG1A1.168e-6443.10gene:FBgn0028509 transcript:FBtr0080546[more]
CenB1A2.141e-2949.11gene:FBgn0039056 transcript:FBtr0084369[more]
CenB1A3.229e-2949.11gene:FBgn0039056 transcript:FBtr0084368[more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap12.123e-6341.85ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap12.213e-6341.85ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap12.325e-6341.85ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap31.340e-6243.53ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap27.061e-5438.80ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stmn41.311e-8239.16stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn41.645e-8239.16stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
AGAP26.634e-8237.72ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
stmn42.748e-8140.00stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
stmn42.008e-7737.47stathmin 4 [Source:Xenbase;Acc:XB-GENE-1009072][more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agap18.120e-8539.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap13.987e-8339.60ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap33.435e-7141.38ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap11.568e-6542.86ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
Agap31.941e-6440.70ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96P47|AGAP3_HUMAN2.119e-6941.46Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q99490|AGAP2_HUMAN8.105e-6643.30Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q8BXK8|AGAP1_MOUSE1.097e-6442.86Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q6NRL1|AGAP1_XENLA1.261e-6443.49Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
sp|Q9UPQ3|AGAP1_HUMAN1.497e-6442.54Arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YDH81.980e-13852.09Arf-GAP GTPase ANK repeat and PH domain-containing... [more]
A0A4Z2DNS71.082e-13449.05Centaurin-gamma-1A isoform 2 OS=Schistosoma japoni... [more]
A0A4Z2DP143.257e-13449.05Centaurin-gamma-1A isoform 4 OS=Schistosoma japoni... [more]
A0A4S2LHF13.394e-13451.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2DP553.415e-13449.05Centaurin-gamma-1A isoform 3 OS=Schistosoma japoni... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap12.487e-8240.91ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap11.329e-6642.46ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap19.561e-6642.46ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap31.881e-6442.90ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap31.936e-6442.90ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006444.15.531e-3944.85pep scaffold:Pmarinus_7.0:GL477103:5377:54062:-1 g... [more]
ENSPMAT00000009914.11.954e-3743.68pep scaffold:Pmarinus_7.0:GL476634:533628:626389:1... [more]
acap3b7.200e-3653.51ArfGAP with coiled-coil, ankyrin repeat and PH dom... [more]
ENSPMAT00000002363.14.572e-2332.50pep scaffold:Pmarinus_7.0:GL476468:219091:252970:1... [more]
smap16.934e-2344.23small ArfGAP 1 [Source:ZFIN;Acc:ZDB-GENE-060920-2][more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AGE23.292e-1938.40ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GCS11.610e-1542.65ADP-ribosylation factor GTPase activating protein ... [more]
AGE18.486e-1537.29ADP-ribosylation factor (ARF) GTPase activating pr... [more]
GLO33.616e-1339.13ADP-ribosylation factor GTPase activating protein ... [more]
GTS11.245e-929.57Protein involved in Arf3p regulation and in transc... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429565.235e-7143.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378091.390e-3354.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430075.895e-3044.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341783.504e-2630.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330912.284e-2543.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agap11.619e-8337.90arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap13.449e-6741.67arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap14.357e-6741.67arf-GAP with GTPase, ANK repeat and PH domain-cont... [more]
agap33.195e-6241.95ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
agap38.194e-6241.64ArfGAP with GTPase domain, ankyrin repeat and PH d... [more]
back to top
BLAST of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048961.10.000e+0100.00SMESG000048961.1[more]
SMESG000048961.10.000e+0100.00SMESG000048961.1[more]
SMESG000048961.10.000e+0100.00SMESG000048961.1[more]
SMESG000048961.10.000e+0100.00SMESG000048961.1[more]
SMESG000075717.10.000e+0100.00SMESG000075717.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013633 ID=SMED30013633|Name=Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=4420bp
ATATAAATCTTATATGATAAATGGATTAAATGTCAATGGGTTTCAATATT
CGTTTTATTTACTCAACACTATGGATTAGTTTACTATTTCAAATCCCAAA
GCTAGTCTATTGTATAGATAAAGAGCTGCCTTCATTTGAAGAACTTCCAC
CACCTGTTCAATATTATTCAACCGGTGTTTCTCATATCGAACTCAGGTGT
AAAGTTTGGCCCAATAATGCTGATATTCAGTTTGTTGTCTCGAGCAAAAA
GCAATGGCAAGGAGAAGCCACATCTAGAAGCATTTCCATTAATCCACTAG
ACAAATCGTTTGGCCAGCCAATTGCTCCTGGATATTTGAAAATATCCTCA
GAGCAATTATCTCAAATACATGGCCAAGACATACACTGTTTGGCAGGAAC
AGATTTCGGAAAAATTTTAAGTAGACCATTCCGCGTGGCACACGCAAGCA
TGTCGAATTTTGGTGGAGGGGAAAAAGTTACGAAAAAAGAATTCCTGATA
GGAAATATCGCATACGTTGATTGTATCCCACCAGAAAGCCATCCTAAAGC
AGATGTGAAATTCATATTTAATGATCAGGAGATCAAGGAAGGAGGCAAAT
ACCGCATCGTGCAATGGTCGGAGCAGCGCAAAATGACATTGCTCATCAAG
AATGTCAACCGAAGTGACAGCGGTAAATACCAGTGCCATGCAATTAACCG
GGTTACAAATCAAGTGATAAAGTCACCTGAAGTGATCCAATTGATAATTG
AAAGTCCACAGGAAACCATCAACCCTTCAATTGTAATGCCGATCTCAGGC
CGTTCTAGTGGGCCTCTCCACATCACTGCTCGACCGGGTTCCAATGTCAC
CTTGTTCTGCATCATACGCGGTTCTCCGCCATCATCGATAAAGGTTTACA
GCACCAGTAATCCCTCGTCACAAAATCCGAGATTCAAGCACGACAACAGT
TTCGGCCTCCTTGACATCATCAACGTCCAACAATCAGATGGAGGCAGCTA
TATGTGCTCCGACAATTTCATCTCCAGCACTGCAGTATTCAAGGTCATTG
AGCCACTGAGCATCACTGAAACTCCTCTGGACATTGTCATGGATTCATTC
ACGGGACACGCGACTTTCTCCTGCAAATCCAACAAGCCCAATTCCAGTCC
GACATGGCTGTTTAATGGGCGTCCTATCACAGCTAATTACAATTCTTCTA
CCATTCAAATAACCGAGGTGTCCCTGAGAACACTGGGACTGTATCAGTGC
ATTATTCAAGATCTCGATGAATGGGTCAGTGCAGCTGCAACGCTGTCGAC
AAAGTCATACCGATTGATCTCCAGGCCACCGTTGGAACCCTCCAGTAACA
TCAAGCCACCAATACAGCAAAACATTGATAATGAAGGCAAAATATTTCGT
TCTGTGGAATCCAAAAGAATATTCTATAATTTGGCCGTGTTCCTCAAATG
GTCGCTGAATCCACATGAGTTGGGCGATGTTTCTTATTATGTGGTCGAGA
TCTCACATCGGGTCGATGAGTCGACATGGTCAGCTCCAGTAACACTTCAG
AAACGAATAACTGATAAGTTCATCTATGTTACCGATAAAGTCATTCAACC
ACAGAACAAATATCGGTTCAGAGTTCATGCTTTTTTCAAACTGACGCACA
CCGTCACAAGTATTTGGACGAATCCAGTGTTGTTTATGGATGTCGGAAAT
GAATCTCCGATCATTGAAGAACTGAAACCAGAGGAACCGGATCAAGTGTT
TGTCCGTTGGTCGTATGCCGATTACCACAAATGGCAGGTTAACACATTCC
GAATATTGTATAGACAAGTGTTCCGCAATGCCACTGAGATGTCCAAATAT
AAGTATTCGAAATATCTTCATATTGAGATCAGATATCCTGCAATGAATGT
GACTGTGCAAAAATTGGAACCTGGCGCAACATATCAATTTGTAGTTCTCG
GATTGTATGTTACAGCTGGTACAAACACGAGTACAAAATATAGTGAATCT
CGAATGGTCAGTTTACCGATCAATGTCAAGAAATCAGCGACTTTAACACC
GCAACCATCAGGCGATTGGTTCAAGGGTCTTTGGGATTCATGGAAAAGTA
ATAAAGTTCTATATGGAAGTCTTTTTGCTTTAACTGGACTAATGTTGTTG
ATTATGTTCCTGTTATTGCTGCTCTGCCTGTGTAGACAAAGGAAATTCCG
ATCCACAAAAGGAATGGGATCAACAAACGCATTCCCTTACAATTACAAGG
AAGTCAGCAAAACATCTGCCATTAACAATAGCAGTAGCACGTTACAAATA
CCTGGTCGAATACCACAGCATTCGAACCAATTGGCACTCCAGCAATATCA
ACATAACAATGGTAGCCTCGATCGTAGGAACACCGATACTTCTTCTCAGA
TTTATCGGGCTGGGAGTGTCCAAGCAATGGAAACCGCTAGTTTAGTGACT
GATCTCTATGGAAATAACTATATGCATGGAATGCAGATGAACCACATGCA
GAATCCTTACCAGGGATTCTCTACATTGCAACCGCAAAATTATCCCAGTA
ATCACGGCAGATCTGTGCCTCCATACCAGCATTATCTCCAGCAGCAGCAG
CAACAACAACAACAGCAGATAAACGGTATTGGCAGTGGCAGATTGATTCC
AGTAAAGCAGAACTATTTATTCAAGAAATCCAGTAATCAAATAAATAAAG
ACCGGAAAAACCGGAAATATGTCACGTTAACGGAAGATGCCAAGTTAACA
TATTATCCAAATATGAATGATTACATGAATCAAGTGAGAGGCAAAGAAGT
TGATCTTAAACTTACCTCAATCAAAATTCCAGGTGTTCCATATCGAAACA
GCTGCTTACCATCCACTCCAAGTGCTACTCCCCAACAAACACCTTTTCAA
AATATGCAACAAATGGCCAAATCGAAAGCAAACAGTTCACAAGCTTATCT
CATTGAACACGGAATCTCATCTGTCATTAACTATTCTTCAAATTCCGACT
CTCGCATTAAAGACTCTTCAGTTCGTAGCAAACCACATCGCAGAATGAAA
TCAAATCCCAAAGTGACCAATGATGATGACCTGGAATCATATGAGTTCAT
CCTGATTGGCAATGATACAAGACAGTGGCATTTCGATGCGGGGTCACTTG
AAGAAAGAGATGATTGGGTCATGAAAATCGAATCTCTCATTTTACTTCAA
CTTCAAGTCTCACCACAAAATGGCTTCATCCAACAACAAGATAGTCCCAA
TGACAATTCAAATAATATTAATAATAATCTGAATATGTCTATTGGAGCCA
TAGCTAATCTTATCAGGTCAATAGCCGGTAACGAAGTTTGTTGCGATTGT
GGCAGCCCAGATCCATGTTGGGCTAGTTTGAATCTCGGTATATCTGTGTG
TATTGAATGTAGCGGAGTCCATCGCCAATTAGGTACGCATTTATCTCGGG
TACGGTCATTCCAACTGGATGAGTGGAGCAAGGAGCACATTGCAGTTATG
CAAGCTATCGGCAATACATTGGCTAATTCTGTCTGGGAAGCAAGTGTTCA
TGCCAGTTCATTAAAAAAACCAGAAGCCGATTCATCAAGATCAGATAAAG
AAGCTTGGGTTCGATCTAAATATGAAAAGAAAATGTTTTTACCCCCATTA
CCTTATCTCGACGCTCCTATCCAACAGCAGTTGATTGATGCTATTACCAG
ACAAGACACAAGGCAAGTTATTTTATGCCTGGCATTGGCAGAGGACGCTG
TAAATGCCTGTTACAGCGATCAAGATCCTCGCACTGCAATACACATCGCA
GCAACTTTGGGCAACATTGTCTATCTGCAATTGTTATTATGGTACAATGG
AAATCCCGATGTCACTGATAATGAAGGTCGCAATGCTTCATTCTATGCTT
ACTTTTCCGGGCAAGTGGACTGTGCTTTGTTTCTTATAAAGAATAGCTGT
TCTCCCATGACCCATCCAATGTTATCTCAATGTGAAGAGAGCCCATCTAA
TCAGCTTCGTTCTCAGACCTCTTGTTTGACAATGAACCCTCAACAGCAAA
GTTCACACGTTGGCCATTCTATTGGGGCAACACTTCCTAGACGTCGAAAT
AATGTGGAACCTTTAAGATTTATTCAAAAATCTCAGATGTCTACAAATAA
CTCAATATTGAATTATAACAATAACCACGTAGTCCATGAAAACGTTGTTC
CTATGTCTGGAGTCCTTAACAATAACAACTACATTGATTACGGAAGTTCC
GTATTTCATAATAATAGTGCCAATGGAATGTCTGGGTCTAGAGGCCACCC
TACATTAGGAGCCGGTTATACAAGAGACACCGGTCCAATTTGATATGATT
TTTCTCATTGATAATTTGGCAATACTTTATTATGATTTTCGGTTTGTATA
ATAAATGATTATATGATAAA
back to top

protein sequence of SMED30013633-orf-1

>SMED30013633-orf-1 ID=SMED30013633-orf-1|Name=SMED30013633-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1438bp
MSMGFNIRFIYSTLWISLLFQIPKLVYCIDKELPSFEELPPPVQYYSTGV
SHIELRCKVWPNNADIQFVVSSKKQWQGEATSRSISINPLDKSFGQPIAP
GYLKISSEQLSQIHGQDIHCLAGTDFGKILSRPFRVAHASMSNFGGGEKV
TKKEFLIGNIAYVDCIPPESHPKADVKFIFNDQEIKEGGKYRIVQWSEQR
KMTLLIKNVNRSDSGKYQCHAINRVTNQVIKSPEVIQLIIESPQETINPS
IVMPISGRSSGPLHITARPGSNVTLFCIIRGSPPSSIKVYSTSNPSSQNP
RFKHDNSFGLLDIINVQQSDGGSYMCSDNFISSTAVFKVIEPLSITETPL
DIVMDSFTGHATFSCKSNKPNSSPTWLFNGRPITANYNSSTIQITEVSLR
TLGLYQCIIQDLDEWVSAAATLSTKSYRLISRPPLEPSSNIKPPIQQNID
NEGKIFRSVESKRIFYNLAVFLKWSLNPHELGDVSYYVVEISHRVDESTW
SAPVTLQKRITDKFIYVTDKVIQPQNKYRFRVHAFFKLTHTVTSIWTNPV
LFMDVGNESPIIEELKPEEPDQVFVRWSYADYHKWQVNTFRILYRQVFRN
ATEMSKYKYSKYLHIEIRYPAMNVTVQKLEPGATYQFVVLGLYVTAGTNT
STKYSESRMVSLPINVKKSATLTPQPSGDWFKGLWDSWKSNKVLYGSLFA
LTGLMLLIMFLLLLLCLCRQRKFRSTKGMGSTNAFPYNYKEVSKTSAINN
SSSTLQIPGRIPQHSNQLALQQYQHNNGSLDRRNTDTSSQIYRAGSVQAM
ETASLVTDLYGNNYMHGMQMNHMQNPYQGFSTLQPQNYPSNHGRSVPPYQ
HYLQQQQQQQQQQINGIGSGRLIPVKQNYLFKKSSNQINKDRKNRKYVTL
TEDAKLTYYPNMNDYMNQVRGKEVDLKLTSIKIPGVPYRNSCLPSTPSAT
PQQTPFQNMQQMAKSKANSSQAYLIEHGISSVINYSSNSDSRIKDSSVRS
KPHRRMKSNPKVTNDDDLESYEFILIGNDTRQWHFDAGSLEERDDWVMKI
ESLILLQLQVSPQNGFIQQQDSPNDNSNNINNNLNMSIGAIANLIRSIAG
NEVCCDCGSPDPCWASLNLGISVCIECSGVHRQLGTHLSRVRSFQLDEWS
KEHIAVMQAIGNTLANSVWEASVHASSLKKPEADSSRSDKEAWVRSKYEK
KMFLPPLPYLDAPIQQQLIDAITRQDTRQVILCLALAEDAVNACYSDQDP
RTAIHIAATLGNIVYLQLLLWYNGNPDVTDNEGRNASFYAYFSGQVDCAL
FLIKNSCSPMTHPMLSQCEESPSNQLRSQTSCLTMNPQQQSSHVGHSIGA
TLPRRRNNVEPLRFIQKSQMSTNNSILNYNNNHVVHENVVPMSGVLNNNN
YIDYGSSVFHNNSANGMSGSRGHPTLGAGYTRDTGPI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0046872metal ion binding
GO:0005096GTPase activator activity
GO:0005515protein binding
GO:0005525GTP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR032983CDO
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR001164ArfGAP_dom
IPR001849PH_domain
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR020683Ankyrin_rpt-contain_dom
IPR011993PH-like_dom_sf
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR002110Ankyrin_rpt
IPR003961FN3_dom
Vocabulary: biological process
TermDefinition
GO:0007224smoothened signaling pathway
GO:0045663positive regulation of myoblast differentiation
GO:0045664regulation of neuron differentiation
GO:0048598embryonic morphogenesis
GO:0007264small GTPase mediated signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 156..226
e-value: 0.027
score: 22.2
coord: 356..414
e-value: 0.11
score: 16.2
coord: 268..333
e-value: 0.27
score: 12.6
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 349..425
e-value: 57.0
score: 4.9
coord: 262..340
e-value: 2.2E-4
score: 30.6
coord: 41..241
e-value: 3.7
score: 15.2
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 171..228
e-value: 6.1E-8
score: 32.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 458..553
e-value: 1.4E-5
score: 27.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 151..240
e-value: 2.3E-13
score: 51.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 354..425
e-value: 5.8E-7
score: 31.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 255..339
e-value: 1.7E-9
score: 39.7
NoneNo IPR availablePFAMPF13927Ig_3coord: 264..327
e-value: 3.6E-8
score: 33.9
NoneNo IPR availablePANTHERPTHR44170FAMILY NOT NAMEDcoord: 33..426
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.722
NoneNo IPR availableTMHMMTMhelixcoord: 695..717
IPR032983Cell adhesion molecule-related/down-regulated by oncogenesPANTHERPTHR44170:SF1CELL ADHESION MOLECULE-RELATED/DOWN-REGULATED BY ONCOGENEScoord: 33..426
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 133..237
score: 6.832
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 249..326
score: 9.083
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 342..423
score: 8.793
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 470..641
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 354..428
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 262..346
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 155..228