60S ribosomal protein L7

Overview
Name60S ribosomal protein L7
Smed IDSMED30013606
Length (bp)851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 60S ribosomal protein L7 (SMED30013606) t-SNE clustered cells

Violin plots show distribution of expression levels for 60S ribosomal protein L7 (SMED30013606) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L7 (SMED30013606) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L7 (SMED30013606) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013606

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013606SMESG000022296.1 SmedASXL_009669SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013606SMESG000022296.1 dd_Smed_v4_276_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30013606SMESG000022296.1 dd_Smed_v6_276_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30013606SMESG000022296.1 dd_Smed_v6_276_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013606SMESG000022296.1 dd_Smed_v6_276_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Match: RPL7 (ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:10363])

HSP 1 Score: 250.366 bits (638), Expect = 1.135e-82
Identity = 128/238 (53.78%), Postives = 175/238 (73.53%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +VP  PE+L KK       + KR+ +K A++    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   10 EVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 247          
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Match: RPL7 (ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:10363])

HSP 1 Score: 239.58 bits (610), Expect = 5.182e-79
Identity = 117/203 (57.64%), Postives = 157/203 (77.34%), Query Frame = 1
Query:  214 AKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:    5 ARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 207          
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Match: RPL7 (ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:10363])

HSP 1 Score: 239.58 bits (610), Expect = 5.182e-79
Identity = 117/203 (57.64%), Postives = 157/203 (77.34%), Query Frame = 1
Query:  214 AKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:    5 ARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 207          
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Match: RPL7 (ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:10363])

HSP 1 Score: 239.58 bits (610), Expect = 5.182e-79
Identity = 117/203 (57.64%), Postives = 157/203 (77.34%), Query Frame = 1
Query:  214 AKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:    5 ARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 207          
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Match: RPL7L1 (ribosomal protein L7 like 1 [Source:HGNC Symbol;Acc:HGNC:21370])

HSP 1 Score: 122.865 bits (307), Expect = 4.587e-33
Identity = 82/244 (33.61%), Postives = 137/244 (56.15%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITG------RAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            K+P  PE+L+KK      ++  + ++    ++A LAKK    G      R + +  +  R+K       R         +  +  LAFV+R++ I+ ++   ++ +   RL++I +GVFVK+    L+MLR++EPYV WG+P+ + V++L+ KRG AK+    I + +N +IE+ LGK G++C+EDLIHEI   G HF+E + FL  F L+  R   + +     E G  G R E IN+L+ ++
Sbjct:   17 KIPLVPENLLKK------RKAYQALKATQAKQALLAKKEQKKGKGLRFKRLESFLHDSWRQKRDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLKKIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNKTIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSVARHATKNRVGFLKEMGTPGYRGERINQLIRQL 254          
BLAST of 60S ribosomal protein L7 vs. Ensembl Celegans
Match: rpl-7 (60S ribosomal protein L7 [Source:UniProtKB/Swiss-Prot;Acc:O01802])

HSP 1 Score: 257.299 bits (656), Expect = 6.331e-86
Identity = 132/241 (54.77%), Postives = 173/241 (71.78%), Query Frame = 1
Query:  103 TDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            T KVP+ PE+++K+  +    R K    KV        KK     RA+KY  EY   +       R A+  G+F+V  E K+AFV+R++GIN++ PKP+K +Q+ RLRQINNGVFVKLNKATL +LR+IEPYVAWGYP+ + +  L+YKRG+AK++G+R+ I +N I+EQ LGK  I+C+EDL HEI TVGPHFKEA +FL+ FKLNNP GG+ KK+NHFVEGGDFGNRE+ IN L+ KM 
Sbjct:    4 TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGNRVPITDNTIVEQSLGKFNIICLEDLAHEIATVGPHFKEATNFLWPFKLNNPTGGWTKKTNHFVEGGDFGNREDQINNLLRKMV 244          
BLAST of 60S ribosomal protein L7 vs. Ensembl Celegans
Match: rpl-7 (60S ribosomal protein L7 [Source:UniProtKB/Swiss-Prot;Acc:O01802])

HSP 1 Score: 257.299 bits (656), Expect = 6.331e-86
Identity = 132/241 (54.77%), Postives = 173/241 (71.78%), Query Frame = 1
Query:  103 TDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            T KVP+ PE+++K+  +    R K    KV        KK     RA+KY  EY   +       R A+  G+F+V  E K+AFV+R++GIN++ PKP+K +Q+ RLRQINNGVFVKLNKATL +LR+IEPYVAWGYP+ + +  L+YKRG+AK++G+R+ I +N I+EQ LGK  I+C+EDL HEI TVGPHFKEA +FL+ FKLNNP GG+ KK+NHFVEGGDFGNRE+ IN L+ KM 
Sbjct:    4 TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGNRVPITDNTIVEQSLGKFNIICLEDLAHEIATVGPHFKEATNFLWPFKLNNPTGGWTKKTNHFVEGGDFGNREDQINNLLRKMV 244          
BLAST of 60S ribosomal protein L7 vs. Ensembl Celegans
Match: rpl-7 (60S ribosomal protein L7 [Source:UniProtKB/Swiss-Prot;Acc:O01802])

HSP 1 Score: 257.299 bits (656), Expect = 6.331e-86
Identity = 132/241 (54.77%), Postives = 173/241 (71.78%), Query Frame = 1
Query:  103 TDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            T KVP+ PE+++K+  +    R K    KV        KK     RA+KY  EY   +       R A+  G+F+V  E K+AFV+R++GIN++ PKP+K +Q+ RLRQINNGVFVKLNKATL +LR+IEPYVAWGYP+ + +  L+YKRG+AK++G+R+ I +N I+EQ LGK  I+C+EDL HEI TVGPHFKEA +FL+ FKLNNP GG+ KK+NHFVEGGDFGNRE+ IN L+ KM 
Sbjct:    4 TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGNRVPITDNTIVEQSLGKFNIICLEDLAHEIATVGPHFKEATNFLWPFKLNNPTGGWTKKTNHFVEGGDFGNREDQINNLLRKMV 244          
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Match: RpL7 (gene:FBgn0005593 transcript:FBtr0079946)

HSP 1 Score: 234.187 bits (596), Expect = 1.269e-76
Identity = 126/240 (52.50%), Postives = 170/240 (70.83%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGK-HGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            K+P  PES +K   K  ++R      ++ K      +K     RA+KY  EY + +       R AK    F+V  E KLAFV+R++GINK+APK +KV+QLFRLRQINNGVF+KLNKAT+ MLR+ EPY+ WGYP+ + V++L+YKRGF K N  R+ I +N +IE++L + H I CVEDL+HEI+TVGP+FK A++FL+ FKLN P GG+RKK+NH+V GGDFGNRE+ IN+L+ KM 
Sbjct:   13 KLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKMV 252          
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Match: RpL7 (gene:FBgn0005593 transcript:FBtr0343653)

HSP 1 Score: 234.187 bits (596), Expect = 1.269e-76
Identity = 126/240 (52.50%), Postives = 170/240 (70.83%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGK-HGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            K+P  PES +K   K  ++R      ++ K      +K     RA+KY  EY + +       R AK    F+V  E KLAFV+R++GINK+APK +KV+QLFRLRQINNGVF+KLNKAT+ MLR+ EPY+ WGYP+ + V++L+YKRGF K N  R+ I +N +IE++L + H I CVEDL+HEI+TVGP+FK A++FL+ FKLN P GG+RKK+NH+V GGDFGNRE+ IN+L+ KM 
Sbjct:   13 KLPAVPESKLKFSKKQISKRVAESKRRLKKAAVIALRKKENLVRAEKYQNEYIKAEQREIKLRRLAKKRNQFYVPAEAKLAFVVRIRGINKVAPKVRKVLQLFRLRQINNGVFIKLNKATINMLRIAEPYITWGYPNLKSVRELIYKRGFVKHNRQRVPITDNFVIERKLRQAHQIQCVEDLVHEIFTVGPNFKYASNFLWPFKLNTPTGGWRKKANHYVNGGDFGNREDQINRLLRKMV 252          
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Match: RpL7-like (gene:FBgn0032404 transcript:FBtr0346426)

HSP 1 Score: 126.331 bits (316), Expect = 1.272e-34
Identity = 66/159 (41.51%), Postives = 103/159 (64.78%), Query Frame = 1
Query:  340 PKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKK-SNHFVEGGDFGNREEYINKLV 813
            PKL FV+R  G          + +  R+   +N VF++  K    +LR+IEP+V +G PS   +++LV+K+GFA+I+G +  I +N ++EQQLG  G++C+ED+IHEI TVGP+F   N FL  F L++P  G++KK S  +  GG++G+R   IN+L+
Sbjct:   95 PKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELI 253          
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Match: RpL7-like (gene:FBgn0032404 transcript:FBtr0080296)

HSP 1 Score: 126.331 bits (316), Expect = 1.272e-34
Identity = 66/159 (41.51%), Postives = 103/159 (64.78%), Query Frame = 1
Query:  340 PKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKK-SNHFVEGGDFGNREEYINKLV 813
            PKL FV+R  G          + +  R+   +N VF++  K    +LR+IEP+V +G PS   +++LV+K+GFA+I+G +  I +N ++EQQLG  G++C+ED+IHEI TVGP+F   N FL  F L++P  G++KK S  +  GG++G+R   IN+L+
Sbjct:   95 PKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELI 253          
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Match: RpL7-like (gene:FBgn0032404 transcript:FBtr0113037)

HSP 1 Score: 126.331 bits (316), Expect = 1.272e-34
Identity = 66/159 (41.51%), Postives = 103/159 (64.78%), Query Frame = 1
Query:  340 PKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKK-SNHFVEGGDFGNREEYINKLV 813
            PKL FV+R  G          + +  R+   +N VF++  K    +LR+IEP+V +G PS   +++LV+K+GFA+I+G +  I +N ++EQQLG  G++C+ED+IHEI TVGP+F   N FL  F L++P  G++KK S  +  GG++G+R   IN+L+
Sbjct:   95 PKLLFVMRHAGKKIFDKTTADIFRTLRMGSRHNAVFMENTKENQLLLRVIEPFVVYGNPSLSSIRELVFKKGFARIDGKKTAIQSNTMVEQQLGDKGVICLEDIIHEICTVGPNFAAVNEFLCAFTLSSPSNGWQKKVSVSYKRGGEYGDRGTAINELI 253          
BLAST of 60S ribosomal protein L7 vs. Ensembl Zebrafish
Match: rpl7 (ribosomal protein L7 [Source:ZFIN;Acc:ZDB-GENE-030131-8654])

HSP 1 Score: 245.743 bits (626), Expect = 3.933e-81
Identity = 131/241 (54.36%), Postives = 178/241 (73.86%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            K+P  PESL+K+  +  A R  R+ +  A +KA    + LI  RA+ Y  EY    R ++ ++   R A+  GN++V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NGVFVKLNKA++ MLR+ EPY+AWGYP+ + V++L+YKRGF KI   RI + +N +IE+ LG+ GI+C+EDLIHEIYTVG +FK AN+FL+ FKL++PRGG  KK+ HFVEGGD GNRE+ IN+LV +M
Sbjct:    8 KIPSVPESLLKRRQRFAAIRAVRLKKAKADKKASKVTRKLIFKRAEAYHKEYKQLYRREIRMS---RMARKAGNYYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGFGKIKKQRIALTDNSLIEKTLGQCGIICIEDLIHEIYTVGKNFKAANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLVRRM 245          
BLAST of 60S ribosomal protein L7 vs. Ensembl Zebrafish
Match: rpl7l1 (ribosomal protein L7-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-970])

HSP 1 Score: 142.895 bits (359), Expect = 5.580e-41
Identity = 72/159 (45.28%), Postives = 113/159 (71.07%), Query Frame = 1
Query:  346 LAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            LAF +R++ I  ++PK   V+Q+ RLR+I +G FVK++K ++ ML+ +EPYVAWGYP+ + V++L+ KRG  K++  +I + +N +IEQ LGK+GI+C+EDLIHEIY+ G +F+  N+FL+ F+L+ PR   R K     + G+ G R E IN ++ K+
Sbjct:   88 LAFAVRIREIKGVSPKVMNVIQMLRLRKIFSGTFVKVSKHSINMLKTVEPYVAWGYPNLKSVRELILKRGQGKVDKRKIPLTDNTLIEQHLGKYGIICLEDLIHEIYSAGKNFRVVNNFLWPFRLSVPRHAARDKVGLMKDVGNPGPRAEDINTVIRKL 246          
BLAST of 60S ribosomal protein L7 vs. Ensembl Xenopus
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:448528])

HSP 1 Score: 250.751 bits (639), Expect = 5.775e-83
Identity = 132/241 (54.77%), Postives = 181/241 (75.10%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PESL+K+  +  A + KR+ + VA++K    K+ +I  RA+ Y  EY    R++V L    R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FV+LNKA++ MLRL+EPY+AWGYP+ + V++L+YKRG+ KI   RI + +N +IE+ LGK G++CVEDLIHE+YTVG +FK AN+FL+ FKL++PRGG  KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:    8 KVPSVPESLLKRRKQFAAAKLKRVKKIVAEKKLRKQKRKIIFKRAEGYYKEYRQMYRKEVRLA---RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVRLNKASINMLRLVEPYIAWGYPNLKSVRQLIYKRGYLKIKNQRIPLTDNSLIEKHLGKKGVMCVEDLIHEVYTVGKNFKAANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLIRRM 245          
BLAST of 60S ribosomal protein L7 vs. Ensembl Xenopus
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:448528])

HSP 1 Score: 251.136 bits (640), Expect = 1.025e-82
Identity = 132/241 (54.77%), Postives = 181/241 (75.10%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PESL+K+  +  A + KR+ + VA++K    K+ +I  RA+ Y  EY    R++V L    R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FV+LNKA++ MLRL+EPY+AWGYP+ + V++L+YKRG+ KI   RI + +N +IE+ LGK G++CVEDLIHE+YTVG +FK AN+FL+ FKL++PRGG  KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   29 KVPSVPESLLKRRKQFAAAKLKRVKKIVAEKKLRKQKRKIIFKRAEGYYKEYRQMYRKEVRLA---RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVRLNKASINMLRLVEPYIAWGYPNLKSVRQLIYKRGYLKIKNQRIPLTDNSLIEKHLGKKGVMCVEDLIHEVYTVGKNFKAANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLIRRM 266          
BLAST of 60S ribosomal protein L7 vs. Ensembl Xenopus
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:448528])

HSP 1 Score: 250.751 bits (639), Expect = 1.331e-82
Identity = 132/241 (54.77%), Postives = 181/241 (75.10%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PESL+K+  +  A + KR+ + VA++K    K+ +I  RA+ Y  EY    R++V L    R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FV+LNKA++ MLRL+EPY+AWGYP+ + V++L+YKRG+ KI   RI + +N +IE+ LGK G++CVEDLIHE+YTVG +FK AN+FL+ FKL++PRGG  KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   29 KVPSVPESLLKRRKQFAAAKLKRVKKIVAEKKLRKQKRKIIFKRAEGYYKEYRQMYRKEVRLA---RMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVRLNKASINMLRLVEPYIAWGYPNLKSVRQLIYKRGYLKIKNQRIPLTDNSLIEKHLGKKGVMCVEDLIHEVYTVGKNFKAANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRLIRRM 266          
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Match: Rpl7 (ribosomal protein L7 [Source:MGI Symbol;Acc:MGI:98073])

HSP 1 Score: 249.595 bits (636), Expect = 2.540e-82
Identity = 129/241 (53.53%), Postives = 174/241 (72.20%), Query Frame = 1
Query:  100 MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +  KVP  PE+L KK       + KR+ +K A +    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   29 LKKKVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 269          
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Match: Rpl7 (ribosomal protein L7 [Source:MGI Symbol;Acc:MGI:98073])

HSP 1 Score: 229.18 bits (583), Expect = 3.559e-74
Identity = 120/225 (53.33%), Postives = 161/225 (71.56%), Query Frame = 1
Query:  100 MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGG 774
            +  KVP  PE+L KK       + KR+ +K A +    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGG
Sbjct:   55 LKKKVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLIARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGG 279          
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Match: Rpl7l1 (ribosomal protein L7-like 1 [Source:MGI Symbol;Acc:MGI:1913479])

HSP 1 Score: 119.398 bits (298), Expect = 5.544e-32
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 1
Query:  346 LAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            LAFVIR++ I  ++   K  +    L+++ +GVFVK+   +++MLR +EPYV WG+P+ + V++L+ KRG AKIN   + + +N +IE+ LG+ G++C+EDLIHEI   G HF+E +SFL  F L+  R   R +     E G  G R + IN+L+ ++
Sbjct:   87 LAFVIRMERIEGVSLLVKSTIMKLGLKKLFSGVFVKVTPQSVRMLRTVEPYVTWGFPNLKSVRELILKRGQAKINNKTVPLTDNTVIEEHLGRFGVICLEDLIHEIAFPGKHFQEVSSFLCPFLLSVARHATRNRVGFRKEMGSPGYRGDRINQLIRQL 245          
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Match: Rpl7l1 (ribosomal protein L7-like 1 [Source:MGI Symbol;Acc:MGI:1913479])

HSP 1 Score: 119.398 bits (298), Expect = 5.544e-32
Identity = 65/159 (40.88%), Postives = 103/159 (64.78%), Query Frame = 1
Query:  346 LAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            LAFVIR++ I  ++   K  +    L+++ +GVFVK+   +++MLR +EPYV WG+P+ + V++L+ KRG AKIN   + + +N +IE+ LG+ G++C+EDLIHEI   G HF+E +SFL  F L+  R   R +     E G  G R + IN+L+ ++
Sbjct:   87 LAFVIRMERIEGVSLLVKSTIMKLGLKKLFSGVFVKVTPQSVRMLRTVEPYVTWGFPNLKSVRELILKRGQAKINNKTVPLTDNTVIEEHLGRFGVICLEDLIHEIAFPGKHFQEVSSFLCPFLLSVARHATRNRVGFRKEMGSPGYRGDRINQLIRQL 245          
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Match: Rpl7l1 (ribosomal protein L7-like 1 [Source:MGI Symbol;Acc:MGI:1913479])

HSP 1 Score: 60.8474 bits (146), Expect = 8.738e-12
Identity = 28/70 (40.00%), Postives = 49/70 (70.00%), Query Frame = 1
Query:  361 RLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKIN 570
            R++G++ +    K  +    L+++ +GVFVK+   +++MLR +EPYV WG+P+ + V++L+ KRG AKIN
Sbjct:    3 RIEGVSLLV---KSTIMKLGLKKLFSGVFVKVTPQSVRMLRTVEPYVTWGFPNLKSVRELILKRGQAKIN 69          
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Match: sp|O01802|RL7_CAEEL (60S ribosomal protein L7 OS=Caenorhabditis elegans OX=6239 GN=rpl-7 PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 8.053e-85
Identity = 132/241 (54.77%), Postives = 173/241 (71.78%), Query Frame = 1
Query:  103 TDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            T KVP+ PE+++K+  +    R K    KV        KK     RA+KY  EY   +       R A+  G+F+V  E K+AFV+R++GIN++ PKP+K +Q+ RLRQINNGVFVKLNKATL +LR+IEPYVAWGYP+ + +  L+YKRG+AK++G+R+ I +N I+EQ LGK  I+C+EDL HEI TVGPHFKEA +FL+ FKLNNP GG+ KK+NHFVEGGDFGNRE+ IN L+ KM 
Sbjct:    4 TKKVPQVPETVLKRRKQRADARTKAAQHKVTVAAKNKEKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPKPRKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGNRVPITDNTIVEQSLGKFNIICLEDLAHEIATVGPHFKEATNFLWPFKLNNPTGGWTKKTNHFVEGGDFGNREDQINNLLRKMV 244          
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Match: sp|Q5R9R4|RL7_PONAB (60S ribosomal protein L7 OS=Pongo abelii OX=9601 GN=RPL7 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.523e-82
Identity = 129/238 (54.20%), Postives = 175/238 (73.53%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PE+L KK       + KR+ +K A++    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:    9 KVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 246          
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Match: sp|Q58DT1|RL7_BOVIN (60S ribosomal protein L7 OS=Bos taurus OX=9913 GN=RPL7 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.794e-82
Identity = 129/238 (54.20%), Postives = 175/238 (73.53%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PE+L KK       + KR+ +K A++    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   10 KVPAVPETLKKKRKNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 247          
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Match: sp|P18124|RL7_HUMAN (60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 5.451e-82
Identity = 128/238 (53.78%), Postives = 175/238 (73.53%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +VP  PE+L KK       + KR+ +K A++    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N +I + LGK+GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   10 EVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 247          
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Match: sp|P05426|RL7_RAT (60S ribosomal protein L7 OS=Rattus norvegicus OX=10116 GN=Rpl7 PE=1 SV=2)

HSP 1 Score: 249.595 bits (636), Expect = 1.315e-81
Identity = 128/238 (53.78%), Postives = 173/238 (72.69%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PE+L KK       + KR+ +K A +    A++ LI  +A+ Y  EY +         R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NG FVKLNKA++ MLR++EPY+AWGYP+ + V +L+YKRG+ KIN  RI + +N ++ + LGK GI+C+EDLIHEIYTVG  FKEAN+FL+ FKL++PRGG +KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   22 KVPAVPETLKKKRRNFAELKVKRLRKKFALKTLRKARRKLIYEKAKHYHKEYRQMYRTEIRMARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASVNMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNSLVARSLGKFGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRM 259          
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Match: A0A443SH99 (Ribosomal protein-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_11390 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 9.668e-93
Identity = 138/241 (57.26%), Postives = 191/241 (79.25%), Query Frame = 1
Query:  103 TDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            + KVP  PE+L+KK  +   Q+ K + + +  RK   +K+++I  RA+KY  EY +++  +    R AK  GNF+V  EPKLAFV+R++GIN ++PKP+KV+QL RLRQINNG FVKLNKAT+ MLR+ EPY+AWGYP+ + V++LVYKRG+ +ING R+ + +N +IEQ+LGK GI+C+EDLIHEI+TVGP+FK+AN+FLY+FKLNNP+GG+RKK+ H+VEGGDFGNRE+ IN+L+ KM 
Sbjct:   11 SSKVPTVPETLLKKRKRRALQKAKDLQKSLKLRKEQKSKRLVIFKRAEKYVKEYRQKEKDIVRLKRQAKIHGNFYVPDEPKLAFVMRIRGINGLSPKPRKVLQLLRLRQINNGTFVKLNKATINMLRIAEPYIAWGYPNLKTVRELVYKRGYGRINGQRVALSDNAVIEQRLGKLGIICMEDLIHEIFTVGPNFKKANNFLYHFKLNNPKGGWRKKTTHYVEGGDFGNREDKINELLRKMI 251          
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Match: K7XWX7 (60S ribosomal protein L7 OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 9.828e-93
Identity = 142/239 (59.41%), Postives = 181/239 (75.73%), Query Frame = 1
Query:  106 DKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +KVPKKPES   KDI    + +    +KV +R  +L  K ++  RAQK+ AEY R +    N  R+A+  GNF+V+ EP+LAF +R++GIN I PKP+K +QL RLRQINNG FV+LNKATL MLRLI+PYVAWGYPS + V++L+YKRGF KI G R     N  I+++LG++GI+C EDL+HEIYTVGPHFK+A+SFL+ FKLNNP GGFRKK  HFVEGGDFGNRE+YIN+L+  M
Sbjct:   20 EKVPKKPESRSYKDIVRARKIKSNAKKKVIRRLKYLRLKKIMMKRAQKHLAEYRRAEKREVNLKRNAEKFGNFYVEAEPRLAFAVRIRGINGIHPKPRKTLQLMRLRQINNGTFVRLNKATLNMLRLIDPYVAWGYPSLKTVRRLIYKRGFCKIRGQR-LPLTNARIQKRLGRYGIICTEDLVHEIYTVGPHFKQASSFLWRFKLNNPTGGFRKKGRHFVEGGDFGNREKYINRLLKTM 257          
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Match: A0A0X3PKE5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR101165 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 1.195e-92
Identity = 142/239 (59.41%), Postives = 181/239 (75.73%), Query Frame = 1
Query:  106 DKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +KVPKKPES   KDI    + +    +KV +R  +L  K ++  RAQK+ AEY R +    N  R+A+  GNF+V+ EP+LAF +R++GIN I PKP+K +QL RLRQINNG FV+LNKATL MLRLI+PYVAWGYPS + V++L+YKRGF KI G R     N  I+++LG++GI+C EDL+HEIYTVGPHFK+A+SFL+ FKLNNP GGFRKK  HFVEGGDFGNRE+YIN+L+  M
Sbjct:   37 EKVPKKPESRSYKDIVRARKIKSNARKKVIRRLKYLRLKKIMMKRAQKHLAEYRRAEKREVNLKRNAEKFGNFYVEAEPRLAFAVRIRGINGIHPKPRKTLQLMRLRQINNGTFVRLNKATLNMLRLIDPYVAWGYPSLKTVRRLIYKRGFCKIRGQR-LPLTNARIQKRLGRYGIICTEDLVHEIYTVGPHFKQASSFLWRFKLNNPTGGFRKKGRHFVEGGDFGNREKYINRLLKTM 274          
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Match: A0A1Z5LFP1 (Ribosomal protein L7-like Ribosomal protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 5.307e-92
Identity = 137/240 (57.08%), Postives = 189/240 (78.75%), Query Frame = 1
Query:  106 DKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            +K+P+ PE+L+K+       + K+    + +RKA  AK++ I  RA++Y  EY R++  L    R+A+  GNF+V  EPKLA VIR++GIN ++PKP+KV+QL RLRQINN   +KLNKAT+ MLR+ EPY+AWGYP+ + V++LVYKRGFA+++G R+ + +N IIE+ LGK+GI+CVEDLIHE+YTVGP+FK+AN+FL+YFKLNNPRGG+RKK+NH+ EGGDFGNRE+ INKL+ KM 
Sbjct:   12 EKLPEVPETLLKRRKTRAEIKAKQYQNAIKQRKAKRAKRLEIFKRAEQYVKEYRRQERDLIRLKRTARHKGNFYVPAEPKLAIVIRIRGINGVSPKPRKVLQLLRLRQINNATLLKLNKATINMLRIAEPYIAWGYPNLKSVRELVYKRGFARVDGRRVALSDNAIIEKALGKYGIICVEDLIHELYTVGPNFKKANNFLWYFKLNNPRGGWRKKTNHYNEGGDFGNREDLINKLLRKMI 251          
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Match: A0A3P7CUU8 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9338 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 6.797e-92
Identity = 142/239 (59.41%), Postives = 181/239 (75.73%), Query Frame = 1
Query:  106 DKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            +KVPKKPES   KDI    + +    +KV +R  +L  K ++  RAQK+ AEY R +    N  R+A+  GNF+V+ EP+LAF +R++GIN I PKP+K +QL RLRQINNG FV+LNKATL MLRLI+PYVAWGYPS + V++L+YKRGF KI G R     N  I+++LG++GI+C EDL+HEIYTVGPHFK+A+SFL+ FKLNNP GGFRKK  HFVEGGDFGNRE+YIN+L+  M
Sbjct:   66 EKVPKKPESRSYKDIVRARKIKSNARKKVIRRLKYLRLKKIMMKRAQKHLAEYRRAEKREVNLKRNAEKFGNFYVEAEPRLAFAVRIRGINGIHPKPRKTLQLMRLRQINNGTFVRLNKATLNMLRLIDPYVAWGYPSLKTVRRLIYKRGFCKIRGQR-LPLTNARIQKRLGRYGIICTEDLVHEIYTVGPHFKQASSFLWRFKLNNPTGGFRKKGRHFVEGGDFGNREKYINRLLKTM 303          
BLAST of 60S ribosomal protein L7 vs. Ensembl Cavefish
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:103022683])

HSP 1 Score: 246.128 bits (627), Expect = 3.593e-81
Identity = 132/240 (55.00%), Postives = 174/240 (72.50%), Query Frame = 1
Query:  112 VPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            VP  PESL+KK     A + KRI  K  ++KA    + LI  RA+ Y  EY    R ++ L    R A+  GNF+V  E KLAFV+R++GIN ++PK +KV+QL RLRQI NGVFVKLNKA++ MLR+ EPY+AWGYP+ + V++L+YKRG  KIN  RI + +N +IE+ LG+ GI+CVEDLIHEIYTVG +FK AN+FL+ FKL++P GG  KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   16 VPSVPESLLKKRKHYAAVKAKRIKTKRVEKKARRVTRKLIFKRAEAYHKEYREMYRREIRLN---RMARKAGNFYVPAEAKLAFVVRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGHGKINRRRIPLTDNALIEKNLGRTGIICVEDLIHEIYTVGKNFKAANNFLWPFKLSSPHGGMNKKTTHFVEGGDAGNREDQINRLIRRM 252          
BLAST of 60S ribosomal protein L7 vs. Ensembl Cavefish
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:103022683])

HSP 1 Score: 246.128 bits (627), Expect = 3.593e-81
Identity = 132/240 (55.00%), Postives = 174/240 (72.50%), Query Frame = 1
Query:  112 VPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYA---REKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            VP  PESL+KK     A + KRI  K  ++KA    + LI  RA+ Y  EY    R ++ L    R A+  GNF+V  E KLAFV+R++GIN ++PK +KV+QL RLRQI NGVFVKLNKA++ MLR+ EPY+AWGYP+ + V++L+YKRG  KIN  RI + +N +IE+ LG+ GI+CVEDLIHEIYTVG +FK AN+FL+ FKL++P GG  KK+ HFVEGGD GNRE+ IN+L+ +M
Sbjct:   16 VPSVPESLLKKRKHYAAVKAKRIKTKRVEKKARRVTRKLIFKRAEAYHKEYREMYRREIRLN---RMARKAGNFYVPAEAKLAFVVRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGHGKINRRRIPLTDNALIEKNLGRTGIICVEDLIHEIYTVGKNFKAANNFLWPFKLSSPHGGMNKKTTHFVEGGDAGNREDQINRLIRRM 252          
BLAST of 60S ribosomal protein L7 vs. Ensembl Cavefish
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:NCBI gene;Acc:103041646])

HSP 1 Score: 144.436 bits (363), Expect = 1.059e-41
Identity = 74/158 (46.84%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  346 LAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDK 819
            LAF +R++ I  ++P+ KKV+ + RLR+I +G FV+++K +L ML+++EPYVAWG+P+ + V++L+ KRG  KI   +I + +N +IEQ LG+HGI+C+EDLIHEIY+ G HF+  N  L+ F+L+ PR   R K     E GD G R E IN ++ K
Sbjct:   88 LAFAVRVRMIKGVSPRVKKVIHMLRLRKIFSGTFVRISKTSLNMLKIVEPYVAWGFPNLKSVRELILKRGQLKIKKKKIPLTDNTVIEQHLGEHGIICLEDLIHEIYSTGKHFRMVNRLLWPFRLSVPRHSARDKVGLLKEMGDPGPRAEDINSVIRK 245          
BLAST of 60S ribosomal protein L7 vs. Ensembl Cavefish
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:NCBI gene;Acc:103041646])

HSP 1 Score: 145.206 bits (365), Expect = 1.420e-41
Identity = 74/158 (46.84%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  346 LAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDK 819
            LAF +R++ I  ++P+ KKV+ + RLR+I +G FV+++K +L ML+++EPYVAWG+P+ + V++L+ KRG  KI   +I + +N +IEQ LG+HGI+C+EDLIHEIY+ G HF+  N  L+ F+L+ PR   R K     E GD G R E IN ++ K
Sbjct:  124 LAFAVRVRMIKGVSPRVKKVIHMLRLRKIFSGTFVRISKTSLNMLKIVEPYVAWGFPNLKSVRELILKRGQLKIKKKKIPLTDNTVIEQHLGEHGIICLEDLIHEIYSTGKHFRMVNRLLWPFRLSVPRHSARDKVGLLKEMGDPGPRAEDINSVIRK 281          
BLAST of 60S ribosomal protein L7 vs. Ensembl Sea Lamprey
Match: rpl7 (ribosomal protein L7 [Source:ZFIN;Acc:ZDB-GENE-030131-8654])

HSP 1 Score: 246.899 bits (629), Expect = 4.039e-82
Identity = 127/233 (54.51%), Postives = 171/233 (73.39%), Query Frame = 1
Query:  124 PESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            PESL+K+     A R  R  ++V  R      + LI  RA+ Y  EY  ++ +     R A+  GNF+V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NGVFV++NKA++ MLR+ EPY+AWGYP+ + V++LVYKRGF KI   RI + +N +IE+ LGK GI+C+EDLIHEI+TVG +FK AN+FL+ FKL++PRGG RKK+ H+VEGGD GNRE+ IN+LV +M
Sbjct:   28 PESLLKRRKAFQAMRTVRAKQRVRDRLTRWVTRRLIYKRAEAYVKEYHSKERSEIRLARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGVFVRINKASINMLRIAEPYIAWGYPNLKTVRELVYKRGFGKIRKQRIPLTDNSLIEKNLGKTGIICIEDLIHEIFTVGKNFKLANNFLWPFKLSSPRGGMRKKTTHYVEGGDAGNREDQINRLVRQM 260          
BLAST of 60S ribosomal protein L7 vs. Ensembl Sea Lamprey
Match: rpl7l1 (ribosomal protein L7-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-970])

HSP 1 Score: 144.821 bits (364), Expect = 1.830e-42
Identity = 87/240 (36.25%), Postives = 144/240 (60.00%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLR--SAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            ++PK PE+L+KK     A +E +    + +RK    ++ +   RA+++  + +R+K      LR    K   +     EP+L F +R++  N  + K ++ +QL RL +I +GVF+KL K +L MLR +EP++AWGYP+ + V++L+ KRG  K+NG    + +N +IE +LGKHG+VC+ED+IHEI+T+G +F+ A  FL    L+  R     K     E G  G+R + IN+L+ ++
Sbjct:   10 RLPKVPENLLKKRKAYQAIKETQKKRNLQQRKGSKTERKIKFKRAEQFLRD-SRKKQRDDVRLRRLECKPGPHLTPPAEPRLVFAVRVRSSNACSYKAQRCLQLLRLSRIFSGVFIKLGKTSLHMLRQVEPFIAWGYPNLKSVRELILKRGQTKVNGKLCPLTDNAMIEDRLGKHGMVCLEDVIHEIFTLGKNFRTAAFFLQPMILSVARHSRLSKGGQESETGPTGDRGDDINQLIRQL 248          
BLAST of 60S ribosomal protein L7 vs. Ensembl Yeast
Match: RPL7A (Ribosomal 60S subunit protein L7A; required for processing of 27SA3 pre-rRNA to 27SB pre-rRNA during assembly of large ribosomal subunit; depletion leads to a turnover of pre-rRNA; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2); binds to Domain II of 25S and 5.8S rRNAs; homologous to mammalian ribosomal protein L7 and bacterial L30; RPL7A has a paralog, RPL7B, that arose from the whole genome duplication [Source:SGD;Acc:S000003044])

HSP 1 Score: 227.254 bits (578), Expect = 6.910e-75
Identity = 123/235 (52.34%), Postives = 167/235 (71.06%), Query Frame = 1
Query:  124 PESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGF--RKKSNHFVEGGDFGNREEYINKLVDKM 822
            PES +KK        E+   E+ A++ A   K+ +I  R   Y  EY   +  +    R AK  G+++V+ + KL FV+R+KGINKI PKP+KV+QL RL +IN+G FVK+ KATL++L+LIEPYVA+GYPS   +++LVYKRGF KIN  R+ + +N IIE  LGK+GI+ ++DLIHEI TVGPHFK+AN+FL+ FKL+NP GG+   +K  HF++GG FGNREE+INKLV  M
Sbjct:    9 PESQLKKSKAQQKTAEQVAAERAARKAANKEKRAIILERNAAYQKEYETAERNIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKSM 243          
BLAST of 60S ribosomal protein L7 vs. Ensembl Yeast
Match: RPL7B (Ribosomal 60S subunit protein L7B; required for processing of 27SA3 pre-rRNA to 27SB pre-rRNA during assembly of large ribosomal subunit; depletion leads to a turnover of pre-rRNA; contains a conserved C-terminal Nucleic acid Binding Domain (NDB2); binds to Domain II of 25S and 5.8S rRNAs; homologous to mammalian ribosomal protein L7 and bacterial L30; RPL7B has a paralog, RPL7A, that arose from the whole genome duplication [Source:SGD;Acc:S000006119])

HSP 1 Score: 226.868 bits (577), Expect = 1.203e-74
Identity = 114/204 (55.88%), Postives = 153/204 (75.00%), Query Frame = 1
Query:  217 KKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGF--RKKSNHFVEGGDFGNREEYINKLVDKM 822
            K+ +I  R   Y  EY   +  +    R AK  G+++V+ + KL FV+R+KGINKI PKP+KV+QL RL +IN+G FVK+ KATL++L+LIEPYVA+GYPS   +++LVYKRGF KIN  R+ + +N IIE  LGK+GI+ ++DLIHEI TVGPHFK+AN+FL+ FKL+NP GG+   +K  HF++GG FGNREE+INKLV  M
Sbjct:   40 KRAIILERNAAYQKEYETAERNIIQAKRDAKAAGSYYVEAQHKLVFVVRIKGINKIPPKPRKVLQLLRLTRINSGTFVKVTKATLELLKLIEPYVAYGYPSYSTIRQLVYKRGFGKINKQRVPLSDNAIIEANLGKYGILSIDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRKFKHFIQGGSFGNREEFINKLVKAM 243          
BLAST of 60S ribosomal protein L7 vs. Ensembl Yeast
Match: RLP7 (Nucleolar protein similar to large ribosomal subunit L7 proteins; constituent of 66S pre-ribosomal particles; plays an essential role in processing of precursors to the large ribosomal subunit RNAs; binds junction of ITS2 and ITS2-proximal stem between the 3' end of 5.8S rRNA and the 5' end of 25S rRNA [Source:SGD;Acc:S000004947])

HSP 1 Score: 101.293 bits (251), Expect = 1.871e-25
Identity = 62/143 (43.36%), Postives = 84/143 (58.74%), Query Frame = 1
Query:  340 PKLAFVIRLKG---INKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXX------XXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGF 741
            P L F++R++G   +N I  K  K++ L RL + N GVFVKL K    +L++I PYV  G PS   ++ L+ KRG     G           ++N+I+E+QLG HGI+CVED+IHEI T+G  F   N FL  FKLN    GF
Sbjct:  139 PALLFIVRVRGPLAVN-IPNKAFKILSLLRLVETNTGVFVKLTKNVYPLLKVIAPYVVIGKPSLSSIRSLIQKRGRIIYKGENEAEPHEIVLNDNNIVEEQLGDHGIICVEDIIHEIATMGESFSVCNFFLQPFKLNREVSGF 280          
BLAST of 60S ribosomal protein L7 vs. Ensembl Yeast
Match: YPL197C_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; partially overlaps the ribosomal gene RPL7B [Source:SGD;Acc:S000006118])

HSP 1 Score: 77.411 bits (189), Expect = 3.039e-18
Identity = 44/119 (36.97%), Postives = 74/119 (62.18%), Query Frame = -3
Query:  478 LTHFINKFVDVFFSVSKITTFNKMVRLL--SETTTWVI*FEVIQK*ISFFEMWSNGINFMY*IFNTDNSMFAQLLFDNIIVVNLNSRTIDLCKSSFIN*LFNHSL*RVSPSDIWFDQSQ 828
            L H +N+F+D FF+V++ TT ++M+ L   + TT WV   E  QK +S  E+W+N  +F+  I N  +++  Q+ FD+ IV   NS  +DL ++S ++ L N  +  V+ S++WF+Q Q
Sbjct:   19 LVHSLNQFIDEFFTVTERTTLDEMLELSWDTPTTRWVGQLEWPQKVVSLLEVWTNSDDFVNQIVNGQDTILTQVGFDDSIVGQWNSLLVDLTETSLVDQLSNSRVGWVTVSNVWFNQLQ 137          
BLAST of 60S ribosomal protein L7 vs. Ensembl Nematostella
Match: EDO36655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHY5])

HSP 1 Score: 253.447 bits (646), Expect = 1.258e-84
Identity = 135/245 (55.10%), Postives = 183/245 (74.69%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITG-------RAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP+ PE+L+KK  KS  Q       K A+ KA LA+K L  G       RA+KY  EY +++V      + AK  GNF+V  E +LAFVIR++GIN ++PK +K++QL RLRQINNGVFV+LNKAT  MLR+++PY+A+GYP+ + V++L+YKRG+ K++  R+ + +N I+E+ LGKHGI+CVEDLIHEI+TVG HFKEA++FL+ FKL++P+GGFRKK+ HFVEGGD GNRE+ IN LV  M
Sbjct:    7 KVPRVPETLLKKR-KSLEQ------IKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKEVDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQRVALTDNSIVEKVLGKHGIICVEDLIHEIFTVGEHFKEASNFLWPFKLSSPKGGFRKKTTHFVEGGDHGNREDKINGLVRVM 244          
BLAST of 60S ribosomal protein L7 vs. Ensembl Medaka
Match: rpl7 (ribosomal protein L7 [Source:NCBI gene;Acc:100049522])

HSP 1 Score: 251.906 bits (642), Expect = 1.352e-83
Identity = 127/238 (53.36%), Postives = 178/238 (74.79%), Query Frame = 1
Query:  109 KVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKM 822
            KVP  PESL+K+     A +  R+ + +A++KA    + LI  RA+KY  EY + +       R A+  GN++V  EPKLAFVIR++GIN ++PK +KV+QL RLRQI NGVFVKLNKA++ MLR+ EPY+AWGYP+ + V++L+YKRG+ ++   RI + +N ++E+ LGK+GI+CVEDLIHEIYTVG +FK AN+FL+ FKL++PRGG  KK+ HFVEGGD GNRE+ IN+++ +M
Sbjct:    7 KVPAVPESLLKRRKAYAAMKAMRVKKLLAEKKARKVTRKLIYKRAEKYHKEYRQMERREIRLARMARKVGNYYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGVFVKLNKASINMLRIAEPYIAWGYPNLKSVRELIYKRGYGRMRKQRIALTDNALVEKALGKYGIICVEDLIHEIYTVGKNFKPANNFLWPFKLSSPRGGMNKKTTHFVEGGDAGNREDQINRMIRRM 244          
BLAST of 60S ribosomal protein L7 vs. Ensembl Medaka
Match: rpl7l1 (ribosomal protein L7 like 1 [Source:NCBI gene;Acc:101167849])

HSP 1 Score: 145.591 bits (366), Expect = 4.286e-42
Identity = 72/157 (45.86%), Postives = 113/157 (71.97%), Query Frame = 1
Query:  343 KLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLV 813
            KLAF +R++ I  ++PK +KV+Q+ RLR+I +G F+K+NK ++ M++++EPYVAWG+P+ + V++L+ KRG  +I   R+ + +N +IEQ +GKHGI+C+EDLIHEI++VG  F+ AN+FL  F+L+ PR   R K+    + G  G R   IN +V
Sbjct:   87 KLAFAVRIREIKGVSPKVRKVVQMMRLRKIFSGAFIKINKTSVAMMKVVEPYVAWGFPNLKSVRELILKRGQTRIGRRRVPLTDNALIEQHMGKHGIICLEDLIHEIFSVGRSFRPANNFLLPFRLSVPRHAARDKAGLLKDLGGPGFRGADINAIV 243          
BLAST of 60S ribosomal protein L7 vs. Planmine SMEST
Match: SMESG000022296.1 (SMESG000022296.1)

HSP 1 Score: 464.151 bits (1193), Expect = 1.559e-167
Identity = 241/242 (99.59%), Postives = 241/242 (99.59%), Query Frame = 1
Query:  100 MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 825
            MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRI IDNNDIIEQQLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC
Sbjct:    1 MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQKYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRIPIDNNDIIEQQLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC 242          
BLAST of 60S ribosomal protein L7 vs. Planmine SMEST
Match: SMESG000076604.1 (SMESG000076604.1)

HSP 1 Score: 127.487 bits (319), Expect = 3.947e-35
Identity = 84/226 (37.17%), Postives = 129/226 (57.08%), Query Frame = 1
Query:  163 QREKRIIEKVAKRKAFLAKKILITGRAQ----KYAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPKKVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYKRGFAKINGSRXXXXXXXXXXXXLGKHGIVCVEDLIHEIYTVGPHFKEANSFLYYFKLNNPRGGFRKKSNHFVEGG-DFGNREEYINKLVDKMC 825
            QREK +  ++  RK    +  L+ G AQ       A Y ++++   +NL+  KT    F+   PKL  V+RL G + +  K + + +  RL   N  VF+K+N+  L+ L +++PY+AWGYPS  ++  L+ KRG+A IN  R++I NN IIE  LGK  ++C+ D++HE+ TVG +F   NSFL+ FKL     GF    N       + GNR+ Y+N L+ +M 
Sbjct:   36 QREKALNVRIQSRK----RSSLLKGPAQFIIDSKKARYNKKRI---DNLKMKKTP--IFLGDSPKLGIVLRLGGFSGLGEKIENIFKSLRLDTYNQAVFIKVNQKMLKKLTILKPYIAWGYPSVEIINDLLSKRGWANINDKRVRISNNTIIENHLGKFDVLCLADIVHELATVGSNFDAVNSFLWPFKLLTAPPGFLGLGNSRKHVRLEPGNRDIYVNDLLRRMI 252          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL71.135e-8253.78ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL75.182e-7957.64ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL75.182e-7957.64ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL75.182e-7957.64ribosomal protein L7 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPL7L14.587e-3333.61ribosomal protein L7 like 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl-76.331e-8654.7760S ribosomal protein L7 [Source:UniProtKB/Swiss-... [more]
rpl-76.331e-8654.7760S ribosomal protein L7 [Source:UniProtKB/Swiss-... [more]
rpl-76.331e-8654.7760S ribosomal protein L7 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL71.269e-7652.50gene:FBgn0005593 transcript:FBtr0079946[more]
RpL71.269e-7652.50gene:FBgn0005593 transcript:FBtr0343653[more]
RpL7-like1.272e-3441.51gene:FBgn0032404 transcript:FBtr0346426[more]
RpL7-like1.272e-3441.51gene:FBgn0032404 transcript:FBtr0080296[more]
RpL7-like1.272e-3441.51gene:FBgn0032404 transcript:FBtr0113037[more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl73.933e-8154.36ribosomal protein L7 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl7l15.580e-4145.28ribosomal protein L7-like 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rpl75.775e-8354.77ribosomal protein L7 [Source:NCBI gene;Acc:448528][more]
rpl71.025e-8254.77ribosomal protein L7 [Source:NCBI gene;Acc:448528][more]
rpl71.331e-8254.77ribosomal protein L7 [Source:NCBI gene;Acc:448528][more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpl72.540e-8253.53ribosomal protein L7 [Source:MGI Symbol;Acc:MGI:98... [more]
Rpl73.559e-7453.33ribosomal protein L7 [Source:MGI Symbol;Acc:MGI:98... [more]
Rpl7l15.544e-3240.88ribosomal protein L7-like 1 [Source:MGI Symbol;Acc... [more]
Rpl7l15.544e-3240.88ribosomal protein L7-like 1 [Source:MGI Symbol;Acc... [more]
Rpl7l18.738e-1240.00ribosomal protein L7-like 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01802|RL7_CAEEL8.053e-8554.7760S ribosomal protein L7 OS=Caenorhabditis elegans... [more]
sp|Q5R9R4|RL7_PONAB1.523e-8254.2060S ribosomal protein L7 OS=Pongo abelii OX=9601 G... [more]
sp|Q58DT1|RL7_BOVIN1.794e-8254.2060S ribosomal protein L7 OS=Bos taurus OX=9913 GN=... [more]
sp|P18124|RL7_HUMAN5.451e-8253.7860S ribosomal protein L7 OS=Homo sapiens OX=9606 G... [more]
sp|P05426|RL7_RAT1.315e-8153.7860S ribosomal protein L7 OS=Rattus norvegicus OX=1... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SH999.668e-9357.26Ribosomal protein-like protein OS=Leptotrombidium ... [more]
K7XWX79.828e-9359.4160S ribosomal protein L7 OS=Spirometra erinaceieur... [more]
A0A0X3PKE51.195e-9259.41Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A1Z5LFP15.307e-9257.08Ribosomal protein L7-like Ribosomal protein (Fragm... [more]
A0A3P7CUU86.797e-9259.41Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpl73.593e-8155.00ribosomal protein L7 [Source:NCBI gene;Acc:1030226... [more]
rpl73.593e-8155.00ribosomal protein L7 [Source:NCBI gene;Acc:1030226... [more]
rpl7l11.059e-4146.84ribosomal protein L7 like 1 [Source:NCBI gene;Acc:... [more]
rpl7l11.420e-4146.84ribosomal protein L7 like 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl74.039e-8254.51ribosomal protein L7 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
rpl7l11.830e-4236.25ribosomal protein L7-like 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RPL7A6.910e-7552.34Ribosomal 60S subunit protein L7A; required for pr... [more]
RPL7B1.203e-7455.88Ribosomal 60S subunit protein L7B; required for pr... [more]
RLP71.871e-2543.36Nucleolar protein similar to large ribosomal subun... [more]
YPL197C_mRNA3.039e-1836.97Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366551.258e-8455.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl71.352e-8353.36ribosomal protein L7 [Source:NCBI gene;Acc:1000495... [more]
rpl7l14.286e-4245.86ribosomal protein L7 like 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of 60S ribosomal protein L7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000022296.11.559e-16799.59SMESG000022296.1[more]
SMESG000076604.13.947e-3537.17SMESG000076604.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013606 ID=SMED30013606|Name=60S ribosomal protein L7|organism=Schmidtea mediterranea sexual|type=transcript|length=851bp
ATAAACATTAAAAATATTTTATTTTCTGACATTATAATAAAATAGGTTGT
TTAAATTTATTAACAATTATTGAAACTTATAATTCAAATAAAATAAAAAA
TGACTGATAAGGTACCAAAAAAACCAGAATCACTTGTCAAAAAGGATATT
AAAAGTTGTGCTCAAAGAGAGAAAAGAATTATTGAAAAGGTAGCTAAACG
AAAGGCTTTTTTGGCTAAGAAAATTTTGATTACTGGACGAGCTCAAAAAT
ATGCAGCTGAATATGCTAGAGAAAAAGTTGCTCTTACCAATAATTTAAGA
TCTGCTAAGACTGATGGAAACTTCTTTGTCAAACAAGAACCTAAATTGGC
CTTTGTTATCAGACTCAAAGGTATTAATAAAATTGCACCCAAACCTAAGA
AGGTTATGCAACTTTTCCGATTGAGACAAATTAACAATGGTGTATTTGTC
AAATTGAACAAAGCTACTTTGCAAATGTTGAGATTGATCGAACCATATGT
CGCTTGGGGATACCCGTCACAACGAATGGTTAAAAAGTTAGTTTATAAAA
GAGGATTTGCAAAGATCAATGGTTCTCGAATTCAAATTGACAACAATGAT
ATTATCGAACAACAGTTGGGCAAACATGGAATTGTCTGTGTTGAAGATTT
AATACATGAAATTTATACCGTTGGACCACATTTCAAAGAAGCTAATTCAT
TTTTGTATTACTTCAAATTAAATAACCCACGTGGTGGTTTCAGAAAGAAG
TCTAACCATTTTGTTGAAGGTGGTGATTTTGGAAACAGAGAAGAATACAT
CAACAAACTTGTTGATAAAATGTGTTAATTTATAATAAAATTTTGGATTG
C
back to top

protein sequence of SMED30013606-orf-1

>SMED30013606-orf-1 ID=SMED30013606-orf-1|Name=SMED30013606-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MTDKVPKKPESLVKKDIKSCAQREKRIIEKVAKRKAFLAKKILITGRAQK
YAAEYAREKVALTNNLRSAKTDGNFFVKQEPKLAFVIRLKGINKIAPKPK
KVMQLFRLRQINNGVFVKLNKATLQMLRLIEPYVAWGYPSQRMVKKLVYK
RGFAKINGSRIQIDNNDIIEQQLGKHGIVCVEDLIHEIYTVGPHFKEANS
FLYYFKLNNPRGGFRKKSNHFVEGGDFGNREEYINKLVDKMC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000463maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0022625cytosolic large ribosomal subunit
GO:0005840ribosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036919L30_ferredoxin-like_sf
IPR005998Ribosomal_L7_euk
IPR023106Ribosomal_L30_central_dom_arc
IPR039699Ribosomal_L7/L30
IPR035808Ribosomal_L7_euk_arc
IPR016082Ribosomal_L30_ferredoxin-like
IPR012988Ribosomal_L30_N
IPR018038Ribosomal_L30_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 52..72
NoneNo IPR availablePANTHERPTHR11524:SF1660S RIBOSOMAL PROTEIN L7coord: 7..241
IPR036919Ribosomal protein L30, ferredoxin-like fold domain superfamilyGENE3DG3DSA:3.30.1390.20coord: 86..230
e-value: 1.7E-26
score: 94.8
IPR036919Ribosomal protein L30, ferredoxin-like fold domain superfamilySUPERFAMILYSSF55129Ribosomal protein L30p/L7ecoord: 83..241
IPR012988Ribosomal protein L30, N-terminalPFAMPF08079Ribosomal_L30_Ncoord: 9..78
e-value: 1.3E-10
score: 41.3
IPR005998Ribosomal protein L7, eukaryoticTIGRFAMTIGR01310TIGR01310coord: 9..241
e-value: 7.3E-88
score: 292.0
IPR023106Ribosomal protein L30, central domain, archaeal typeGENE3DG3DSA:1.10.15.30coord: 140..202
e-value: 1.7E-26
score: 94.8
IPR016082Ribosomal protein L30, ferredoxin-like fold domainPFAMPF00327Ribosomal_L30coord: 84..134
e-value: 5.4E-19
score: 67.8
IPR039699Ribosomal protein L7/L30PANTHERPTHR1152460S RIBOSOMAL PROTEIN L7coord: 7..241
IPR018038Ribosomal protein L30, conserved sitePROSITEPS00634RIBOSOMAL_L30coord: 102..134
IPR035808Ribosomal protein L7, eukaryotic/archaealCDDcd01657Ribosomal_L7_archeal_eukcoord: 83..241
e-value: 7.13394E-84
score: 245.129