Chromodomain-helicase-DNA-binding protein 1-like

Overview
NameChromodomain-helicase-DNA-binding protein 1-like
Smed IDSMED30013596
Length (bp)2871
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromodomain-helicase-DNA-binding protein 1-like (SMED30013596) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein 1-like (SMED30013596) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromodomain-helicase-DNA-binding protein 1-like (SMED30013596) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromodomain-helicase-DNA-binding protein 1-like (SMED30013596) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013596

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30013596SMESG000081089.1 SmedASXL_007412SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30013596SMESG000081089.1 SmedASXL_007412SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30013596SMESG000081089.1 dd_Smed_v6_17704_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30013596SMESG000081089.1 dd_Smed_v4_17704_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013596SMESG000081089.1 SMED_13213_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30013596SMESG000081089.1 SMED_13213_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Match: CHD1L (chromodomain helicase DNA binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:1916])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 334/865 (38.61%), Postives = 480/865 (55.49%), Query Frame = 2
Query:   89 DMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            + +L   GL+ I LR YQ++GV W        +G IL DEMGLGKT QTI   +      + +   ++  PL+V++NWK E  +  P L    Y G+K ER  ++   +  +   +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F  LLTGTP+QN+  ELY+LL+ V  + L S++    +   +  D  K+   +   +   +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:   33 EQDLRQWGLTGIHLRSYQLEGVNWLAQRFHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEEVG-DFIQRYQDIEKES--ESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGS---TMDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPR 877          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Match: CHD1L (chromodomain helicase DNA binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:1916])

HSP 1 Score: 524.242 bits (1349), Expect = 2.751e-172
Identity = 318/825 (38.55%), Postives = 458/825 (55.52%), Query Frame = 2
Query:  209 MGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            MGLGKT QTI   +      + +   ++  PL+V++NWK E  +  P L    Y G+K ER  ++   +  +   +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F  LLTGTP+QN+  ELY+LL+ V  + L S++    +   +  D  K+   +   +   +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:    1 MGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEEVG-DFIQRYQDIEKES--ESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGST---MDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPR 805          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Match: CHD1L (chromodomain helicase DNA binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:1916])

HSP 1 Score: 498.819 bits (1283), Expect = 6.421e-162
Identity = 310/827 (37.48%), Postives = 451/827 (54.53%), Query Frame = 2
Query:   89 DMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIH 2377
            + +L   GL+ I LR YQ++GV W        +G IL DEMGLGKT QTI   +      + +   ++  PL+V++NWK E  +  P L    Y G+K ER  ++   +  +   +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F  LLTGTP+QN+  ELY+LL+ V  + L S++    +   +  D  K+   +   +   +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A      +H
Sbjct:   25 EQDLRQWGLTGIHLRSYQLEGVNWLAQRFHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEEVG-DFIQRYQDIEKES--ESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGS---TMDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKGRLH 831          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Match: CHD1L (chromodomain helicase DNA binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:1916])

HSP 1 Score: 456.833 bits (1174), Expect = 1.921e-147
Identity = 279/701 (39.80%), Postives = 395/701 (56.35%), Query Frame = 2
Query:  578 FKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            F  LLTGTP+QN+  ELY+LL+ V  + L S++    +   +  D  K+   +   +   +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:   45 FSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEEVG-DFIQRYQDIEKES--ESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGS---TMDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPR 725          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Match: CHD1L (chromodomain helicase DNA binding protein 1 like [Source:HGNC Symbol;Acc:HGNC:1916])

HSP 1 Score: 434.106 bits (1115), Expect = 2.009e-139
Identity = 260/641 (40.56%), Postives = 364/641 (56.79%), Query Frame = 2
Query:  758 ILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:   49 LLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGS---TMDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPR 673          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 318.546 bits (815), Expect = 2.491e-93
Identity = 197/579 (34.02%), Postives = 320/579 (55.27%), Query Frame = 2
Query:   74 ALMKSDMNLFNLG---LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVC---YGVDKLFSDN--KNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            A+   D+ +F+     + N ++R YQ+ G+ W      +   GILADEMGLGKT+QTI  +             +++ P + + NW NEF K  P++   V +G++  R  +        +  +  TTYE +L+   ++  +N     +DE HRIKN +S L   V E+ ++ + L+TGTP+QNN  EL+ LL  +  +I  S D F     S  S+ +   N D + +   +L   +LRR K++  + L  K EV ++ G++ +Q+  Y  +LM+D++++       N   K     L NILM +RKC  HPYLF+G E   PF    HLVDNS K+ V+DKLL+     G ++L+FSQ ++MLD+++D+C+ R + Y RLDGS   E+R  AI  ++  +S K +F+L+TRAGG G+NL  AD VI  DSD+NPQ DLQAM R HR GQ +  R+ RL+   +V+E I+ +A+ KL +   ++     +  +K L   +M+    +G +++F+      +D  +      + +   + + +   + +NN   L+N+   ++    +Y F+G+NYK K
Sbjct:  111 AIKSDDLVIFDKSPFYIENGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQLKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIFTSSDDF----DSWFSNDAMSGNTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKVYVGLSKMQREWYTKVLMKDIDII-------NGAGKVEKARLMNILMHLRKCVNHPYLFDGAEPGPPFTTDQHLVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVIQQGRMSEAQKTLGKGDMISMIRHGAEQVFAAKDSTISDDDIDTILEKAEVKTAELNEKMGKIDENN---LRNMTFEDNAKFTVYQFEGENYKAK 675          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 291.197 bits (744), Expect = 5.712e-82
Identity = 187/492 (38.01%), Postives = 273/492 (55.49%), Query Frame = 2
Query:   59 FKSTFALMKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAX-XXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEW----------NAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYL---FNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKL 1489
            F+S    +K+D      G S  +LR YQ++G+ W + +    +  ILADEMGLGKT+Q+I  + +          +++V PL+ +  W+ EF +  P +   VYMG+ + R  IR  +EW          NA    ++TTYE LL+D   ++ I+  A  +DE HR+KN ES+LY  +++     K L+TGTP+QN+  EL+ LL  +        + F+            + N  GI      L   +LRR K +  + LP KTE ++   MT  QK  YK IL ++   L +    +            N++M+++KC  H  L   ++ I  +       L+ +S KL ++DKLL  L   GH++L+FSQM  MLDI+Q+Y  LR F  +RLDGS+R++ R  A+++++   ST   FLLSTRAGG G+NL  ADTVI  DSD+NPQ DLQAM+R HR GQ +   I RLV + SVEE IV RA+RKL
Sbjct:  388 FESMPDFLKTD------GESTHKLRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQ-YEWFVGGTKKMKINA----ILTTYEILLKDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEEFE--------TAHNESNHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWILTKNYRELSKGVKGS-------INGFVNLVMELKKCCNHASLTRQYDHIYDDAQGRLQQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKL 853          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Match: let-418 (pep chromosome:WBcel235:V:5826833:5832866:1 gene:WBGene00002637.1 transcript:F26F12.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-418)

HSP 1 Score: 291.197 bits (744), Expect = 8.837e-82
Identity = 187/525 (35.62%), Postives = 301/525 (57.33%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEW--------------------NAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFK--ENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKE-PFEL-----GDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSM----TREILGHEENTITKKKLNLKEMVCYGVDKLFSDN 1597
            +L  YQ++G+ W      +    ILADEMGLGKTVQ++  + +     H K   +++ PL+ + NW+ E  +  P+     Y+G +  R  +R  HE+                    N +  +++T+YE +  D   ++ I   A  +DE HR+KN++S+ +  ++E    ++ LLTGTP+QNN +EL++LL        +S++RF   E  T++ ++ SK+D ++   K  ++L   +LRR KA+ L  +P K+E+++   ++ +QK  YK+IL R+ + L       NV++  +  +L N+LM+++KC  HPYLF   E E P E      G  L+ NS K  ++ K+L  L   GH++L+FSQMT+MLDI++D C    + YER+DGS+  + R  AI+ ++   + + +FLLSTRAGG G+NL  ADTVI  DSD+NP  D+QA +R HR GQ     I R V + SVEE I S A++K+ +     R  LG +E   T  K  L +++ +G ++LFS++
Sbjct:  601 KLHPYQLEGLNWLRHCWSNGTDAILADEMGLGKTVQSLTFLYSLMKEGHCKGPFLIAAPLSTIINWEREAEQWCPDFYVVTYVGLRDARVVLRE-HEFSFVEGAVRSGPKASKMKTTENMKFHVLLTSYETINMDKTILSSIEWGALVVDEAHRLKNNQSLFFKNLNEYTIHYRVLLTGTPLQNNLEELFHLLN------FLSKERFNQLEAFTAEFNEISKEDQIE---KLHNLLGPHMLRRLKADVLTGMPSKSELIVRVELSAMQKKWYKNILTRNFDAL-------NVKNGGTQMSLMNVLMELKKCCNHPYLFVKAELEAPKEKNGMYEGTALIKNSGKFVLLQKMLRKLKDGGHRVLIFSQMTRMLDIMEDLCEYEGYRYERIDGSIMGQMRQDAIDRYNAPGAQQFIFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKKSVEEKITSVAKKKMLLNHLVVRAGLGGKEGK-TMSKTELDDVLRWGTEELFSED 1107          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Match: chd-3 (Chromodomain-helicase-DNA-binding protein 3 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q22516])

HSP 1 Score: 290.812 bits (743), Expect = 9.825e-82
Identity = 185/525 (35.24%), Postives = 299/525 (56.95%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEW--------------------NAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFK--ENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFEL------GDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMT----REILGHEENTITKKKLNLKEMVCYGVDKLFSDNK 1600
            L  YQ++G+ W      +    ILADEMGLGKTVQ++  +       H K   +++ PL+ + NW+ E     P+     Y+G++  R  IR  HE+                    N +  +++T+YE +  D   ++ I+  A  +DE HR+KN++S  +  + E   +++ LLTGTP+QNN +EL++LL  +A       DRF   E+ T++ S+ SK+D ++   K  ++L   +LRR KA+ L  +P K E+++   ++ +QK  YK+IL R+ + L       NV++  +  +L NI+M+++KC  HPYLF     E  +L      G  L+ N+ K  ++ K+L  L   GH++L+FSQMT MLDI++D+C +  + YER+DGS+  ++R  AI+ ++   + + +FLLSTRAGG G+NL  ADTVI  DSD+NP  D+QA +R HR GQ     I R V + SVEE I S A++K+ +T    R  LG ++   +  K  L +++ +G ++LF + +
Sbjct:  616 LHPYQLEGINWLRHCWSNGTDAILADEMGLGKTVQSLTFLYTLMKEGHTKGPFLIAAPLSTIINWEREAELWCPDFYVVTYVGDRESRMVIRE-HEFSFVDGAVRGGPKVSKIKTLENLKFHVLLTSYECINMDKAILSSIDWAALVVDEAHRLKNNQSTFFKNLREYNIQYRVLLTGTPLQNNLEELFHLLNFLAP------DRFNQLESFTAEFSEISKEDQIE---KLHNLLGPHMLRRLKADVLTGMPSKQELIVRVELSAMQKKYYKNILTRNFDAL-------NVKNGGTQMSLINIIMELKKCCNHPYLFMKACLEAPKLKNGMYEGSALIKNAGKFVLLQKMLRKLKDGGHRVLIFSQMTMMLDILEDFCDVEGYKYERIDGSITGQQRQDAIDRYNAPGAKQFVFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRLGQKHKVMIYRFVTKGSVEERITSVAKKKMLLTHLVVRAGLGAKDGK-SMSKTELDDVLRWGTEELFKEEE 1122          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 269.626 bits (688), Expect = 8.789e-75
Identity = 171/486 (35.19%), Postives = 264/486 (54.32%), Query Frame = 2
Query:  110 GLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEI-PTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE------NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSI---LMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFEL-------GDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL 1510
            G  N+ L+ YQ+ G++W +    +N  GILADEMGLGKT+QTI  V    ++       +V  PL+ ++NW+NEF K  P++   +Y G K  R  +       A  ++M TTYEY++++   +  I      +DEGHR+KNH   L   ++     + + LLTGTP+QN   EL+ LL  +  +I  S   F++        T +  + ++++ +  I +   +L   +LRR K E    LP+KTE VI    + LQK +Y+ +   L+ D  +     +  N             ++ +RK   HP+LF  IE             G  L+  + KL+++D++L  L   GH+IL+F QMT M++I +D+   R + Y RLDGS + +ER   +  F+   S   LF+LSTRAGG GLNL  ADTVI  DSD+NP  D+QA  R HR GQ +  R++RL+   SVEE I++ A+ KL++  +++
Sbjct:  527 GDPNLLLKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRVEGQIRKGAFNVLM-TTYEYVIKEKALLGKIRWKYMIIDEGHRLKNHNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIFSSCGTFEQWFNAPFATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQKGLLLDAKMSSGARSLMNT------------VVHLRKLCNHPFLFPNIEDSCRAYWKVNEVNGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDEKVI 999          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087841)

HSP 1 Score: 318.161 bits (814), Expect = 5.715e-93
Identity = 210/569 (36.91%), Postives = 319/569 (56.06%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIER-TNIRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE--NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL-GHEENTITKKKLNLKEM---VCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNI---ENINDDVNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +             I++ P + + NW NEF K  P+L+    +G++  R T IR+     EW+    + +T+YE  +++       N     +DE HRIKN +S L   + E  T  + L+TGTP+QNN  EL+ LL  +  ++  S + F E  N  + L D    D L  I +  ++L   +LRR KAE  + L  K E+ IF G++ +Q+  Y  +L++D++++       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+ ++DKLL  L   G ++L+FSQMT+MLDI++DYC+ R++NY RLDG    E+R   I  F+   S K LF+LSTRAGG G+NL  AD VI  DSD+NPQ+DLQAM R HR GQ +  R+ RL+   +VEE IV RA+ KL + + ++ G         +LN  EM   + +G +++FS  + +   +++E    IL  G+  +  +   +    + +L+      N     + +Y F+G++++ K
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWD----VCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGD----DAL--ITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVV-------NGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETD---ITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK 675          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087842)

HSP 1 Score: 318.161 bits (814), Expect = 5.715e-93
Identity = 210/569 (36.91%), Postives = 319/569 (56.06%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIER-TNIRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE--NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL-GHEENTITKKKLNLKEM---VCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNI---ENINDDVNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +             I++ P + + NW NEF K  P+L+    +G++  R T IR+     EW+    + +T+YE  +++       N     +DE HRIKN +S L   + E  T  + L+TGTP+QNN  EL+ LL  +  ++  S + F E  N  + L D    D L  I +  ++L   +LRR KAE  + L  K E+ IF G++ +Q+  Y  +L++D++++       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+ ++DKLL  L   G ++L+FSQMT+MLDI++DYC+ R++NY RLDG    E+R   I  F+   S K LF+LSTRAGG G+NL  AD VI  DSD+NPQ+DLQAM R HR GQ +  R+ RL+   +VEE IV RA+ KL + + ++ G         +LN  EM   + +G +++FS  + +   +++E    IL  G+  +  +   +    + +L+      N     + +Y F+G++++ K
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWD----VCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGD----DAL--ITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVV-------NGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETD---ITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK 675          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087843)

HSP 1 Score: 318.161 bits (814), Expect = 5.715e-93
Identity = 210/569 (36.91%), Postives = 319/569 (56.06%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIER-TNIRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE--NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL-GHEENTITKKKLNLKEM---VCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNI---ENINDDVNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +             I++ P + + NW NEF K  P+L+    +G++  R T IR+     EW+    + +T+YE  +++       N     +DE HRIKN +S L   + E  T  + L+TGTP+QNN  EL+ LL  +  ++  S + F E  N  + L D    D L  I +  ++L   +LRR KAE  + L  K E+ IF G++ +Q+  Y  +L++D++++       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+ ++DKLL  L   G ++L+FSQMT+MLDI++DYC+ R++NY RLDG    E+R   I  F+   S K LF+LSTRAGG G+NL  AD VI  DSD+NPQ+DLQAM R HR GQ +  R+ RL+   +VEE IV RA+ KL + + ++ G         +LN  EM   + +G +++FS  + +   +++E    IL  G+  +  +   +    + +L+      N     + +Y F+G++++ K
Sbjct:  127 EMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWD----VCVTSYEMCIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGD----DAL--ITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVV-------NGAGKVEKMRLQNILMQLRKCTNHPYLFDGAEPGPPYTTDTHLVYNSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVIQGGRLVDNRSNQLNKDEMLNIIRFGANQVFSSKETD---ITDEDIDVILERGEAKTAEQKAALDSLGESSLRTFTMDTNGEAGTSSVYQFEGEDWREK 675          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0077674)

HSP 1 Score: 296.975 bits (759), Expect = 1.322e-83
Identity = 195/546 (35.71%), Postives = 293/546 (53.66%), Query Frame = 2
Query:   59 FKSTFALMKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXX-XXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDH-----LVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNF-SETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKL-----------SMTREIL-----GHEENTITKKKLNLKEMVCYGVDKLFSDNKNND 1609
            ++  F+ +K+     + GL+   LR YQMDG+ W + S    +  ILADEMGLGKT+QTIC + +   I H     + V PL+ +  W+ EF+   P++    Y+G+ I+   +   +EW  E         ++TTYE +L+D   +  +   A  +DE HR+KN +S+LY  + E  T  + L+TGTP+QN+  EL+ LL  +  +   + + F+      +   + +D   G  +    L   ILRR K +  + LP K E ++   MT LQK  YK IL ++ + L++    +            NI+++++KC  H  L    E E   L        L+  S KL ++DKLL  L   GH++L+FSQM +MLD++ DY   R F ++RLDGS++ E R  A+++F +E      FLLSTRAGG G+NL  ADTVI  DSD+NPQ DLQA AR HR GQ     I RLV   SVEE IV RA++K+           +  R +L     GH  N+    K +L  ++ +G ++LF D + +D
Sbjct:  508 YRPKFSRIKNQPEFLSSGLT---LRDYQMDGLNWLLHSWCKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGD-IKSRELIQQYEWQFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFE------VQHGNAEDK--GYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGST-------STFLNIVIELKKCCNHAALIRPSEFELMGLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHD 1034          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Match: Chd1 (gene:FBgn0250786 transcript:FBtr0331654)

HSP 1 Score: 296.975 bits (759), Expect = 1.503e-83
Identity = 195/546 (35.71%), Postives = 293/546 (53.66%), Query Frame = 2
Query:   59 FKSTFALMKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXX-XXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDH-----LVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNF-SETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKL-----------SMTREIL-----GHEENTITKKKLNLKEMVCYGVDKLFSDNKNND 1609
            ++  F+ +K+     + GL+   LR YQMDG+ W + S    +  ILADEMGLGKT+QTIC + +   I H     + V PL+ +  W+ EF+   P++    Y+G+ I+   +   +EW  E         ++TTYE +L+D   +  +   A  +DE HR+KN +S+LY  + E  T  + L+TGTP+QN+  EL+ LL  +  +   + + F+      +   + +D   G  +    L   ILRR K +  + LP K E ++   MT LQK  YK IL ++ + L++    +            NI+++++KC  H  L    E E   L        L+  S KL ++DKLL  L   GH++L+FSQM +MLD++ DY   R F ++RLDGS++ E R  A+++F +E      FLLSTRAGG G+NL  ADTVI  DSD+NPQ DLQA AR HR GQ     I RLV   SVEE IV RA++K+           +  R +L     GH  N+    K +L  ++ +G ++LF D + +D
Sbjct:  508 YRPKFSRIKNQPEFLSSGLT---LRDYQMDGLNWLLHSWCKENSVILADEMGLGKTIQTICFLYSLFKIHHLYGPFLCVVPLSTMTAWQREFDLWAPDMNVVTYLGD-IKSRELIQQYEWQFESSKRLKFNCILTTYEIVLKDKQFLGTLQWAALLVDEAHRLKNDDSLLYKSLKEFDTNHRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFE------VQHGNAEDK--GYTRLHQQLEPYILRRVKKDVEKSLPAKVEQILRVEMTSLQKQYYKWILTKNFDALRKGKRGST-------STFLNIVIELKKCCNHAALIRPSEFELMGLQQDEALQTLLKGSGKLVLLDKLLCRLKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFNAEGSQDFCFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAQARAHRIGQKNQVNIYRLVTARSVEEQIVERAKQKMVLDHLVIQRMDTTGRTVLDKSGNGHSSNSNPFNKDDLSAILKFGAEELFKDEQEHD 1034          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Match: chd1l (chromodomain helicase DNA binding protein 1-like [Source:NCBI gene;Acc:393283])

HSP 1 Score: 547.354 bits (1409), Expect = 6.844e-179
Identity = 334/867 (38.52%), Postives = 482/867 (55.59%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVL-AXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH------EENTITKKKLNLKEMVCYGVDKLFSDNKNN--DVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDV--NHIYLFDGQNYKPKPSTSDFQALNRILK----DTKDCQQSKKKTKLDLDVS---------RPDRKITIN--------------------------------KKKQQMWDSNKYVSRKI-----EINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLP-------LKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            +L   GL  I LR YQ+DGV+W    +K+  G IL DEMGLGKT QTI  +  A   +     F+++ PL V+ NW+ E  +  P+L    Y G+K  R  ++ + + +    +++TTYE  L+D   +         +DE HR+KN ES+L+  + E    F+ LLTGTP+QNN  E+Y+LL  +  ++ +      E+  +  +D   +  L  + +   +L   +LRR KAE    LP+KTE+V+FHG++ LQK  YK+ILMRD++  +  T+++          L N+LMQ+RKC  HPYLF+G+E EPFE+G+HLV+ S KL ++D +L YL   GH +LLFSQMT+MLDI+QDY   R ++YERLDGSVR EER  AI NFS T+   +FLLST+AGG G+NLTAADTVIFVD DFNPQ DLQA AR HR GQ RP ++IRL+ R ++EEII SRA  KL +T  ++        ++       L L E++ +GVDKL S  +++  DV L       ILG +  DG+W    ++  +   N E   D    NH+Y F+G++Y   PS  D +    +L+    + +D ++  +  +    VS         R  R +T +                                KKK   WDS  Y S  +     E  D + +  D +  + +D     I ++ G+VT+P  D +++ II H VD+SG WG GGLF+A++  +     +Y  AG+M DL+LG+  + P       L     LAL+VAQ RD   +LS ++   L+   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T IYY+ R
Sbjct:   24 DLKKWGLGAIHLRPYQLDGVKWLSLCMKNQQGCILGDEMGLGKTCQTISLLAYARGSLKMNGPFLVLCPLAVLENWRQELERFCPSLSVICYTGDKERRAELQQNLKSDPRFHVLLTTYEMCLKDARYLKSWKWKILVVDEAHRLKNQESLLHQTLKEFTVGFRVLLTGTPIQNNLQEVYSLLTFIQPSVFLPEA--VEDFVNAYADIQTEPAL--VDELHQVLQPFLLRRVKAEVAAELPKKTELVVFHGLSALQKRYYKAILMRDLDAFR--TDQST------KTRLLNVLMQLRKCVDHPYLFDGVEPEPFEMGEHLVEASGKLSLLDSMLAYLQEGGHHVLLFSQMTRMLDILQDYLEYRGYSYERLDGSVRGEERNLAIKNFS-TKDVFIFLLSTKAGGVGMNLTAADTVIFVDGDFNPQNDLQAAARAHRIGQTRPVKVIRLLGRDTIEEIIYSRAVSKLRLTDTVIEEGRFSLLDQAQSAASGLQLSEILKFGVDKLLSSEESSVQDVDLQ-----LILGQS-RDGQWLTDEEHAKLNESNEEEDEDMEGQNHMYYFEGKDYSKDPSAEDEKTFELLLEKQFAEMEDAEKEGRALRNKAGVSLSGPLINPARKKRPLTESELEERRQKRQAAAAKRAKLQEERKKQQEELNYKKKMAWWDSCGYRSLCLPRVDSEGEDMEPDEDDHVSFSSTDSDHTAIRYVLGDVTHPQADREDA-IIVHCVDDSGHWGRGGLFTALELRSDEPRKQYELAGDMKDLELGNVLLFPVDDKQSRLCGRDYLALIVAQQRDKANKLSGIRLTALDEGLKKIYRAAKQKKASVHLPRIGHSTKGFNWYGTERLIRKHLATRGIFTSIYYYRR 870          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Match: smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:ZFIN;Acc:ZDB-GENE-070705-296])

HSP 1 Score: 325.094 bits (832), Expect = 2.344e-95
Identity = 217/580 (37.41%), Postives = 316/580 (54.48%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERT----NIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSK--DDNLDG----ILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKE---MVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIE-NINDDVNHIYLFDGQNYKPKPSTSDF 1795
            + N  LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P LK    +GNK ER     ++    EW+    + +T+YE ++++       N     +DE HRIKN +S L     E  T  + LLTGTP+QNN  EL++LL  +  ++  S            SDF    D N  G    + +  ++L   +LRR KAE  + LP K EV I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R F Y RLDG+   E R  AI+ F+   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +P ++ RL+   +VEE IV RA+ KL +   ++        + KL   E   M+ +G   +F+   + D  L++E   +IL  G   +    + +    + +L+N   +       +Y F+G++Y+ K     F
Sbjct:  138 IKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGNKDERAAFIRDVMMPGEWD----VCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIAREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNS-----------ASDFDSWFDTNCLGDQKLVERLHAVLRPFLLRRIKAEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDIL-------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVINSGKMVALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGFEYCRLDGNTPHEAREQAIDAFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQRKPVKVFRLITDNTVEERIVERAEMKLRLDSIVIQQGRLIDQQNKLGKDEMLQMIRHGATHVFA---SKDSELTDEDIDTILERGAKKTAEMNERMQNLGESSLRNFTVDTGATETSLYNFEGEDYREKQKVGVF 692          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:ZFIN;Acc:ZDB-GENE-021125-1])

HSP 1 Score: 320.087 bits (819), Expect = 1.615e-93
Identity = 215/564 (38.12%), Postives = 318/564 (56.38%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRNS---HEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENT-ITKKKLNLKEMVC---YGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            +LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + + NW NEF +  P+LK    +G++ ERT  IR++    EW+    + +T+YE L+ +       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +  ++L   +LRR KA+  + L  K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K     L N+LMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +IN F+E  S+K LF+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++        +  KL   EM+    +G   +F+  ++    +++E    IL  G+  +    + +    + +L+N     D  N +Y F+G++Y+ K
Sbjct:  162 KLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLKAVCLIGDREERTAFIRDTLLPGEWD----VCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDAWFDT--NNCLGDTKL--VERLHTVLRPFLLRRIKADVEKSLLPKKEIKIYVGLSKMQREWYTKILMKDIDIL-------NSAGKMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQGRLVDPSMNKLGKDEMLSIIRHGATHVFASKESE---ITDEDIDGILERGERKTMEMKEKMANLGEGSLRNF--TMDTENSVYNFEGEDYREK 705          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:568214])

HSP 1 Score: 291.967 bits (746), Expect = 8.167e-82
Identity = 186/501 (37.13%), Postives = 282/501 (56.29%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEE---LI--------MITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQ-ELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK----------EPFELGDHL---VDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL----GHEENTITK 1537
            QLR+YQ++GV W + +  +    ILADEMGLGKT+Q+I  +           F+I++PL+ + NW+ EF+  T ++   VY G+   R  I+    +  ++   LI        +ITT+E +L D  E+  I+     +DE HR+KN    L + +  +  + K LLTGTP+QN  +EL++LL  +      S   F       L +F      + + K  SIL  ++LRR K +  ++L  K E +I   +TD+QK  Y++IL R+ + L    T  +NV +  ++       M++RKC  HPYL  G E+          +P     HL   V ++ KL ++DKLL  L   GHK+L+FSQM + LDI++DY   + + YER+DG VR   R AAI+ FS+ +S + +FLL TRAGG G+NLTAADT +  DSD+NPQ DLQA AR HR GQ +  ++ RL+ R S E  ++ +A  KL + R +L    G++E++I +
Sbjct:  566 QLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIALLSEMFSAGVQSPFMIIAPLSTITNWEREFSNWT-DMNAIVYHGSLASRQMIQQYEMYCKDDKGHLIPGAYKFDALITTFEMILSDCPELREISWRCVVIDEAHRLKNRNCKLLDSLKMLEIEHKVLLTGTPLQNTVEELFSLLHFLEPAQFPSEIEF-------LREFGDLKTEEQVQKLQSILKPMMLRRLKEDVEKNLAPKQETIIEVELTDVQKKYYRAILERNFSFLSMGATQNSNVPNLLNTM------MELRKCCNHPYLITGAEEKIVSELREVYDPLAPDFHLQALVRSAGKLVLLDKLLPRLKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMLDKASLKLGLDRAVLQSMSGNKESSIQQ 1052          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Match: chd8 (chromodomain helicase DNA binding protein 8 [Source:NCBI gene;Acc:568214])

HSP 1 Score: 291.967 bits (746), Expect = 8.789e-82
Identity = 185/499 (37.07%), Postives = 281/499 (56.31%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEE---LI--------MITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQ-ELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK----------EPFELGDHL---VDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL----GHEENTI 1531
            QLR+YQ++GV W + +  +    ILADEMGLGKT+Q+I  +           F+I++PL+ + NW+ EF+  T ++   VY G+   R  I+    +  ++   LI        +ITT+E +L D  E+  I+     +DE HR+KN    L + +  +  + K LLTGTP+QN  +EL++LL  +      S   F       L +F      + + K  SIL  ++LRR K +  ++L  K E +I   +TD+QK  Y++IL R+ + L    T  +NV +  ++       M++RKC  HPYL  G E+          +P     HL   V ++ KL ++DKLL  L   GHK+L+FSQM + LDI++DY   + + YER+DG VR   R AAI+ FS+ +S + +FLL TRAGG G+NLTAADT +  DSD+NPQ DLQA AR HR GQ +  ++ RL+ R S E  ++ +A  KL + R +L    G++E+++
Sbjct:  886 QLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIALLSEMFSAGVQSPFMIIAPLSTITNWEREFSNWT-DMNAIVYHGSLASRQMIQQYEMYCKDDKGHLIPGAYKFDALITTFEMILSDCPELREISWRCVVIDEAHRLKNRNCKLLDSLKMLEIEHKVLLTGTPLQNTVEELFSLLHFLEPAQFPSEIEF-------LREFGDLKTEEQVQKLQSILKPMMLRRLKEDVEKNLAPKQETIIEVELTDVQKKYYRAILERNFSFLSMGATQNSNVPNLLNTM------MELRKCCNHPYLITGAEEKIVSELREVYDPLAPDFHLQALVRSAGKLVLLDKLLPRLKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMLDKASLKLGLDRAVLQSMSGNKESSV 1370          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Match: anxa4 (annexin A4 [Source:Xenbase;Acc:XB-GENE-854498])

HSP 1 Score: 317.39 bits (812), Expect = 4.812e-93
Identity = 211/570 (37.02%), Postives = 318/570 (55.79%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXX--XXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERT----NIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTS 1789
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI A+L +   +       +++ P + ++NW NEF +  P+L     +G+K  R     ++    EW+    + +T+YE ++++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +  ++L   +LRR KAE  + LP K EV I+ G+  +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+ V+DKLL      G ++L+FSQMT++LDI++DYC  R + Y RLDG    E+R      F+   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ RL+   +VEE IV RA+ KL +         ++  + N + K +  + +M+ +G   +F+   + D  L++E  T+IL  G+  +    + + K  + +L+N     D    +Y F+G++Y+ K   S
Sbjct:  129 LRDYQVRGLNWMISLYENGINGILADEMGLGKTLQTI-ALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWIPSLCAVCLIGDKNARAAFIRDVMMPGEWD----VCVTSYEMVIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDT--NNCLGDQKL--VERLHAVLKPFLLRRIKAEVEKSLPPKKEVKIYLGLGKMQREWYTKILMKDIDIL-------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVYNSGKMVVLDKLLPKFKEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGQTPHEQREVNTITFNSPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKTVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKDE--MLQMIRHGATHVFA---SKDSELTDEDITTILERGERKTAEMAERLQKMGESSLRNFS--VDTETSLYNFEGEDYREKQKLS 675          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 311.227 bits (796), Expect = 3.168e-91
Identity = 208/565 (36.81%), Postives = 317/565 (56.11%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K         +V  P + ++NW  EF +  P+L     +G+K  R   +R+     EW+    + +T+YE L+++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +   +L   +LRR KA+  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K+    L NILMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +I  ++   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++  ++  +  + LN      + +M+ +G   +F+   + D  ++ E   +IL  G+  +    + +    + +L+N     D+ + +Y F+G++Y+ K
Sbjct:   52 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWD----VCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDT--NNCLGDQKL--VERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDIL-------NSSGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVI--QQGRLVDQNLNKLGKDEMLQMIRHGATHVFA---SKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNF--TVDNESSVYNFEGEDYREK 594          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 311.612 bits (797), Expect = 5.712e-91
Identity = 209/569 (36.73%), Postives = 318/569 (55.89%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTS 1789
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K         +V  P + ++NW  EF +  P+L     +G+K  R   +R+     EW+    + +T+YE L+++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +   +L   +LRR KA+  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K+    L NILMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +I  ++   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++  ++  +  + LN      + +M+ +G   +F+   + D  ++ E   +IL  G+  +    + +    + +L+N     D+ + +Y F+G++Y+ K   S
Sbjct:  105 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWD----VCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDT--NNCLGDQKL--VERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDIL-------NSSGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVI--QQGRLVDQNLNKLGKDEMLQMIRHGATHVFA---SKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNF--TVDNESSVYNFEGEDYREKQKVS 651          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 311.227 bits (796), Expect = 1.238e-90
Identity = 208/565 (36.81%), Postives = 317/565 (56.11%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K         +V  P + ++NW  EF +  P+L     +G+K  R   +R+     EW+    + +T+YE L+++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +   +L   +LRR KA+  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K+    L NILMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +I  ++   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++  ++  +  + LN      + +M+ +G   +F+   + D  ++ E   +IL  G+  +    + +    + +L+N     D+ + +Y F+G++Y+ K
Sbjct:  128 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWD----VCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDT--NNCLGDQKL--VERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDIL-------NSSGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVI--QQGRLVDQNLNKLGKDEMLQMIRHGATHVFA---SKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNF--TVDNESSVYNFEGEDYREK 670          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Match: mettl6 (methyltransferase like 6 [Source:Xenbase;Acc:XB-GENE-5809155])

HSP 1 Score: 311.997 bits (798), Expect = 2.306e-90
Identity = 208/565 (36.81%), Postives = 317/565 (56.11%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K         +V  P + ++NW  EF +  P+L     +G+K  R   +R+     EW+    + +T+YE L+++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +   +L   +LRR KA+  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K+    L NILMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +I  ++   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++  ++  +  + LN      + +M+ +G   +F+   + D  ++ E   +IL  G+  +    + +    + +L+N     D+ + +Y F+G++Y+ K
Sbjct:  176 LRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRSIPGPHMVLVPKSTLHNWMAEFKRWVPSLCAICLIGDKDHRAAFVRDVLLPGEWD----VCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSAEDFDSWFDT--NNCLGDQKL--VERLHMVLKPFLLRRIKADVEKSLPPKKEIKIYVGLSKMQREWYTKILMKDIDIL-------NSSGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDKLLPRLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQDSIIAYNAPGSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRYITDNTVEERIVERAEMKLRLDSIVI--QQGRLVDQNLNKLGKDEMLQMIRHGATHVFA---SKDSEITEEDINAILERGEKKTAEMNEKLSNMGESSLRNF--TVDNESSVYNFEGEDYREK 718          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Match: Chd1l (chromodomain helicase DNA binding protein 1-like [Source:MGI Symbol;Acc:MGI:1915308])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 337/877 (38.43%), Postives = 488/877 (55.64%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL--GH----EENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKP-----VVKNNDVTLKNIENINDDV----NHIYLFDGQNYKPKPSTSDFQALNRILKDTKD-----------------------CQQSKKKTKL----DLDVSRPDRKITINKKKQQM------------------WDSNKYVSRKIEINDNDIE-----NSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRN 2506
            +L   GL+ I+LR YQ++GV W +      +G IL DEMGLGKT QTI  ++      + +   +V  PL+V++NWK E  +  P L    Y G+K ER  ++      +   +++TTYE  L+D   +   +     +DE HR+KN  S+L+  +SE    F+ LLTGTP+QN+  ELY+LL +V  + L  R++  E+   +  D  K+      L    +L   +LRR KA+    LP+KTEVV++HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+G+HL++ S KL ++D+LL +L   GH++LLFSQMT MLDI+QDY   R ++YER+DGSVR EER  AI NF   +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  ++  GH     +    +    L E++ +G+DKL S   ++   + +    SILG+T  DG+W P            +L+  E    +     NH+YLF+G++Y  +PS  D ++  +++   K                         +   K+ K+    +L+  R  R+    K+K+ M                  W+SN Y S  +   D+++E     +  S      D     IN++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LGD  + P+       K    LAL+VAQ RD    LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR   R+
Sbjct:   29 DLQQWGLTGIRLRSYQLEGVNWLVQCFHCQNGCILGDEMGLGKTCQTIALLIYLVGRLNDEGPFLVLCPLSVLSNWKEEMERFAPGLSCVTYTGDKEERARLQQDLRQESGFHVLLTTYEICLKDASFLKSFSWSVLAVDEAHRLKNQSSLLHRTLSEFSAVFRLLLTGTPIQNSLRELYSLLCVVEPD-LFCREQV-EDFVQRYQDIEKESKSASELH--RLLQPFLLRRVKAQVATELPKKTEVVVYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILTQLRKCVDHPYLFDGVEPEPFEVGEHLIEASGKLHLLDRLLAFLYSGGHRVLLFSQMTHMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFG-NQPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMVIEGGHFTPGAQKPSAEADFQLSEILKFGLDKLLSSEGSS---MEDIDLKSILGET-KDGQWTPDALPAAAAAGGGSLEPEEGSELESRSYENHMYLFEGRDYSKEPSKEDRKSFEQLVNLQKTLLEKTSHGGRTLRNKGSVLIPGLAEGPIKRKKILSPEELEDRRKKRQEAAAKRKRLMEEKRKEKEEAEHRKKMAWWESNGYQSFCLSSEDSELEDLEGGDESSAELAYEDLDSTSINYVSGDVTHPQAGEEDA-VIVHCVDDSGRWGRGGLFTALEVRSAEPRKIYELAGKMEDLSLGDVLLFPIDDKESRDKGQDLLALVVAQHRDRTNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLATRGIPTYIYYFPRSKARH 887          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 329.331 bits (843), Expect = 1.111e-96
Identity = 208/563 (36.94%), Postives = 317/563 (56.31%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSK--LSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P+L+   ++G+K  R           E  + +T+YE ++++       +     +DE HRIKN +S L   V E  +  + LLTGTP+QNN  EL+ LL  +  ++  S D F     +K  L D    + L  +LK        +LRR K +  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+   +H+V NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG    EER  AI+ F+   S+K +F+LSTRAGG G+NL +AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +         ++  + N + K++  + +M+ +G   +F+  ++    L++E   +IL  G+  +    + + K  + +L+N     D    +Y F+G++Y+ K
Sbjct:  187 LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKP------FLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVL-------NSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEE--MLQMIRHGATHVFACKESE---LTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFR--MDLEQSLYKFEGEDYREK 729          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 329.331 bits (843), Expect = 1.111e-96
Identity = 208/563 (36.94%), Postives = 317/563 (56.31%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSK--LSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P+L+   ++G+K  R           E  + +T+YE ++++       +     +DE HRIKN +S L   V E  +  + LLTGTP+QNN  EL+ LL  +  ++  S D F     +K  L D    + L  +LK        +LRR K +  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+   +H+V NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG    EER  AI+ F+   S+K +F+LSTRAGG G+NL +AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +         ++  + N + K++  + +M+ +G   +F+  ++    L++E   +IL  G+  +    + + K  + +L+N     D    +Y F+G++Y+ K
Sbjct:  187 LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKP------FLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVL-------NSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEE--MLQMIRHGATHVFACKESE---LTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFR--MDLEQSLYKFEGEDYREK 729          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 329.331 bits (843), Expect = 1.227e-96
Identity = 208/563 (36.94%), Postives = 317/563 (56.31%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSK--LSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P+L+   ++G+K  R           E  + +T+YE ++++       +     +DE HRIKN +S L   V E  +  + LLTGTP+QNN  EL+ LL  +  ++  S D F     +K  L D    + L  +LK        +LRR K +  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+   +H+V NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG    EER  AI+ F+   S+K +F+LSTRAGG G+NL +AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +         ++  + N + K++  + +M+ +G   +F+  ++    L++E   +IL  G+  +    + + K  + +L+N     D    +Y F+G++Y+ K
Sbjct:  187 LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKP------FLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVL-------NSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREEAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEE--MLQMIRHGATHVFACKESE---LTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFR--MDLEQSLYKFEGEDYREK 729          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Match: Smarca1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1 [Source:MGI Symbol;Acc:MGI:1935127])

HSP 1 Score: 321.627 bits (823), Expect = 3.645e-96
Identity = 208/575 (36.17%), Postives = 317/575 (55.13%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSK--LSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEER------------FAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P+L+   ++G+K  R           E  + +T+YE ++++       +     +DE HRIKN +S L   V E  +  + LLTGTP+QNN  EL+ LL  +  ++  S D F     +K  L D    + L  +LK        +LRR K +  + LP K E+ I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+   +H+V NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG    EER              AI+ F+   S+K +F+LSTRAGG G+NL +AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +         ++  + N + K++  + +M+ +G   +F+  ++    L++E   +IL  G+  +    + + K  + +L+N     D    +Y F+G++Y+ K
Sbjct:  182 LRDYQIRGLNWLISLYENGVNGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPSLRVICFVGDKDVRAAFIRDEMMPGEWDVCVTSYEMVIKEKSVFKKFHWRYLVIDEAHRIKNEKSKLSEIVREFKSTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSADDFDSWFDTKNCLGDQKLVERLHAVLKP------FLLRRIKTDVEKSLPPKKEIKIYLGLSKMQREWYTKILMKDIDVL-------NSSGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDEHIVGNSGKMVALDKLLARIKEQGSRVLIFSQMTRLLDILEDYCMWRGYEYSRLDGQTPHEEREDKFLEVELLGQREAIDAFNAPNSSKFIFMLSTRAGGLGINLASADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITDNTVEERIVERAEIKLRLDSIVIQQGRLIDQQSNKLAKEE--MLQMIRHGATHVFACKESE---LTDEDIVTILERGEKKTAEMNERMQKMGESSLRNFR--MDLEQSLYKFEGEDYREK 736          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q9CXF7|CHD1L_MOUSE (Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus OX=10090 GN=Chd1l PE=1 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 337/877 (38.43%), Postives = 488/877 (55.64%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL--GH----EENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKP-----VVKNNDVTLKNIENINDDV----NHIYLFDGQNYKPKPSTSDFQALNRILKDTKD-----------------------CQQSKKKTKL----DLDVSRPDRKITINKKKQQM------------------WDSNKYVSRKIEINDNDIE-----NSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRN 2506
            +L   GL+ I+LR YQ++GV W +      +G IL DEMGLGKT QTI  ++      + +   +V  PL+V++NWK E  +  P L    Y G+K ER  ++      +   +++TTYE  L+D   +   +     +DE HR+KN  S+L+  +SE    F+ LLTGTP+QN+  ELY+LL +V  + L  R++  E+   +  D  K+      L    +L   +LRR KA+    LP+KTEVV++HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+G+HL++ S KL ++D+LL +L   GH++LLFSQMT MLDI+QDY   R ++YER+DGSVR EER  AI NF   +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  ++  GH     +    +    L E++ +G+DKL S   ++   + +    SILG+T  DG+W P            +L+  E    +     NH+YLF+G++Y  +PS  D ++  +++   K                         +   K+ K+    +L+  R  R+    K+K+ M                  W+SN Y S  +   D+++E     +  S      D     IN++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LGD  + P+       K    LAL+VAQ RD    LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR   R+
Sbjct:   29 DLQQWGLTGIRLRSYQLEGVNWLVQCFHCQNGCILGDEMGLGKTCQTIALLIYLVGRLNDEGPFLVLCPLSVLSNWKEEMERFAPGLSCVTYTGDKEERARLQQDLRQESGFHVLLTTYEICLKDASFLKSFSWSVLAVDEAHRLKNQSSLLHRTLSEFSAVFRLLLTGTPIQNSLRELYSLLCVVEPD-LFCREQV-EDFVQRYQDIEKESKSASELH--RLLQPFLLRRVKAQVATELPKKTEVVVYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILTQLRKCVDHPYLFDGVEPEPFEVGEHLIEASGKLHLLDRLLAFLYSGGHRVLLFSQMTHMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFG-NQPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMVIEGGHFTPGAQKPSAEADFQLSEILKFGLDKLLSSEGSS---MEDIDLKSILGET-KDGQWTPDALPAAAAAGGGSLEPEEGSELESRSYENHMYLFEGRDYSKEPSKEDRKSFEQLVNLQKTLLEKTSHGGRTLRNKGSVLIPGLAEGPIKRKKILSPEELEDRRKKRQEAAAKRKRLMEEKRKEKEEAEHRKKMAWWESNGYQSFCLSSEDSELEDLEGGDESSAELAYEDLDSTSINYVSGDVTHPQAGEEDA-VIVHCVDDSGRWGRGGLFTALEVRSAEPRKIYELAGKMEDLSLGDVLLFPIDDKESRDKGQDLLALVVAQHRDRTNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLATRGIPTYIYYFPRSKARH 887          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q86WJ1|CHD1L_HUMAN (Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L PE=1 SV=3)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 334/865 (38.61%), Postives = 480/865 (55.49%), Query Frame = 2
Query:   89 DMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI--------------------------------------------LKD-TKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKI---EINDNDIENSD--SIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            + +L   GL+ I LR YQ++GV W        +G IL DEMGLGKT QTI   +      + +   ++  PL+V++NWK E  +  P L    Y G+K ER  ++   +  +   +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F  LLTGTP+QN+  ELY+LL+ V  + L S++    +   +  D  K+   +   +   +L   +LRR KAE    LP+KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET     +    L NIL Q+RKC  HPYLF+G+E EPFE+GDHL + S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +   +FLLSTRAGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL +   +    +      SILG+T  DG+W  V            +  +  NH+YLF+G++Y  +PS  D ++  ++                                            L+D  K  Q++  K +  ++  +  ++   +KKK   W+SN Y S  +   E    D+EN +  S   +  D     + ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       K    LAL+VAQ RD +  LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:   33 EQDLRQWGLTGIHLRSYQLEGVNWLAQRFHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEEVG-DFIQRYQDIEKES--ESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NET-----AKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGS---TMDEIDLESILGET-KDGQW--VSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDA-LIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPR 877          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q3B7N1|CHD1L_BOVIN (Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus OX=9913 GN=CHD1L PE=2 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 328/863 (38.01%), Postives = 472/863 (54.69%), Query Frame = 2
Query:   89 DMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKK------LNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRIL--------KDTKDCQQSKKKTKLDLD-----------VSRPDRKITINKKKQQM--------------------------WDSNKYVSRKI---EINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            + +L   GL+ I LR YQ+ GV W        +G IL DEMGLGKT QTI   +      + +   ++  PL+V++NWK E  +  P L    Y G+K +R  ++   +  +   +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F  LLTGTP+QN+  ELY+LL+ V  + L S+++  E+   +  D  K+      L    +L   +LRR KAE    LP KTEVVI+HGM+ LQK  YK+ILM+D++  +   NET  + K  +        Q+RKC  HPYLF+G+E EPFE+GDHL++ S KL ++DKLL +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  AI NF + +    FLLSTRAGG G+NLTAADTVIF DSDFNPQ DLQA AR HR GQ +  ++IRL+ R +VEEI+  +A  KL +T  I+     T+  +K      L L E++ +G+DKL S   +    +      SILG+T+ DG W  V        +      +  NH+YLF+G++Y  +PS  D ++  +++        K +++ +  + K  + +            +  P+      K++Q+                           W+SN Y S  +   E    D E+  S      D     I ++SG+VT+P    +++ +I H VD+SG WG GGLF+A++  ++     Y  AG+M DL LG   + P+       +    LAL+VAQ RD    LS +K   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T+IYYFPR
Sbjct:   35 EQDLRQWGLTGIHLRPYQLQGVNWLAQCFHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMERFAPGLSCVTYAGDKDKRACLQQDLKQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPD-LFSKEQV-EDFVQRYQDIEKESESASELY--KLLQPFLLRRVKAEVATELPRKTEVVIYHGMSALQKKYYKAILMKDLDAFE---NETAKKVKLQNVLS-----QLRKCVDHPYLFDGVEPEPFEIGDHLIEASGKLHLLDKLLAFLYSKGHRVLLFSQMTQMLDILQDYLDYRGYSYERVDGSVRGEERHLAIKNFGQ-QPIFTFLLSTRAGGVGMNLTAADTVIFFDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNTIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLSSEGST---MHEIDLKSILGETE-DGHW--VSDALPTAEEGSREPEEGKNHMYLFEGKDYSKEPSKEDRESFEQLVNLQKTLLEKTSQEGRLLRNKGSVPIPGLVEGSTKRKRILSPEELEDRRKRRQEAAAKRKRLLEEKRKKKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDGEDESSAQLEYEDPDSTSIRYVSGDVTHPQAGAEDA-VIVHCVDDSGRWGRGGLFTALETRSAEPRKRYELAGKMKDLSLGGVLLFPIDDKESRNEGQDLLALIVAQHRDRANVLSGIKMAALEEALKKIFLAAKKRKASVHLPRIGHATKGFNWYGTERLIRKHLASRGIPTYIYYFPR 877          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Match: sp|Q7ZU90|CHD1L_DANRE (Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio OX=7955 GN=chd1l PE=2 SV=1)

HSP 1 Score: 546.584 bits (1407), Expect = 7.581e-178
Identity = 335/867 (38.64%), Postives = 483/867 (55.71%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVL-AXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH------EENTITKKKLNLKEMVCYGVDKLFSDNKNN--DVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDV--NHIYLFDGQNYKPKPSTSDFQALNRILK----DTKDCQQSKKKTKLDLDVS------RPDRK-------------------------ITINKKKQQ----------MWDSNKYVSRKI-----EINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLP-------LKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            +L   GL  I LR YQ+DGV+W    +K+  G IL DEMGLGKT QTI  +  A   +     F+++ PL V+ NW+ E  +  P+L    Y G+K +R  ++ + + +    +++TTYE  L+D   +         +DE HR+KN ES+L+  + E    F+ LLTGTP+QNN  E+Y+LL  +  ++ +      E+  +  +D   +  L  + +   +L   +LRR KAE    LP+KTE+V+FHG++ LQK  YK+ILMRD++  +  T+++          L N+LMQ+RKC  HPYLF+G+E EPFE+G+HLV+ S KL ++D +L YL   GH +LLFSQMT+MLDI+QDY   R ++YERLDGSVR EER  AI NFS T+   +FLLST+AGG G+NLTAADTVIFVD DFNPQ DLQA AR HR GQ RP ++IRL+ R ++EEII SRA  KL +T  ++        ++       L L E++ +GVDKL S  +++  DV L       ILG +  DG+W    ++  +   N E   D    NH+Y F+G++Y   PS  D +    +L+    + +D ++  +  +    VS       P RK                         +   +KKQQ           WDS  Y S  +     E  D + +  D +  + +D     I ++ G+VT+P  D +++ II H VD+SG WG GGLF+A+   +     +Y  AG+M DL+LG+  + P       L     LAL+VAQ RD   +LS ++   L+   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI T IYY+ R
Sbjct:   24 DLKKWGLGAIHLRPYQLDGVKWLSLCMKNQQGCILGDEMGLGKTCQTISLLAYARGSLKMNGPFLVLCPLAVLENWRQELERFCPSLSVICYTGDKEKRAELQQNLKSDPRFHVLLTTYEMCLKDARYLKSWKWKILVVDEAHRLKNQESLLHQTLKEFTVGFRVLLTGTPIQNNLQEVYSLLTFIQPSVFLPE--AVEDFVNAYADIQTEPAL--VDELHQVLQPFLLRRVKAEVAAELPKKTELVVFHGLSALQKRYYKAILMRDLDAFR--TDQST------KTRLLNVLMQLRKCVDHPYLFDGVEPEPFEMGEHLVEASGKLSLLDSMLAYLQEGGHHVLLFSQMTRMLDILQDYLEYRGYSYERLDGSVRGEERNLAIKNFS-TKDVFIFLLSTKAGGVGMNLTAADTVIFVDGDFNPQNDLQAAARAHRIGQTRPVKVIRLLGRDTIEEIIYSRAVSKLRLTDTVIEEGRFSLLDQAQSAASGLQLSEILKFGVDKLLSSEESSVQDVDLQ-----LILGQS-RDGQWLTDEEHAKLNESNEEEDEDMEGQNHMYYFEGKDYSKDPSAEDEKTFELLLEKQFAEMEDAEKEGRALRNKAGVSLSGPLINPARKKRPLTEAELEERRQKRQAAAAKRAKLQEERKKQQEELNYKKKMAWWDSCGYRSLCLPRVDSEGEDMEPDEDDHVSFSSTDSDHTAIRYVLGDVTHPQADREDA-IIVHCVDDSGHWGRGGLFTALGLRSDEPRKQYELAGDMKDLELGNVLLFPVDDKQSRLCGRDYLALIVAQQRDKANKLSGIRLTALDEGLKKIYKAAKQKKASVHLPRIGHSTKGFNWYGTERLIRKHLATRGIFTSIYYYRR 870          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Match: sp|F4IV45|CHR10_ARATH (Probable helicase CHR10 OS=Arabidopsis thaliana OX=3702 GN=CHR10 PE=3 SV=1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.206e-123
Identity = 296/865 (34.22%), Postives = 450/865 (52.02%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILA-DEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL---------IMITTYEYLL--QDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSE---IPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSK-DDNLDGILKTDS---------ILNKLILRRTKAEQLQH----LPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELT----NETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-----------FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNND-------VVLSN--EFFTSILGDTDSDGRWKPV-VKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQ----MWDSNKYVSRKIE--INDNDIENSDSIMRNPSDESDFG-INFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-----KLNIQ----LALLVAQTRDDNGR----LSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYK--TPRFNWYSIEKLINKHFTEQGIDTFIYYFPR 2491
            L+ +Q++GV W I         +L  D+MGLGKT+Q I  +   K         +V  PL+V + W +E N+ TPNL+   Y+G+K  R ++R S   + ++          +++TTY+  L  QDF+  + I      +DE  R+KN  SVLYN + E   IP +   L+TGTP+QNN  EL+ L+      +  + D+F       LS F +  D L G+  ++          IL   +LRRTK+  ++     LP  TE+ +   +  LQK +Y SIL +++  L EL+    N T++++           +Q+RK   HPYLF GIE EPFE G+HLV  S KL V+D+LL  L   GH++LLFSQMT  LDI+QD+  LR ++YERLDGSVR+EERFAAI NFS      L           F++STRAGG GLNL AADTVIF + D+NPQVD QA+ R HR GQ      I LV  +SVEE+I+ RA+RKL ++  ++G       +   +L+ +V +G+ +   +  +N+       V +S+  E   +I  + + D   +   + ++D  L N  + + D       D  +Y      S  + L    + +KD +  +   + +L   R  R     KK ++     W ++ Y S  +E  I  +D+++S          SD G +NF+ G+ TNP        II   VD+SG+WG GG+F A+  +++ +   Y  A E  DL LGD H++ +     + N Q    L + VA T+  N R     S +    LE C  K    A   +AS+H+ R+GY+  + R  WY++E+L+ K+ +   +  F+YY+ R
Sbjct:   51 LKPHQVEGVSWLIQKYLLGVNVVLELDQMGLGKTLQAISFLSYLKFRQGLPGPFLVLCPLSVTDGWVSEINRFTPNLEVLRYVGDKYCRLDMRKSMYDHVKKSSKGHFLPFDVLLTTYDIALVDQDFL--SQIPWQYAIIDEAQRLKNPNSVLYNVLLEQFLIPRRL--LITGTPIQNNLTELWALMHFCMPLVFGTLDQF-------LSAFKETGDGLSGLDVSNDKETYKSLKFILGAFMLRRTKSLLIESGNLVLPPLTELTVMVPLVSLQKKIYTSILRKELPGLLELSSGGSNHTSLQNIV---------IQLRKACSHPYLFPGIEPEPFEEGEHLVQASGKLLVLDQLLKRLHDSGHRVLLFSQMTSTLDILQDFMELRRYSYERLDGSVRAEERFAAIKNFSAKTERGLDSEVDGSNAFVFMISTRAGGVGLNLVAADTVIFYEQDWNPQVDKQALQRAHRIGQISHVLSINLVTEHSVEEVILRRAERKLQLSHNVVGDNMEEKEEDGGDLRSLV-FGLQRFDPEEIHNEESDNLKMVEISSLAEKVVAIRQNVEPDKEERRFEINSSDTLLGNTSSASLDSE----LDEASY-----LSWVEKLKEAARSSKDEKIIELGNRKNLSEERNLRIEAARKKAEEKKLATWGAHGYQSLSVEEPILPDDVDSS----------SDAGSVNFVFGDCTNPSTVSHEPAIIFSCVDDSGNWGRGGMFDALSKLSNTVPTAYHRASEFKDLHLGDLHLIKIDDNDDQQNTQASKPLWVAVAVTQSYNSRRKVPRSSISIPDLESCLAKASFSASQKSASLHMPRIGYQDGSDRSQWYTVERLLRKYSSIFTVKIFVYYYRR 875          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Match: A0A1S3IU14 (chromodomain-helicase-DNA-binding protein 1-like OS=Lingula unguis OX=7574 GN=LOC106167452 PE=4 SV=1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 376/986 (38.13%), Postives = 544/986 (55.17%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTIC-AVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEE-----LIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDF---SKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREI-------LG----HEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPV-VKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI-------LKDTKDCQQSKKKTKLDL-----DVSR-PDRKITINKKKQQM--------------------------------WDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR--------------DLKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASFDGQLTDNPMDGNITHFLLSNKMXXXXX-----XXXXXXXXXVKVDWVMKCI 2776
            +L   GL  I+LR YQ+ GV W I     +HG IL DEMGLGKT QTI   V  +    +    +I+ PL+V+ NWK+E N+  P LK   Y+G+K  R  +R+  +   E       +++TTYE  L+D   +  I      +DE HR+KN ES+L+  +     +   LLTGTP+QNN  ELY+LL  VA ++   + R+ E    + SD    SKD N         +L   ILRR K E L+ LP+K+EVV++HG+T LQK  YK+IL +D         E+          L NILMQ+RKC  HPYLF+G+E EPFELG+HLV+ S KL +ID+LL YL P GHK+LLFSQMT+MLDIIQDY   R ++YERLDGSVR EERF A+ NF++ + T +FLLST+AGGQGLNL +ADTVIF+DSDFNPQ DLQA AR HR GQ R  +++RL+ R +VEEI++ RA+ KL +T+ +       LG    ++E  I    + L++++ +GVD+LF   ++ +  L    F  ILG T   G W+   V+     L + E  +DDV ++Y+F+G++Y    S  D +A +++       L+++   ++S +K K  L     DV R P +++T  +K+++                                 W +N Y S  +E++    E  +             I ++SG+VT+P    D    I H VD+SG+WGSGGLFSA+   +    I+Y  AG M DL LGD H++ +       K +   AL+V Q RD   +LS +K   LE   +++   A   NAS+HL R+GY TP FNWY  E+LI K    +GI T+IYY+PR                KR   + V    S          +  +FH   +KE K+ L RY+ ++DG ++ + +D + TH L++ + +   +        NE++  VK++W+  C+
Sbjct:   24 DLEKFGLEGIKLRPYQLSGVNWLIQRYARSHGCILGDEMGLGKTCQTISFLVYLYGSQKNHGPHLILCPLSVIGNWKDELNRFAPKLKLLSYLGDKDTRGELRDKVKEEKEGDHFPFHVLLTTYEVCLKDSSFLAEIPWRTLVVDEAHRLKNQESLLHQTLKGFTIEHHILLTGTPVQNNLTELYSLLCFVAPHVF--KWRYLEEFLDRYSDVDNSSKDRN-----DLHKLLKPFILRRVKNEVLKDLPKKSEVVLYHGLTALQKKYYKAILTKDTEAF-----ESGNPYGPPKTCLMNILMQLRKCVDHPYLFDGVEPEPFELGEHLVEASGKLVLIDQLLAYLRPRGHKVLLFSQMTRMLDIIQDYLGYRGYSYERLDGSVRGEERFLAVQNFNQQDDTFIFLLSTKAGGQGLNLVSADTVIFIDSDFNPQNDLQAAARAHRIGQKRAVKVLRLIGRSTVEEIVLRRAEAKLKLTQSVIEGGQFSLGAGSVNKEALIADDSIQLQDILKFGVDQLF---ESEEGTLEEVDFDQILGPT-KKGHWQSEDVEQTAAELADEEEGSDDVENMYVFEGKDYSKGSSDDDKKAFDQLLAAEVAKLEESTSAERSLRKKKGLLLSALPDVPRKPRKQLTEEEKEERKRKRAETAARRAQEAEEEEVRRAQERRQRREEKWAANNYTSCNVELDSEGEEEEEEDGGGSQQ-----ICYVSGDVTHPSHTGDEDAFIVHCVDDSGNWGSGGLFSALSARSQQPEIQYELAGSMRDLALGDTHIIQVDDLQSREKGSDMAALIVTQHRDRKNKLSGIKLPALEEGLQRLYKVAKQRNASVHLPRIGYNTPGFNWYGTERLIRKWLAAKGIPTYIYYYPRKKAAKRRHSDDCEQKSKRKPSDKVPSASSSSSLPVYMQGVNAYFHHIPEKEAKK-LKRYLVAYDGDVSRD-VDESTTHILINGEKQEDTEIFQRWSEENEDLKIVKLNWLQDCL 986          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Match: A0A1S3HSU4 (chromodomain-helicase-DNA-binding protein 1-like OS=Lingula unguis OX=7574 GN=LOC106157858 PE=4 SV=1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 365/938 (38.91%), Postives = 513/938 (54.69%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTIC-AVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRN--SHEWNAEEL---IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDF---SKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREI-------LG----HEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPV-VKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRI-------LKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQM-----------------------------------------WDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPR--------------DLKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASF 2638
            +L   GL  I+LR YQ+ GV W I+    +HG IL DEMGLGKT QTI   V  +    +    +I+ PL+V+ NWK+E N+  P LK   Y+G+K  R  +R+  S E   +     +++TTYE  L+D   +  I      +DE HR+KN ES+L+  +     +   LLTGTP+QNN  ELY+LL  VA ++   + R+ E    + SD    SKD N         +L   ILRR K E L+ LP+K+EVV++HG+T LQK  YK+IL +D         E+          L NILMQ+RKC  HPYLF+G+E EPFELG+HLV+ S KL +ID+LL YL P GHK+LLFSQMT+MLDIIQDY   R ++YERLDGSVR EERF A+ NF++ + T +FLLST+AGGQGLNL +ADTVIFVDSDFNPQ DLQA AR HR GQ R  +++RL+ R +VEEI++ RA+ KL +T+ +       LG    ++E  I    + L++++ +GVD+LF   +     L    F  ILG T   G W+   V+     L + E  +DDV ++Y+F+G++Y    S  D +A +++       L+++   ++S +K K  L  + PD      K ++Q+                                         W +N Y S  +E++    E  +      S +    I ++SG+VT+P    D    I H VD+SG WGSGGLFSA+   +    I+Y  AG M DL LGD H++P+       K +   AL+V Q RD   +LS +K   LE   +++   A   NAS+HL R+GY TP FNWY  E+LI K    +GI T+IYY+PR                KR   + V    S          +  +FH   ++E K+ L RY+ ++
Sbjct:   24 DLEKFGLEGIKLRPYQLSGVNWLIERYARSHGCILGDEMGLGKTCQTISFLVYLYGSQKNHGPHLILCPLSVIGNWKDELNRFAPKLKLLSYLGDKDTRGELRDKVSEEKEGDHFPFHVLLTTYEVCLKDSSFLAEIPWRTLVVDEAHRLKNQESLLHQTLKGFTIEHHILLTGTPIQNNLTELYSLLCFVAPHVF--KWRYLEEFLDRYSDVDNSSKDRN-----DLHKLLKPFILRRVKNEVLKDLPKKSEVVLYHGLTALQKKYYKAILTKDTEAF-----ESGNPYGPPKTRLMNILMQLRKCVDHPYLFDGVEPEPFELGEHLVEASGKLVLIDQLLAYLRPRGHKVLLFSQMTRMLDIIQDYLGYRGYSYERLDGSVRGEERFLAVQNFNQQDDTFIFLLSTKAGGQGLNLVSADTVIFVDSDFNPQNDLQAAARAHRIGQKRAVKVLRLIGRSTVEEIVLRRAEAKLKLTQSVIEGGQFSLGAGSVNKEALIADDSIQLQDILKFGVDQLFDSEEG---TLEEVDFDQILGPT-KKGHWQSEDVEQTAAELADEEEGSDDVENMYVFEGKDYSKGSSDDDKKAFDQLLAAEVAKLEESTSAERSLRKKKGLLLTALPD---VPRKPRKQLTEEEKEERKRKRAETAARRAQEAEEEEVRRAQERRQRREEKWAANNYTSCNVELDSEGEEEEEEEDGGGSQQ----ICYVSGDVTHPSHTGDEDAFIAHCVDDSGHWGSGGLFSALSARSQQPEIQYELAGSMRDLALGDTHIIPVDDLQSREKGSDMAALIVTQHRDRKNKLSGIKLPALEEGLQRLYKVAKQRNASVHLPRIGYNTPGFNWYGTERLIRKWLAAKGIPTYIYYYPRKKAAKRRHLDDYEQKSKRKPSDKVPSASSSSSLPVYMQGVNAYFHHIPEEEAKK-LKRYLVAY 937          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Match: A0A210PIP9 (Chromodomain-helicase-DNA-binding protein 1-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17981 PE=4 SV=1)

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 364/912 (39.91%), Postives = 512/912 (56.14%), Query Frame = 2
Query:   86 SDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAX--XXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIER----TNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVI----NLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENT------ITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRIL------------------------------------------------KDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRN----PSDESDFG------INFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPLKLNIQ-------LALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRD---LKRNS-----PNAVTLKLSEKYFK 2551
            S+  L + G +++ LR YQ+ GV W I+  +  HG IL DEMGLGKT QTI A LA+       +   +I+ P +++ NW  E  K  P +K   Y+GNK ER      +R   +   +   +++TTYE  L+D  E+N      +  A  +DE HR+KN ES+LY  + +  T+ + LLTGTP+QNN +ELY+LL+ V  +    R    E    K  D  +     G+ +  ++L   +LRRTK   L+ LP+K+EVV++HG++ LQK +YK+IL +D+++ Q   N         +  L NILMQ+RKC  HPYLF+G+E EPF LG+HLV+ S KL +IDKLL +L   GHK+LLFSQMT MLDIIQDY   R + YERLDGSVR EERF A+ NF++ E T +FLLSTRAGGQGLNL AADTVIFVDSDFNPQ DLQA AR HR GQ RP +I+RL+ R +VEEII+ RA+ KL +T +++   + T      IT  K+ L++++ +GVD L  DN  ++  +    FT ILG +  +G W+P  +  +V       + +  + +Y F+G +Y  +PS  D +A  ++L                                                   K+ ++ K K   +    R D+K    K+++ MW++  Y+S  ++I  ++ E  +           +E D G      I+++SG+VT P+       +I H  D+SGSWG GGLFSAI   +S    +Y  AG+M DL LG+CH++ L  N         LAL++AQ RD    LS +K   L+   K V   A +  AS+HL R+G+ TP FNWY  E+LI KH T +GI TFIYY+PR    LKR S     P A   K+S   FK
Sbjct:   23 SNDKLKDFGWTDLPLRPYQLTGVNWLIECYQKGHGAILGDEMGLGKTCQTI-AFLAYIDSRAKKWHPNLIICPRSILENWVAELTKFAPEIKVKSYVGNKDERNALAKELRTQVKAGRQPFSVLVTTYELCLKD-AELNGFLASQDWRAVVVDEAHRLKNSESLLYTTLKQWSTRHRVLLTGTPVQNNLEELYSLLSFVCPSSF--RLSGVEKFLRKFKDIERSK---GVSELHALLQPYLLRRTKEGVLKDLPKKSEVVLYHGISKLQKKVYKAILTKDLSVFQTRGNYPGG--GGGTPRLMNILMQLRKCVNHPYLFDGVEPEPFLLGEHLVEASGKLVLIDKLLSHLKQTGHKVLLFSQMTHMLDIIQDYLGYRDYTYERLDGSVRGEERFLAVQNFNKNEETFIFLLSTRAGGQGLNLVAADTVIFVDSDFNPQNDLQAAARAHRIGQVRPVKIMRLIGRNTVEEIILRRAEDKLHLTEKVIEEGQFTLGAKSLITNDKVGLQDILKFGVDTLLDDNDTDETDVD---FTQILGPS-VNGEWQP-EEEPEVKTSQSAVLEEAPSSMYEFEGTDYSKEPSAEDIKAFEKLLAVEKQVLDEEYTAERSSRGKATQVLELFPGVKRKPRTPLTAEELEERNAKRKETEERKAKLAEEKKARREDQK---RKQREDMWNAAGYISSCVQIESDEEEEENGEDEEEFDLTQEEEDGGVAKNRSISYVSGDVTCPVTGGTQVNVIVHCADDSGSWGRGGLFSAIGRRSSAPQEQYELAGDMGDLALGNCHLIALDDNHTRDGEEDWLALVIAQHRDKRNNLSGIKLSALQQGLKAVHYLAKARKASVHLPRIGHDTPWFNWYGTERLIKKHLTAEGIPTFIYYYPRKQQLLKRKSSEDSDPPAKKKKISTVSFK 917          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Match: A0A3B3VMG3 (Chromodomain helicase DNA binding protein 1-like OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 376/1023 (36.75%), Postives = 549/1023 (53.67%), Query Frame = 2
Query:   62 KSTFALMKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTIT--------KKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNI------ENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTK---------------------------DCQQSKKKTKLDLDVSRPDR--------KITINKKKQQ----------MWDSNKYVSRKIEINDN---------DIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLP-------LKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNS--------------------------------PNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASFDGQLTDNPMDGNITHFL--LSNKMXXXX---XXXXXXXXXXVKVDWVMKCISEKE 2788
            K   AL +SD+  F  GL  IQLR YQ+DGVQW   S+  + G IL DEMGLGKT QTI  ++        K   +V SPL+V+ NW+ E     P+L    Y G+K  R  I+   E  A++  +++TTYE  L+D   +     +   +DE HR+KN  SVL+  ++E    F+ LLTGTP+QNN  ELY+LL+ +  +I    +   ++  S  SD      L   L+  SIL   +LRR K+E    LP+KTE+V++HGM+ LQK  YK+ILMRD +          V  + S   L NIL+ +RKC  HPYLF+G+E EPF++G+HL++ S KL ++D +L +L   GH++LLFSQMT+MLDI+QDY   R ++YER+DGSVR EER  A+ NFS T+   +FLLST+AGG GLNLTAADTV+FVDSDFNPQ DLQA AR HR GQ RP ++IRL+AR +VEEI+ SRA  KL +T  ++  EE   +           L L E++ +GVDKL S ++++   +       ILG +  DG+W     ++D     +      E+ +D+ NH+Y F+G++Y   PS+ D ++ +RIL++                               ++ K  T+ +L++ R  R        K+  +KK+Q+           W+S  Y S  +++ D+         + E++ S+    S  +D  I ++ G+VT+P        II H VD+SG WG GGLF+A++  +      Y  AG+M DL+LG+  + P       L    QLAL+VAQ RD    L+ +    L+   KK+   A  NNAS+HL R+G+ T  FNWY  E+LI KH   +GI TFIYY  R +K+ +                                P+A+    S     S    +   F+     E KR L RY+ ++DG   ++ M   +TH +  + N ++  E       N++ V VK  W+  C S+++
Sbjct:   15 KKKTALSQSDLQTF--GLRGIQLRAYQLDGVQWLTQSLHDHQGCILGDEMGLGKTCQTISLLVYVSGALGKKGPFLVLSPLSVMENWRKELESFAPSLTVLCYKGDKERRAEIQR--EQTAQDFQVLLTTYELCLKDASFLKRWRWEVLVVDEAHRLKNQNSVLHKTLTEFSVGFRLLLTGTPIQNNLQELYSLLSFIQPSIFTPEE--ADSFVSSYSDVRSRPALASELQ--SILEPFLLRRVKSEVAFDLPKKTELVVYHGMSALQKKYYKAILMRDYDAF--------VNEQGSKNRLLNILVNLRKCVDHPYLFDGVEPEPFQIGEHLIEASGKLCLLDSILAFLYKGGHRVLLFSQMTRMLDILQDYMEYRGYSYERMDGSVRGEERNLAVKNFS-TKDIFVFLLSTKAGGVGLNLTAADTVVFVDSDFNPQNDLQAAARCHRIGQNRPVKVIRLLARDTVEEIMYSRAVSKLQLTNTVI--EEGRFSLLDQVQSAAAGLQLSEILKFGVDKLLSSDESS---IQEVRLEKILGPS-RDGQWVDDDDDDDDGFSPLEEEVENESDSDEQNHMYFFEGKDYSKDPSSEDQRSFDRILEEQMAEFQKAAGEGRALRRKAGSSLSVAFAIPVRKRKPLTEAELELRRQRRQEAAAKRAKMMEDKKRQEEEEKRRKKTAWWESCGYQSLCLQLVDSEEEEEDEEDEEEDNSSVCSTDSTSTD--ICYVLGDVTHP-HTARGDAIIVHCVDDSGRWGRGGLFTALEVRSDEPRKHYELAGKMKDLELGNVLLFPIDDKQSRLDGRDQLALIVAQKRDKANNLTGILLSALDEGLKKIYSAAKKNNASVHLPRIGHSTKGFNWYGTERLIRKHLASRGIPTFIYYHSRAVKKTASHQTPATSAAARQASLPSSDGPTDETETEGPGPSALPRGFSPAELPSFMKGVRLFFYNIPASERKR-LARYLITYDGD-EEDVMSEEVTHIVAEVENHIQIQELLDLVRQNQQAVPVKTAWLESCFSKQQ 1009          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Match: A0A1A8A3Q1 (Chromodomain helicase DNA binding protein 1-like OS=Nothobranchius furzeri OX=105023 GN=CHD1L PE=4 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 371/997 (37.21%), Postives = 537/997 (53.86%), Query Frame = 2
Query:   62 KSTFALMKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH------EENTITKKKLNLKEMVCYGVDKLFSDNKNN--DVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSD--------------FQ---ALNRILKDTKDC----------QQSKKKTKLDLDVSRPDRKITINKKKQQM------------------WDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLP-------LKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSPNAVTLKLSEKYFKS----------------------IFSKLIFHFHESVDKETKRILTRYIASFDGQLTDNPMDGNITHFLLS-----NKMXXXXXXXXXXXXXXVKVDWVMKCISEK 2785
            K TF   +S++  F  GL  I+LR YQ+DGVQW +    +  G ILADEMGLGKT QTI  ++        K   +V SPL+V+ NW+NE  +  P+L    Y G+K  R  I+   E N ++  +++TTYE  L+D   +         +DE HR+KN  S+L+  +SE    F+ LLTGTP+QNN  ELY+LL+ +  +I  + D   ++  +  S+      L   L+  SIL   +LRR K+E    LP+K E+V++HGM+ LQK  YK+IL++D+          N         L NILM +RKC  HPYLF+G+E EPFE+G+HLV+ S KL ++D+LL +L   GH++LLFSQMT+MLDI+QDY   R ++YERLDGSVR EER  A+ NFS ++   +FLLST+AGG GLNLTAADTVIFVDSDFNPQ DLQA AR HR GQ RP ++IRL+AR +VEEI+ SRA  KL +T  ++        ++       L L E++ +G+DKL S ++++  DV L       ILG    DG+W  + +     L+  E+  + ++H+Y F+G++Y   PS+ D              FQ   A  R L+               ++ K  T+ +L++ R  R+ T  KK +                    W S  Y S  ++  D+D E  D+     +D +   I ++ G+VT+P     ++ II H VD+SG WG GGLF+A++  +     +Y  AG+M DL LG+  + P       L    QLAL+VAQ RD +  LS +    L+   KK+   A  + AS+HL R+G  T  F WY  E+LI KH   +GI TFIYY  R   R++P  VT    E   +S                       F K +  F  ++    ++ L+RY+ ++DG   ++ M   +TH +       +K E  +      E V V+  W+  C S++
Sbjct:   18 KKTFC--QSELQKF--GLRGIRLRDYQLDGVQWLVQCQNNQQGCILADEMGLGKTCQTISLLVYMSGALGQKGPFLVLSPLSVLENWRNELERFAPSLTLLCYKGDKERRAEIQR--EANTQDFSVLLTTYELCLKDASYLKRWRWKVLVVDEAHRLKNQNSLLHKTLSEFTVGFRVLLTGTPIQNNLQELYSLLSFIQPSIFAAED--VDSFVNSYSNVQSQPALAADLQ--SILEPFLLRRIKSEVAVDLPKKMELVVYHGMSALQKKYYKAILLKDIEAFGNEQGSRN--------RLLNILMNLRKCVDHPYLFDGVEPEPFEMGEHLVEASGKLCLLDRLLAFLHKEGHRVLLFSQMTRMLDILQDYMEYRGYSYERLDGSVRGEERNLAVKNFS-SKDMFVFLLSTKAGGVGLNLTAADTVIFVDSDFNPQNDLQAAARCHRIGQNRPVKVIRLLARDTVEEIMYSRAVSKLQLTNTVIEEGRFSLLDQAQSAAAGLKLSEILKFGIDKLLSSDESSVQDVKLEK-----ILG-MSHDGQW--MDEEESSPLREEEDEYEGLDHMYCFEGKDYSKDPSSGDRSSFEHLLEEQLAEFQRGTAEGRALRHNAGASLSVALMIPVRKRKPLTEEELELRRKRREETAAKKAKMQEDIKKQQQEKKQQKKMAWWASCGYRSLCLQCVDSDEEEDDASSMCSTDSNATDITYVMGDVTHPHASKGDA-IIIHCVDDSGRWGRGGLFTALEVRSDEPRKQYELAGKMKDLDLGNVLLFPIDDKQSRLDGQDQLALIVAQQRDKSNNLSGILLSALDEGLKKIYIAARRSKASVHLPRIGQSTKGFKWYGTERLIRKHLASRGIPTFIYYHNR-AARSTPQMVTGTRGEDSNRSGDETQVPGPSAPSHSSGSAALPSFMKGVHVFFYNIPASERKRLSRYLITYDGD-EEDIMSAEVTHIVAEVENNIHKQELQDLVRQYTEAVPVQKAWLESCFSKQ 984          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Match: chd1l (chromodomain helicase DNA binding protein 1-like [Source:NCBI gene;Acc:393283])

HSP 1 Score: 535.028 bits (1377), Expect = 1.350e-174
Identity = 339/883 (38.39%), Postives = 482/883 (54.59%), Query Frame = 2
Query:   86 SDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVL-AXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH------EENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRW----KPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKD--------TKDCQQSKKKTKLD-LDVSRPDRKIT----------------------------------INKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRNPS----DESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPLK-----LNIQ--LALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSPNAVTLKLS 2536
            ++ +L   GL  I+LR YQ+ GV+W  + +    G IL DEMGLGKT QTI  +  A   +     F++VSPLTV+ NWK E  +  P+L    Y GNK ER  ++   E N+++  +++TTYE  L+D   +   N     +DE HR+KN  S L+  +SE    F+ LLTGTP+QNN  E+Y+LL  +  + L   D   E   S  +D   +D L  + +   +L   +LRR K E  + LP+K E+V++HGMT LQK  YKSILM+D             E+   ++ L NILM++RKC  HPYL  G+E  P+ +G+H+V+ S KL ++D +L YL+  GH++LLFSQ T MLD +Q+Y  LR + YERLDGSVR EER  AI NF +T+ T +FLLST+AGG GLNLTAADTVIFVDSDFNPQ DLQA AR HR GQ R  ++IRL+ + +VEEII SRA  KL +T  ++        E          L++++ +GVDKL S   ++   + N     ILG +  DG W    +PV+   D      +      +H+Y F+G++Y   PS  D + L  + ++          D +  + KT +    ++ P RK T                                  I K K   WD   Y S  +   D++ E+ D    N S    D  D  I+++ G+VT+P   P    II H VD+SG WG GGLF+A++  +     +Y  AG M DL +G   + P++     LN +  LAL+VAQ RD +  +S ++   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI TF+YY+     + +P+  T++ S
Sbjct:   20 TEKDLNTWGLREIKLRSYQLAGVKWLSEGMGILEGCILGDEMGLGKTCQTISLLAYARGFLGMDGPFLVVSPLTVLENWKQELERFCPSLSVVCYTGNKEERAELQR--EINSKQFHVLLTTYELCLRDAQWLKRRNWKILVVDEAHRLKNQASKLHETLSEFSVDFRLLLTGTPIQNNLQEIYSLLTFIQPS-LFPHDA-TEEFVSSYADVQTEDTL--VKELHKVLQPFLLRRVKDEVEKKLPQKKELVVYHGMTALQKKHYKSILMKDT---------AAFEAHGKTRALHNILMELRKCVNHPYLIRGVEPYPYVVGEHVVEASGKLSLLDHMLAYLLEGGHRVLLFSQFTLMLDYLQEYAELRGYGYERLDGSVRGEERNLAIKNF-KTKDTFIFLLSTKAGGVGLNLTAADTVIFVDSDFNPQNDLQAEARAHRIGQERAVKVIRLLGKDTVEEIIYSRAMSKLQLTNTVIEEGRFSLLENPKTASSAPELRDILTFGVDKLLSTETSS---VQNVDLKLILG-SSKDGCWLMDEEPVIPVED------DEEKAGPSHMYEFEGKDYSKTPSAKDREVLTCLFEEELALKMDLVNDGRTLRSKTGVGHYPLATPSRKRTLTESQMEERRLKKEESIAKKAKIQEEKKRQREEEIYKNKMARWDLCGYKSLCLSSTDSEGEDVDEDGENSSVNSTDSEDTEIHYVIGDVTHP-QTPRMDAIIVHCVDDSGRWGKGGLFTALEVRSDEAKKQYELAGNMEDLDIGHVLLFPIEDKQPTLNGRDHLALIVAQKRDKSNNVSGIQLTALEKGLKKIYRAAKKLKASVHLPRIGHSTKGFNWYGTERLIRKHLAHRGIPTFVYYY-----KQTPSQSTVEAS 870          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Match: chd1l (chromodomain helicase DNA binding protein 1-like [Source:NCBI gene;Acc:393283])

HSP 1 Score: 522.702 bits (1345), Expect = 5.563e-170
Identity = 334/879 (38.00%), Postives = 474/879 (53.92%), Query Frame = 2
Query:   86 SDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVL-AXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH------EENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRW----KPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQ----------QSKKKTKLDLDVSRPDRKIT----------------------------------INKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRNPS----DESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPLK-----LNIQ--LALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSPNAV 2521
            ++ +L   GL  I+LR YQ+ GV+W  + +    G IL DEMGLGKT QTI  +  A   +     F++VSPLTV+ NWK E  +  P+L    Y GNK ER  ++   E N+++  +++TTYE           +N     +DE HR+KN  S L+  +SE    F+ LLTGTP+QNN  E+Y+LL  +  + L   D   E   S  +D   +D L  + +   +L   +LRR K E  + LP+K E+V++HGMT LQK  YKSILM+D             E+   ++ L NILM++RKC  HPYL  G+E  P+ +G+H+V+ S KL ++D +L YL+  GH++LLFSQ T MLD +Q+Y  LR + YERLDGSVR EER  AI NF +T+ T +FLLST+AGG GLNLTAADTVIFVDSDFNPQ DLQA AR HR GQ R  ++IRL+ + +VEEII SRA  KL +T  ++        E          L++++ +GVDKL S   ++   + N     ILG +  DG W    +PV+   D      +      +H+Y F+G++Y   PS  D + L  + ++    +          +SK  + L   ++ P RK T                                  I K K   WD   Y S  +   D++ E+ D    N S    D  D  I+++ G+VT+P   P    II H VD+SG WG GGLF+A++  +     +Y  AG M DL +G   + P++     LN +  LAL+VAQ RD +  +S ++   LE   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH   +GI TF+Y +   L   +  ++
Sbjct:   20 TEKDLNTWGLREIKLRSYQLAGVKWLSEGMGILEGCILGDEMGLGKTCQTISLLAYARGFLGMDGPFLVVSPLTVLENWKQELERFCPSLSVVCYTGNKEERAELQR--EINSKQFHVLLTTYE-----------VNWKILVVDEAHRLKNQASKLHETLSEFSVDFRLLLTGTPIQNNLQEIYSLLTFIQPS-LFPHDA-TEEFVSSYADVQTEDTL--VKELHKVLQPFLLRRVKDEVEKKLPQKKELVVYHGMTALQKKHYKSILMKDT---------AAFEAHGKTRALHNILMELRKCVNHPYLIRGVEPYPYVVGEHVVEASGKLSLLDHMLAYLLEGGHRVLLFSQFTLMLDYLQEYAELRGYGYERLDGSVRGEERNLAIKNF-KTKDTFIFLLSTKAGGVGLNLTAADTVIFVDSDFNPQNDLQAEARAHRIGQERAVKVIRLLGKDTVEEIIYSRAMSKLQLTNTVIEEGRFSLLENPKTASSAPELRDILTFGVDKLLSTETSS---VQNVDLKLILG-SSKDGCWLMDEEPVIPVED------DEEKAGPSHMYEFEGKDYSKTPSAKDREVLTCLFEEELALKMDLVNDGRTLRSKTGSFLAEPLATPSRKRTLTESQMEERRLKKEESIAKKAKIQEEKKRQREEEIYKNKMARWDLCGYKSLCLSSTDSEGEDVDEDGENSSVNSTDSEDTEIHYVIGDVTHP-QTPRMDAIIVHCVDDSGRWGKGGLFTALEVRSDEAKKQYELAGNMEDLDIGHVLLFPIEDKQPTLNGRDHLALIVAQKRDKSNNVSGIQLTALEKGLKKIYRAAKKLKASVHLPRIGHSTKGFNWYGTERLIRKHLAHRGIPTFVYPYRSHLNERASTSL 860          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 327.02 bits (837), Expect = 7.805e-97
Identity = 213/576 (36.98%), Postives = 317/576 (55.03%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERT----NIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDG----ILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKE---MVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIE-NINDDVNHIYLFDGQNYKPKPSTS 1789
            + N  LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P LK    +G+K  R     ++    EW+    + +T+YE ++++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL++LL  +  ++         N  S    +   +N  G    + +  ++L   +LRR K E  + LP K EV I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG+   E+R  AI+ F+   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +   ++        + KL   E   M+ +G   +F+   + D  L+ E  ++IL  G   +    + + K  + +L+N   + +     +Y F+G++Y+ K   S
Sbjct:   54 VKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWD----VCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVF--------NSASDFDSWFDTNNCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDIL-------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVTNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGRLIEQQNKLGKDEMLQMIRHGATHVFA---SKDSELTEEDISTILERGAKKTAEMNERMEKLGESSLRNFTMDTSGAETSLYKFEGEDYREKQKLS 607          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 326.25 bits (835), Expect = 1.148e-96
Identity = 212/576 (36.81%), Postives = 318/576 (55.21%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERT----NIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDG----ILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN---LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIE-NINDDVNHIYLFDGQNYKPKPSTS 1789
            + N  LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW NEF +  P LK    +G+K  R     ++    EW+    + +T+YE ++++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL++LL  +  ++         N  S    +   +N  G    + +  ++L   +LRR K E  + LP K EV I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV NS K+  +DKLL  +   G ++L+FSQMT++LDI++DYC  R + Y RLDG+   E+R  AI+ F+   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +P R+ RL+   +VEE IV RA+ KL +   ++        + KL    + +M+ +G   +F+   + D  L+ E  ++IL  G   +    + + K  + +L+N   + +     +Y F+G++Y+ K   S
Sbjct:   54 VKNGTLRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWD----VCVTSYEMVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVF--------NSASDFDSWFDTNNCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDIL-------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVTNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVIQQGRLIEQQNKLGKDEMLQMIRHGATHVFA---SKDSELTEEDISTILERGAKKTAEMNERMEKLGESSLRNFTMDTSGAETSLYKFEGEDYREKQKLS 607          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:103021645])

HSP 1 Score: 317.775 bits (813), Expect = 9.194e-93
Identity = 211/567 (37.21%), Postives = 319/567 (56.26%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRNS---HEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDG---ILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGH----EENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            +LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + + NW NEF +  P+L+    +G++ ERT  IR++    EW+    + +T+YE L+ +       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F        S F  ++ L     + +  ++L   +LRR KA+  + L  K E+ ++ G++ +Q+  Y  ILM+D+++L       N   K     L N+LMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  L   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +IN F+E  S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++      + N     K  +  ++ +G   +F+  ++    +++E   +IL  G+  +    + +    + +L+N     D  N +Y F+G++Y+ K
Sbjct:  163 KLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRDERTAFIRDTLLPGEWD----VCVTSYEMLIIERAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFD-------SWFDTNNCLGDTKLVERLHTVLRPFLLRRIKADVEKSLLPKKEIKMYIGLSKMQREWYTKILMKDIDIL-------NSAGKMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMAVLDKLLPKLNEQGSRVLIFSQMTRVLDILEDYCMWRNYGYCRLDGQTPHEERQISINAFNEPNSSKFIFMLSTRAGGLGINLATADVVIIYDSDWNPQVDLQAMDRAHRIGQKKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPNMNKLGKDEMLSIIRHGATHVFASKESE---ITDEDIDAILERGEKKTMEMKEKLSNLGESSLRNF--TMDTENSVYNFEGEDYREK 706          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 314.309 bits (804), Expect = 1.564e-95
Identity = 192/506 (37.94%), Postives = 287/506 (56.72%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN----IRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNN 1606
            +R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + ++NW  EF +  P+L+    +G+K  R +    I    EW+    + +T+YE ++++       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL++LL  +  ++  S D F     +  ++   D  L  + +   +L   +LRR KA+  + LP K E  I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    H+V NS K+ V+DKLL  L   G ++L+FSQMT+M+DI++DYC  R + Y RLDG    E+R  +I +F+  +S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VE+ IV RA+ KL +   ++      +  +  N      + +M+ YG  ++FS  ++ 
Sbjct:  112 MRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEWD----VCVTSYEMIIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADTFTSWFDT--NNCFGDQQL--VERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDIL-------NSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHIVINSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVIQQGPGRLVDQVANKLGKDEMLQMIRYGATQVFSSKESQ 602          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 314.309 bits (804), Expect = 1.537e-92
Identity = 190/466 (40.77%), Postives = 274/466 (58.80%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERT----NIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNL---DGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSM 1495
            +R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   + +   +V  P + ++NW NEF +  P+L+    +GNK +R     N+    EW+    + +T+YE ++++       N     +DE HRIKN +S L + V E  +  + LLTGTP+QNN  EL++LL  +  ++  S + F        S F  ++ L   + + +   +L   +LRR KA+  + L  K EV I+ G++ +Q+  Y  ILM+D+++L       N   K     L NILMQ+RKC  HPYLF+G E   P+    HLV+NS K+ V+DKLL  L   G ++LLFSQMT+MLDI++DYC  + + Y RLDG    E+R  AI  ++   S+K +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +
Sbjct:  137 MRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHHRNIQGPHMVLVPKSTLHNWMNEFERWVPSLRAVCLIGNKDQRVATDENVYTKREWD----VCVTSYEIVIREKSVFKKFNWRYLVIDEAHRIKNEKSKLSDIVREFKSTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSSEDFD-------SWFDTNNCLGDQELVERLHMVLRPFLLRRIKADVEKSLQPKKEVKIYIGLSKMQREWYTKILMKDIDIL-------NSAGKMDKLRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDTHLVNNSGKMVVLDKLLPKLQEQGSRVLLFSQMTRMLDILEDYCMWKGYGYCRLDGQTPHEDRQEAIAAYNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKRVRVFRFLTENTVEERIVERAEMKLRL 584          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.026 bits (715), Expect = 3.729e-84
Identity = 181/461 (39.26%), Postives = 261/461 (56.62%), Query Frame = 2
Query:  194 ILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDF-----SKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD---HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNF-SETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENT 1528
            ILADEMGLGKT+QTI  +   F     +  F++V PL+ V +W+ EF    P +   VY+G+   R  IR  +EW  ++        ++TTYE LL+D   +  +N     +DE HR+KN +S+LY  + E  T  + L+TGTP+QN+  EL++LL  +        D+F     S   DF     S  DN  G +     L   +LRR K +  + LP K E ++   MT  QK  YK IL R+   L + T  +            NI+M+++KC  H YL    E E  +  D    LV +S KL ++DKLL  L   GH++L+FSQM +MLDI+ DY  ++ F ++RLDGS+++E+R  A+++F +E      FLLSTRAGG G+NL +ADTV+  DSD+NPQ DLQA AR HR GQ +   I RLV R +VEE I+ RA++K+ +   ++   + T
Sbjct:    7 ILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIRE-YEWIHQQTKKLKFNALVTTYEILLKDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMP------DKF-----SAWEDFDAVHGSGSDN--GYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGST-------SGFLNIMMELKKCCNHCYLIKLPEDENVDKHDALQSLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVIQRMDTT 446          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 277.715 bits (709), Expect = 5.873e-78
Identity = 190/516 (36.82%), Postives = 282/516 (54.65%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXX-XXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIR---NSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKV-SEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE------NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHL-VDNSI-----------KLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL----------GHEENTITKKKLNLKE 1558
            L N  L+ YQ+ G++W +    +N  GILADEMGLGKT+QTI  +    +        +I+ PL+ ++NW  EF+K  P++    Y G+ I R        S ++N    +++TTYEY+++D   +  +      +DEGHR+KNH   L   + +      + LLTGTP+QN   EL+ LL  +   I  S   F++       LT +  D ++++ +  I +   +L   +LRR K E    LPEK E VI   M+ LQK LY+ +  + V L     +E + + K  +K L N ++Q+RK A HPY+F  IE+      +HL   NSI           K +++D++L  L    H++LLF QMT ++ I++DY   RSF Y RLDG+ +SE+R   +  F+E  S   +FLLSTRAGG GLNL AADTVI  DSD+NP  DLQA  R HR GQ    R++RL    SVEE I++ A+ KL++ ++++          GHE     +  L  +E
Sbjct:  731 LVNGSLKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKGSPIARRAFMPQLRSGKFN----VLLTTYEYIIKDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTD--GSEKDKKGKGGAKTLMNTIVQLRKIANHPYMFQHIEES---FAEHLGFPNSIVQGADLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSGHERRAFLQAVLEHEE 1237          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006729.1 (pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-1 gene:ENSPMAG00000006035.1 transcript:ENSPMAT00000006729.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.151 bits (666), Expect = 1.070e-74
Identity = 176/525 (33.52%), Postives = 271/525 (51.62%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYN---------KVSEIPTKF-------------------KFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKE-------------PFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL----GHEENTITKKKLNLKEM 1561
            QLR+YQ++GV W + +  +    ILADEMGLGKT+Q+I  +           F++++PL+ + NW+ EF   T ++   V+ G+   R               MI  YE   +D    N++    F+ ++   + +H  VL            +SE  T+                    K LLTGTP+QN  +EL++LL  +      S   F       L +F +  + + + K  +IL  ++LRR K +  ++L  K E +I   +T++QK  Y++IL R+ + L +   + N+ +  ++       M++RKC  HPYL NG E++             P      +V  + KL +IDKLL  L   GHK+L+FSQM + LDI++DY   + + YER+DG VR   R  AI+ F + +S + +FLL TRAGG G+NLTAADT I  DSD+NPQ DLQA AR HR GQ +  ++ RL+ R S E  +  +A  KL + R +L    G E  T   ++++ KE+
Sbjct:  230 QLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTIQSIAFLQDVALAGVHGPFLVIAPLSTIANWEREFRTWT-DMNAVVFHGSVASRQ--------------MIQQYEMYTRDAQSKNIVGF-CFYYEKVTTVHSHLKVLPELHKGLFSCIYLSEHSTRVITRRVLLMHLLELYGVEEHKVLLTGTPLQNTVEELFSLLNFLEPARFPSESSF-------LQEFGQLKSEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILERNFSFLAKGAGQANLPNLMNTM------MELRKCCNHPYLINGAEEKILSDFREAHGADVPDFYLQAMVQAAGKLVLIDKLLPRLREGGHKVLIFSQMVRCLDILEDYLVQKRYPYERIDGRVRGNMRQVAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDRAVLQSMSGRENTTNGVQQMSKKEI 725          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 323.553 bits (828), Expect = 3.556e-95
Identity = 192/495 (38.79%), Postives = 289/495 (58.38%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL----GHEENTITKKKLNLKEMVCYGVDKLF 1588
            +LR YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +            F+I+ P + ++NW+ EF K TPN+   V  G+K  R +I  +    A   ++IT+YE ++++   +  +      +DE HRIKN +S L   +    +K + L+TGTP+QNN  EL+ LL  +  +I    + F E       + S+ D    I +  S+LN  +LRR KA+  + L  K E  ++ GMTD+Q   YKS+L +D++ +        V  +     L NI+MQ+RKC  HPYLF G E   P+   +HL+ NS K+ ++DKLL  L   G ++L+FSQM+++LDI++DYCY R F Y R+DGS   EER  AI+ +++  S K +FLL+TRAGG G+NL  ADTVI  DSD+NPQ DLQAM R HR GQ +   + R V   ++EE ++ RA +KL + + ++    G +  ++   K +L +M+ +G   +F
Sbjct:  183 KLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKNALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIFGDSELFDEWFEQ---NNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVN-----GAVGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGTGKKTASLGNSKDDLLDMIQFGAKNMF 669          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Match: ISW1 (ATPase subunit of imitation-switch (ISWI) class chromatin remodelers; with Ioc3p forms Isw1a complex involved in repression of transcription initiation; with Ioc2p and Ioc4p forms Isw1b complex involved in regulation of transcription elongation; Isw1b recruited to ORFs by H3K36 methylation and acts with Chd1p to prevent trans-histone exchange over coding regions; Isw1p import into nucleus depends on C-terminal bipartite nuclear targeting signal KRIR X19 KKAK [Source:SGD;Acc:S000000449])

HSP 1 Score: 320.087 bits (819), Expect = 7.119e-94
Identity = 213/572 (37.24%), Postives = 331/572 (57.87%), Query Frame = 2
Query:  119 NIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKT-DSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKK------KLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILG--------DTDSDGRWKPV-VKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            N QLR YQ+ GV W +   K+   GILADEMGLGKT+QTI  +            F++++P + +NNW  E N+ TP++  F+  G+K ER  +        +  ++I +YE ++++   +  IN +   +DE HRIKN ES+L   + E  ++ + L+TGTP+QNN  EL+ LL  +  +I      F +  +S+    S +++ D I+K   ++L   +LRR K++    L  K E+ ++ GM+ +QK  YK IL +D++ +    N +N  SK S   L NI+MQ+RKC  HPYLF+G E   P+   +HLV N+ KLQV+DKLL  L   G ++L+FSQM+++LDI++DYCY R++ Y R+DGS   E+R  AI++++  +S K +FLL+TRAGG G+NLT+AD V+  DSD+NPQ DLQAM R HR GQ +  ++ RLV   SVEE I+ RA +KL + + ++     ++ KK      K  L  M+ +G   +F    +     + E  +   G           S+ + K +  K   + L +++  N D    Y ++GQ++K K
Sbjct:  193 NGQLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIEKIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLLGCDFDVVIASYEIIIREKSPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDAQDFDDWFSSE----STEEDQDKIVKQLHTVLQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLDAV----NGSNG-SKESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNAAKLQVLDKLLKKLKEEGSRVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTRAGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQNRTSLKKKENKADSKDALLSMIQHGAADVFKSGTSTGSAGTPEPGSGEKGDDIDLDELLLKSENKTKSLNAKYETLGLDDLQKFNQD--SAYEWNGQDFKKK 753          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 275.404 bits (703), Expect = 1.879e-77
Identity = 177/522 (33.91%), Postives = 278/522 (53.26%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL---------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFE-LGDH----------LVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILG---HEENTITKK----KLNLKEMVCYGVDKLFSDNKN 1603
            +LR +Q+ G+ W          GILADEMGLGKTVQT+  +             IIV PL+ +  W + F K  P+L    YMGN+  R  IR    +              +++TTYEY+L+D  E+  I      +DE HR+KN ES LY  ++      + L+TGTP+QNN  EL  L+      ++  R    + +  +  D  +++ +  + +    +   ILRR K +  + LP KTE ++   ++D+Q   YK+IL ++ + L       +    +          +++K + HPYLF+  E+   +  GD           L+ +S K+ ++D+LL  L   GH++L+FSQM +MLDI+ DY  ++  N++RLDG+V S +R  +I++F+  +S   +FLLSTRAGG G+NL  ADTV+  DSD+NPQ DLQAMAR HR GQ     + RLV++ +VEE ++ RA++K+ +   I+     + N  TKK       L  ++ +G   +F+   N
Sbjct:  375 ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNF----LMPGRFTIDQEIDFENQDEEQEEYIHDLHRR---IQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMN-------ELKKASNHPYLFDNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVTDGNKYTKKNEPNAGELSAILKFGAGNMFTATDN 882          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 262.692 bits (670), Expect = 4.288e-73
Identity = 163/475 (34.32%), Postives = 270/475 (56.84%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKV-SEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLS--------DFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKE---PFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL 1510
            L+ YQ+ G+QW +    ++  GILADEMGLGKT+QTI  +    ++ + +   +V  PL+ ++NW +EF K  P L+   + G+  ER   + +     E  +++TT+EY++++   ++ +      +DEGHR+KN +S L   + +     ++ +LTGTP+QNN  EL+ LL  V   I  S   F E   +  +        + S+++ L  I +   +L   +LRR K +  + LP+K E V+   M+ LQ+ +Y+ +L      + +  N+  V      +  +N +MQ++K   HP++F  +E +     E  D +   + K +++D++L  L   GH++L+F QMT+++DI++D+    +  Y RLDG  +S+ER   +  F+  +S  L F+LSTRAGG GLNL  ADTVI  D+D+NP  DLQA  R HR GQ    RI+RL+   SVEE+I+ RA +KL +  +++
Sbjct:  767 LKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNER-KAKQAKIRAGEFDVVLTTFEYIIKERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMV----GLRGFNNQIMQLKKICNHPFVFEEVEDQINPTRETNDDIWRVAGKFELLDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDIDGKVI 1236          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Match: IRC5 (Putative ATPase containing the DEAD/H helicase-related sequence motif; null mutant displays increased levels of spontaneous Rad52p foci; SWAT-GFP and mCherry fusion proteins localize to the nucleus [Source:SGD;Acc:S000001934])

HSP 1 Score: 254.988 bits (650), Expect = 1.674e-72
Identity = 195/573 (34.03%), Postives = 294/573 (51.31%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNL---KYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENL---TSKLSDFSKDDNLDGILKTD----------SILNKLILRRTKAEQLQH-LPEKTEVVIFHGMTD-------------LQKTLYKSIL------------------MRDVNLLQELTNET--------------------NVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELG-DHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNF-SETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREI--LGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVV 1615
            L N  L+ YQ++G+ W I   ++   GILADEMGLGKTVQ+I  +    ++     F++ +PL+ ++NW NEF K  P+L   KY+   G K     ++N  + +    I+IT+YE +L+D   I   N     +DEGHR+KN    L  ++ +I T  + LLTGTP+QNN  EL++LL  +  +I    + F +     +  L   S  + L+ ++  +          +IL   +LRR K   L + LP K E +I   MT              L+KT++K ++                  +RD    +   NET                    N++ + S+K L N++MQ+R+     +LF      P +L  + L+  S KLQ++ KL+  L+  GHK+L++SQ   MLD+I+D+C L SF   R+DGSV +E R   +  F S  +   +FLLSTRA G G+NL  ADTV+  DSD+NPQVDLQAM R HR GQ  P  + RL    ++E +I++RA  K ++ R +  +G   N    KKL L E      +K   +  N D+V
Sbjct:  217 LKNCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAFIYEMDTKGPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGTGIVITSYEIILRDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQNNLAELWSLLNFIMPDIFADFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLHTILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFYKAGLNGKLKKTMFKELIKDFFTLNDEYIGHVSNRSIRDFINYKLSGNETSNTDNKINPTLLQMDKLYKKNLQMEISNKKLQNMMMQLRQIIDSTFLFYFPYLHPEDLTLETLLKTSGKLQILQKLIPPLISEGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKDQLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQESPVIVYRLCCDNTIEHVILTRAANKRNLERMVIQMGKFNNL---KKLALNEGSFLKANKAGVNVTNKDLV 786          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Match: EDO31943 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF7])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 339/873 (38.83%), Postives = 484/873 (55.44%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL-IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL-GHEENTITK-----KKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRW---KPVVKNNDVTLKNIENINDDVNH---IYLFDGQNYKPKPSTSDFQALNRILKDTKD-CQQSKKKTKLDL--------DVSRPDRKITIN---------------------------------KKKQQMWDSNKYVSRKIEINDNDIENS----DSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSP 2512
             L   GL  I LR YQ++GV W  D   + HG IL DEMGLGKT+QTI  +L  K         +V SPL+V+ NWKNE  + T +LK    +G+K ER   +N    + + + +++T+YE  L++   +   +  A  +DE HR+KN +S+LY ++ +    F  LLTGTP+QNN  ELY+LL+ +A +I    +  +E  T+  +  +  DN +  L    +L+  +LRR K+E +  LPEK+EV+++ GM++LQK  YK+ILM+D ++        N         L++IL  +RKC  HPYLF+G+E EPF LG+HL+  S KL  ID+LL YL   GHK+L+FSQMT+MLDI+QDY   R + YERLDGSVR EER+ AI NF+E +   +FLLST+AGGQGLNL +ADTVIFVDSD+NPQ DLQA AR HR GQ RP +IIRLV R +VEEII+  A  K+ +T  ++ G +    +K     + L L  ++ +G++KLF   +   + L       ILG    +GRW       K +  TL   + +   VNH   +Y+++G++Y    S  D  A ++++ D  D  Q++++  + D         D++   RK+                                    KK +++W  N Y S+++  +DN  E S    DS+     D +   I ++ G+VT PI    N  +I H VD+ G WG GGLFSAI   +     EY  AG+M DL LGD H++ L            +AL+VAQTRD   RL  V  + L      V   A    AS+HL R+G+ TP FNWY  E+LI KH   +G+ T +Y F      +SP
Sbjct:    5 TLSGAGLRGITLRPYQLEGVGWMRDCALTGHGCILGDEMGLGKTIQTISVLLLLKRTIKHTGLFLVLSPLSVMANWKNEIKRFTKSLKVLSLIGSKEEREITKNKLFQDIKNIDVLLTSYEICLRETSFLQRFHWSAVAVDEAHRLKNSQSLLYTELIQFKYDFSILLTGTPVQNNLKELYSLLSFIAPSIF-DLEYVEEFETAFKNLATGRDNTNSDLP--QLLSPFLLRRVKSEVMVDLPEKSEVILYAGMSELQKKYYKAILMKDYDIFSTDGPSRN--------KLNSILTNLRKCVNHPYLFDGVEPEPFALGEHLITASGKLHAIDQLLSYLYKRGHKVLMFSQMTRMLDIVQDYLGYRGYAYERLDGSVRGEERYIAIKNFNEEQDNFIFLLSTKAGGQGLNLMSADTVIFVDSDYNPQNDLQAAARAHRIGQTRPVKIIRLVGRNTVEEIILKHADDKMRLTNNVIEGGQVYDSSKIVASYRTLLLANILKFGLEKLFESEERYVIYL-------ILG-ASRNGRWIVEDKTPKPDLETLSTNQELQGTVNHFTSMYVYEGRDYSKGASDEDVAAFDKMVADVLDEVQKAERTLRSDKCPTASVLGDLTSKKRKVLTPEELEQRRIKRQEAAAKRAKLKEEAEERREQERMKKLEKLWRDNGYTSKRVNRDDNTDEESGSDEDSVTSEGEDSNCRDIQYVRGDVTRPINTRGNEAVIVHCVDDYGFWGQGGLFSAISRRSCKPQEEYELAGQMKDLHLGDVHLIELDDSSTGQDAKHSVALVVAQTRDRQHRLKPVDLRALGTGLLSVALEAKRRKASVHLPRIGHSTPGFNWYGTERLIRKHLASRGVLTSMYPFITCFPPHSP 858          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 316.235 bits (809), Expect = 1.024e-92
Identity = 200/561 (35.65%), Postives = 320/561 (57.04%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRNS---HEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVC---YGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +             +++ P + + NW  EF +  P+++    +GN+ +RT  IR++    EW+    + +T+YE ++++             +DE HRIKN +S L   V E+ +  + LLTGTP+QNN  EL+ LL  +  ++  S D F     S  ++  ++  L  + +  S+L   +LRR K++  + L  K E  ++ G+T +Q++ Y  ILM+D++++       N   K+    L NILMQ+RKC  HPYLF+G E  P    D HL++NS K++V+DKLL  L   G ++L+FSQMT++LDI++DYC  R ++Y RLDG    EER A IN+F+   STK +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  ++ R ++  +VEE I+ RA+ KL +   ++          K+  +EM+    +G + +F+ +K+ D+   +       G+  +    + +    +  L+ +  ++     I+ F+G++YK K
Sbjct:  143 EMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGEWD----VCVTSYEMVIREKAVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDDFDAWFNS--NNLVEEKQL--VERLHSVLRPFLLRRLKSDVEKRLLPKKETKVYTGLTKMQRSWYTKILMKDIDVV-------NGAGKTDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDVHLIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVIQQGRLVDPNLKVGKEEMLSMIRHGAEAVFA-SKDEDITDEDIDAILAKGEKKTAEMEEKMKTYGEGALRKL-TLDAPTESIFHFEGEDYKEK 686          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 284.263 bits (726), Expect = 1.482e-82
Identity = 188/526 (35.74%), Postives = 281/526 (53.42%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRN----------SHEWNAEEL---------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNG--IEKEPFELGDH----LVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNF-SETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMT----REILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNND 1609
            +L +YQ +G+ W   S       ILADEMGLGKT+QTI  + +     H +   +VS PL+ + NW+ EF    P++    Y G+K  R  IRN               A +L         +++T+YE +  D   +  I+     +DE HR+KN++S  +  +S+    +K LLTGTP+QNN +EL+NLL  +      +++ F       L++F      D I K   IL   +LRR KA+ L+ +P K+E+++   ++ +QK  YK IL R+   L    N    +  S    +    M+++KC  HPYLF+   +E +  + G +    L + S KL ++ K+L  L   GH++L+FSQMT+MLD+++D+     + YER+DGSV    R  AI+ F + T     FLLSTRAGG G+NL  ADTV   DSD+NP  D+QA +R HR GQ     I R V R SVEE I   A++K+ +T    R  LG  + TI  K   L +++ +G  +LF D+   D
Sbjct:  257 KLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSASLQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNF-------LTEFDNVAKEDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTRNFEAL----NTKGAQQVSLLNVM----MELKKCCNHPYLFHAAALEAKRTQSGGYEPNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVVRPGLGSNKATIMSKS-ELDDILKFGTSELFKDDDTKD 766          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Match: EDO47298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMN4])

HSP 1 Score: 286.96 bits (733), Expect = 4.701e-81
Identity = 179/482 (37.14%), Postives = 272/482 (56.43%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEE-----------LIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPF-ELGDHLVDN--------SIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL 1510
            LR+YQ++GV W +    +    ILADEMGLGKT+Q+I  +   +        ++++PL+ ++NW+ EF     ++   VY G+   R  I+    +  +E            ++ITTYE ++ D M+++ +   A  +DE HR+KN    L   ++ +  + + LLTGTP+QNN +EL++LL  +  +   S+  F      +  D   +  +D   K   +L  ++LRR K +  +++  K E +I   +T +QK  Y++IL R+   L + T+ T     ++  NL N +M++RKC  HP+L  G E++   E G   VD         S KL +I KLL  L   GHK+L+FSQM + LDI++DY     + YER+DG VR   R AAI+ FS+ +S + +FLL TRAGG G+NLTAADTVI  DSD+NPQ DLQA AR HR GQ R  ++ RL+ R S E  +  RA  KL + + +L
Sbjct:  229 LREYQLEGVNWLMFCWCNRQNSILADEMGLGKTIQSIAFLFEMQRYGIRGPNLVIAPLSTISNWQREFESWN-DINAVVYHGSASSRHLIQEYEFYYRDEHGQPIPNIFKFQVLITTYEIIIADNMQLSTVPWRAVIIDEAHRLKNRNCKLLEGLNNLQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAF----LMEFGDLKTESQVD---KLKQLLKPMMLRRLKEDVEKNIAPKEETIIEVELTTVQKKFYRAILERNFAFLAKGTSST-----ANVPNLMNTMMELRKCCNHPFLITGAEEKILQEYGREHVDRHTHAMIEASGKLVLIHKLLPKLKLGGHKVLVFSQMVRCLDILEDYLVHMKYPYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQSRSVKVYRLITRNSYEREMFDRASMKLGLDKAVL 697          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 258.455 bits (659), Expect = 2.192e-71
Identity = 170/483 (35.20%), Postives = 275/483 (56.94%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN---IRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKV-SEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKE------NLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFE-LGDH--------LVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREIL 1510
            +L++YQ+ G++W +    +N  GILADEMGLGKT+QTI       +       F+++ PL+ ++NW+ EF K  P+     Y G+   R +   +  + ++N    +++TTYEY+++D   +  +      +DEGHR+KNH   L   + +    + + LLTGTP+QN   EL+ LL  +   I  S   F++       +T +  + ++++ +  I +   +L   +LRR K E    LP+K E V+   M+ LQ+ LY  +  + V L     +E + + K  +K L N +MQ+RK   HP++F  IE+   E LG H        +   S K +++D++L  L    H++L+F QMT ++ I++DY   + F Y RLDG+ +SE+R   ++ F+  +S   +FLLSTRAGG GLNL AADTV+  DSD+NP  DLQA  R HR GQ +  R++RL+   SVEE I++ A+ KL++  +++
Sbjct:  645 RLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGAVLRTGKFN----VVLTTYEYVMRDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVSTFEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTD--GSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQHIEESIAEHLGFHGGIVTGPDIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDEKVI 1121          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Match: chd1l (chromodomain helicase DNA binding protein 1 like [Source:NCBI gene;Acc:101159810])

HSP 1 Score: 543.888 bits (1400), Expect = 3.008e-179
Identity = 341/885 (38.53%), Postives = 496/885 (56.05%), Query Frame = 2
Query:   95 NLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTI-CAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIR---NSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRD--RFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTI------TKKKLNLKEMVCYGVDKLFSDNKNN--DVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKD---------------------CQQSKKKTKLDLDVSRPDRKITINK--------------KKQQMWDSNKYVSRKIE--INDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPL-------KLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIY--YFPRDLKRNSPNAVTLKLSEKYFKSIFSKL 2569
            +L   GL  IQLR YQ+DGVQW I ++++  G IL DEMGLGKT QTI   V     +     F+++SPL+V+ NW+ E     P+L    Y G+K  R  ++   +S ++     +++TTYE  L+D   +     +   +DE HR+KN  S+L+  +SE    F+ LLTGTP+QN+  ELY+LL+ +  +I  + D   F +  +  +S  SK   L       S+L   +LRR K+E    LP+KTE+V++HGM+ LQK  YK+ILMRD++         N         L NILM +RKC  HPYLF+G+E EPFE+G+HL++ S KL ++D +L YL   GH++LLFSQMT+MLDI+QDY   R ++YERLDGSVR EER  ++ NFS T+   +FLLST+AGG G+NLTAADTVIFVDSDFNPQ DLQA AR HR GQ RP + IRL+AR +VEEI+ SRA  KL +T  ++     ++          + L E++ +GVDKL S ++++  DV L N F +S  G    D   K V +  +   +     +D++NH+Y+F+G +Y   PS+ D +  +R+L++                         Q+ K  ++ +L++ R  R+    K              KK   W+S+ Y S  +   +++ D +  D       D +   I ++ G+VT+P     ++ II H VD+SG WG GG+F+A++  +      Y  AG+M DL+LG   + P+           QLAL+VAQ RD    LS +    L+   KK+   A    AS+HL R+G+ T  FNWY  E+LI KH T +GI TF+Y      +L R+    V+  L++     IF  L
Sbjct:   24 DLQKWGLRGIQLRGYQLDGVQWLIQNLQNQQGCILGDEMGLGKTCQTIGLLVYVSGALGKKGPFMVLSPLSVLENWRKELESFAPSLTVLCYQGDKDRRAEMQLQASSQDFQ----VLLTTYELCLKDASFLRRWRWEVLVVDEAHRLKNPNSLLHQTLSEFSVDFRVLLTGTPIQNSLQELYSLLSFIQPSIFAANDVDSFVDYYSRVISLLSKATELQ------SVLEPFLLRRIKSEVAVDLPKKTELVVYHGMSALQKKYYKAILMRDLDAFGNEQGSKN--------RLLNILMNLRKCVDHPYLFDGVEPEPFEIGEHLIEASGKLCLLDNMLAYLHKGGHRVLLFSQMTRMLDILQDYMEYRGYSYERLDGSVRGEERNLSVKNFS-TKDIFVFLLSTKAGGVGINLTAADTVIFVDSDFNPQNDLQAAARCHRIGQNRPVKQIRLLARDTVEEIMYSRAASKLQLTNTVIQDGRFSLLDQAHSAAAGVQLSEILKFGVDKLLSSDESSVQDVNLQNIFGSSRGGQWVDDEDLKAVAEEEEEEER---PESDELNHMYIFEGVDYSRDPSSEDRKIFDRLLEEQLAEIQKAVGEGRALRHKAGVRFLNQKRKPLSEAELELRRKRREDAAAKRAKLQEDLKRKQQAKKMAWWESSGYRSLCLPPVVSEEDEDEEDGSSSCSMDSNSVDICYVLGDVTHPHAAKGDA-IIIHCVDDSGRWGRGGVFTALEVRSDEPRKRYELAGKMKDLELGSVLLFPIDDKQSRPDGQDQLALIVAQRRDKAHNLSGILLTALDEGLKKIYVAARRKKASVHLPRIGHSTKAFNWYGTERLIRKHLTSKGIATFMYPNTPSSELTRSGSGCVSSSLTKVGLHEIFPPL 885          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Match: smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:NCBI gene;Acc:101161213])

HSP 1 Score: 317.005 bits (811), Expect = 1.848e-92
Identity = 210/564 (37.23%), Postives = 320/564 (56.74%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXV-SPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTN-IRN---SHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENT-ITKKKLNLKEMVC---YGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I   ++   GILADEMGLGKT+QTI  +   K   +     +V  P + + NW NEF +  P+L+    +G++ ERT  IR+     EW+    + +T+YE L+ +       N     +DE HRIKN +S L   V E  T  + LLTGTP+QNN  EL+ LL  +  ++  S + F     +  ++   D  L  + +  ++L   +LRR KA+  + L  K EV I+ G++ +Q+  Y  ILM+D+++L       N   K     L N+LMQ+RKC  HPYLF+G E  P    D HLV NS K+ V+DKLL  +   G ++L+FSQMT++LDI++DYC  R++ Y RLDG    EER  +IN ++E  STK +F+LSTRAGG G+NL  AD VI  DSD+NPQVDLQAM R HR GQ +  R+ R +   +VEE IV RA+ KL +   ++        +  KL   EM+    +G   +F+   + D  ++++   +IL  G+  +    + +    + +L+N   ++ + + +Y F+G++Y+ K
Sbjct:  165 KMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTIALLGYMKHYRNIPGPHMVLVPKSTLYNWMNEFKRWVPSLRAVCLIGDRNERTALIRDVLLPGEWD----VCVTSYEMLIIEKAVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWALLNFLLPDVFNSSEDFDSWFDT--NNCLGDQKL--VERLHTVLRPFLLRRIKADVEKTLLPKKEVKIYVGLSKMQREWYTKILMKDIDIL-------NSAGKMDKMRLLNVLMQLRKCCNHPYLFDGAEPGPPYTTDLHLVVNSGKMVVLDKLLPKMKVQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHEERQISINAYNEPNSTKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQQKQVRVFRFITENTVEERIVERAEMKLRLDSIVIQQGRLVDPSANKLGKDEMLSIIRHGATHVFA---SKDSEITDDDIDAILERGERKTMEMKEKLSSLGESSLRNF-TMDTENSSVYTFEGEDYREK 709          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Match: chd3 (chromodomain-helicase-DNA-binding protein 3 [Source:NCBI gene;Acc:101167742])

HSP 1 Score: 289.271 bits (739), Expect = 4.339e-81
Identity = 191/527 (36.24%), Postives = 289/527 (54.84%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEEL------------------IMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFN----GIEKEP---FELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMT----REILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVV 1615
            L  YQ++G+ W   S       ILADEMGLGKT+QTI  + +     H K   +VS PL+ + NW+ EF    P+     Y G+K  R  IR  +E++ ++                   +++T+YE +  D   +  I      +DE HR+KN++S  + ++++    +K LLTGTP+QNN +EL++LL  +  N      RF  NL   L +F+     D I K   +L   +LRR KA+  +++P KTE+++   ++ +QK  YK IL ++   L       N +   +  +L NI+M ++KC  HPYLF       +K P   +E G  L   S KL ++ K+L  L   GH++L+FSQMTKMLD+++D+     + YER+DG +    R  AI+ F+   + +  FLLSTRAGG G+NL  ADTVI  DSD+NP  D+QA +R HR GQ     I R V R SVEE I   A+RK+ +T    R  LG +  ++TK++L+  +++ +G ++LF D    D V
Sbjct:  669 LHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQTIVFLYSLFKEGHTKGPFLVSAPLSTIINWEREFEMWAPDFYVVTYTGDKDSRAIIRE-NEFSFDDTAVKGGKKAFKLRAPIKFHVLLTSYELVTIDQTALKSIEWACLVVDEAHRLKNNQSKFFRRLNDYKIDYKLLLTGTPLQNNLEELFHLLNFLTPN------RFN-NLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSPMQKKYYKLILTKNFEAL-------NSKGGGNQVSLLNIMMDLKKCCNHPYLFPVASMEAQKTPSGAYE-GSALTKASGKLMLLQKMLRKLKEQGHRVLVFSQMTKMLDLLEDFLDHEGYKYERIDGGITGALRQEAIDRFNAPGACQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKAGSMTKQELD--DILKFGTEELFKDEGEGDKV 1177          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000046718.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 288.886 bits (738), Expect = 8.386e-81
Identity = 191/520 (36.73%), Postives = 285/520 (54.81%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRN---SHEWNA----------------EELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFEL------GDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMT----REILGHEENTITKKKLNLKEMVCYGVDKLFSD 1594
            L  YQ++G+ W   S       ILADEMGLGKTVQT   + +     H K   +VS PL+ + NW+ EF    P++    Y+G+K  R  IR    S E NA                +  +++T+YE +  D   +  I      +DE HR+KN++S  +  ++    + K LLTGTP+QNN +EL++LL     N L   +RF  NL   L +F+     D I K   +L   +LRR KA+  +H+P KTE+++   ++ +QK  YK IL R+   L       N     +  +L N++M ++KC  HPYLF     E  +L      G  L   S KL ++ K++  L   GH++L+FSQMTKMLD+++D+     + YER+DG V    R  AI+ F+   + +  FLLSTRAGG G+NL +ADTVI  DSD+NP  D+QA +R HR GQ R   I R V + SVEE I   A++K+ +T    R  LG +  +++K++L+  +++ +G ++LF D
Sbjct:  745 LHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLL-----NFLTP-ERFN-NLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEAL-------NTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELD--DILKFGTEELFKD 1248          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Match: ENSORLT00000043581.1 (chromodomain helicase DNA binding protein 4 [Source:NCBI gene;Acc:101170871])

HSP 1 Score: 288.886 bits (738), Expect = 8.386e-81
Identity = 191/520 (36.73%), Postives = 285/520 (54.81%), Query Frame = 2
Query:  128 LRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVS-PLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRN---SHEWNA----------------EELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFEL------GDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKL-FLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMT----REILGHEENTITKKKLNLKEMVCYGVDKLFSD 1594
            L  YQ++G+ W   S       ILADEMGLGKTVQT   + +     H K   +VS PL+ + NW+ EF    P++    Y+G+K  R  IR    S E NA                +  +++T+YE +  D   +  I      +DE HR+KN++S  +  ++    + K LLTGTP+QNN +EL++LL     N L   +RF  NL   L +F+     D I K   +L   +LRR KA+  +H+P KTE+++   ++ +QK  YK IL R+   L       N     +  +L N++M ++KC  HPYLF     E  +L      G  L   S KL ++ K++  L   GH++L+FSQMTKMLD+++D+     + YER+DG V    R  AI+ F+   + +  FLLSTRAGG G+NL +ADTVI  DSD+NP  D+QA +R HR GQ R   I R V + SVEE I   A++K+ +T    R  LG +  +++K++L+  +++ +G ++LF D
Sbjct:  745 LHPYQLEGLNWLRFSWAQATDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEGNAIRGGKKASKMKKDSPVKFHVLLTSYELITIDQAVLGSIEWACLVVDEAHRLKNNQSKFFRLLNNYSLQHKLLLTGTPLQNNLEELFHLL-----NFLTP-ERFN-NLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVRVELSPMQKKYYKFILTRNFEAL-------NTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAATEAPKLPNGMYEGAALTKASGKLMLLQKMMKKLKEGGHRVLVFSQMTKMLDLLEDFLENEGYKYERIDGGVTGNMRQEAIDRFNAPGAQQFAFLLSTRAGGLGINLASADTVIIYDSDWNPHNDIQAFSRAHRIGQNRKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQELD--DILKFGTEELFKD 1248          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Match: SMESG000081089.1 (SMESG000081089.1)

HSP 1 Score: 1684.85 bits (4362), Expect = 0.000e+0
Identity = 844/853 (98.94%), Postives = 850/853 (99.65%), Query Frame = 2
Query:   80 MKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASF 2638
            MKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAFKDIFHFKKFIIVSPL+VVNNWKNEFNK TPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVN+LQELTNETNVESKSSSKNLSNILMQIRKCALHPYLFNGIEKEPFELGDHL+DNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVS+KIEINDNDIENSDSIMRNPSD SDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEM+DLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRD KRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIAS+
Sbjct:    1 MKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAFKDIFHFKKFIIVSPLSVVNNWKNEFNKFTPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNILQELTNETNVESKSSSKNLSNILMQIRKCALHPYLFNGIEKEPFELGDHLIDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSQKIEINDNDIENSDSIMRNPSDGSDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMDDLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDFKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASY 853          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Match: SMESG000081089.1 (SMESG000081089.1)

HSP 1 Score: 1676.76 bits (4341), Expect = 0.000e+0
Identity = 840/849 (98.94%), Postives = 846/849 (99.65%), Query Frame = 2
Query:   92 MNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMNDLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDLKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASF 2638
            MNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAFKDIFHFKKFIIVSPL+VVNNWKNEFNK TPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVN+LQELTNETNVESKSSSKNLSNILMQIRKCALHPYLFNGIEKEPFELGDHL+DNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVS+KIEINDNDIENSDSIMRNPSD SDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEM+DLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRD KRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIAS+
Sbjct:    1 MNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAVLAFKDIFHFKKFIIVSPLSVVNNWKNEFNKFTPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNILQELTNETNVESKSSSKNLSNILMQIRKCALHPYLFNGIEKEPFELGDHLIDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVDKLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENINDDVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSRPDRKITINKKKQQMWDSNKYVSQKIEINDNDIENSDSIMRNPSDGSDFGINFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEYMTAGEMDDLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMCFKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIYYFPRDFKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYIASY 849          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 324.324 bits (830), Expect = 6.097e-96
Identity = 202/516 (39.15%), Postives = 297/516 (57.56%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNI---RNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLF----SDNKNNDV 1612
            +S  ++R YQ+ G+ W I    SN+ GILADEMGLGKT+QTI  +            FI+++P + + NW NE N+  P+L     +G++  R  I     + +W+    +++TTYE  +++   I   N     +DE HRIKN  S L   V E  ++ + L+TGTP+QNN  EL+ LL  +  +   S D F E     L +  K    + + K  SIL   +LRR K +  + LP K E+ ++ G++ +Q+ LY  ILM+D++ L     +           L NILMQ+RKC  HPYLF+GIE   P+    HLV N  K+ ++DKLL  L   G ++L+F+QMT+MLDI++DYC  R   Y RLDG  +  +R  +I++++   STK LF+LSTRAGG G+NLT+AD VI  DSD+NPQVDLQA  R HR GQ +  R+ RL+   +VEE I+ RA+ KL +         ++ H+ N + K   +L EM+ +G + +F    SD K+ D+
Sbjct:   47 VSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKKGHFIVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIHQLQTKQWD----VLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDE-----LFNNDKMAEQNQVQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVE------KTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYNSPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGRLVEHKNNQLGKN--DLLEMIKHGANYIFRSKDSDIKDEDI 545          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 324.324 bits (830), Expect = 9.168e-96
Identity = 202/516 (39.15%), Postives = 297/516 (57.56%), Query Frame = 2
Query:  113 LSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNI---RNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEK-EPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTR------EILGHEENTITKKKLNLKEMVCYGVDKLF----SDNKNNDV 1612
            +S  ++R YQ+ G+ W I    SN+ GILADEMGLGKT+QTI  +            FI+++P + + NW NE N+  P+L     +G++  R  I     + +W+    +++TTYE  +++   I   N     +DE HRIKN  S L   V E  ++ + L+TGTP+QNN  EL+ LL  +  +   S D F E     L +  K    + + K  SIL   +LRR K +  + LP K E+ ++ G++ +Q+ LY  ILM+D++ L     +           L NILMQ+RKC  HPYLF+GIE   P+    HLV N  K+ ++DKLL  L   G ++L+F+QMT+MLDI++DYC  R   Y RLDG  +  +R  +I++++   STK LF+LSTRAGG G+NLT+AD VI  DSD+NPQVDLQA  R HR GQ +  R+ RL+   +VEE I+ RA+ KL +         ++ H+ N + K   +L EM+ +G + +F    SD K+ D+
Sbjct:   70 VSGGEMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKKGHFIVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIHQLQTKQWD----VLVTTYEMCIKEKSAIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEFSSSDNFDE-----LFNNDKMAEQNQVQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKILMKDLDTLNSTAKKVE------KTRLQNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVANCGKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYNSPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVIQQGRLVEHKNNQLGKN--DLLEMIKHGANYIFRSKDSDIKDEDI 568          
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Match: SMESG000013560.1 (SMESG000013560.1)

HSP 1 Score: 312.768 bits (800), Expect = 1.827e-91
Identity = 204/564 (36.17%), Postives = 325/564 (57.62%), Query Frame = 2
Query:  125 QLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTVQTICAV-LAXXXXXXXXXXXXVSPLTVVNNWKNEFNKITPNLKYFVYMGNKIERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIKNHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDRFKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEVVIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVEXXXXXXXXXXXXMQIRKCALHPYLFNGIEKEPFELGD-HLVDNSIKLQVIDKLLLYLMPLGHKILLFSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTK-LFLLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRIIRLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLN------LKEMVCYGVDKLFSDNKNNDVVLSNEFFTSIL--GDTDSDGRWKPVVKNNDVTLKNIENINDD--VNHIYLFDGQNYKPK 1777
            ++R YQ+ G+ W I    S+  GILADEMGLGKT+QTI  +             +I++P + + NW NEF +  P++K    +G++  R+ +        +  +++T+YE  +++   +   N     +DE HRIKN +S L   V    ++ + L+TGTP+QNN  EL+ LL  +   +  S   F +     L + +  +    + +  S+L   +LRR KA+  + LP K E+ I+ G++ LQ+ LY  ILM+D++L+     +++         L NILMQ+RKC  HPYLF+GIE  P    D HLV+N  K+ ++DKLL  L   G +ILLFSQMT+MLDI++DYC  R ++Y RLDGS   +ER  +I+ +++  S K LF+LSTRAGG G+NL  AD VI  DSD+NPQVDLQA  R HR GQ +  R+ RL+   +VEE I++RA+ KL +   ++  ++  + ++K N      + +M+ YG + +F   ++ D  + +E    +L  G+  +    K + +  +  L+ ++  ND+  V  +Y F+G++Y+ K
Sbjct:   86 EMRDYQVRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWAPSVKPICLIGDQETRSRVIREQILPQDWDVIVTSYEMCIKEKSTLKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFASSANFDD-----LFNINSLEEETLVQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSD------KVRLLNILMQLRKCTNHPYLFDGIEPGPPYTTDYHLVENCGKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVI--QQGRLVEQKNNQLGKNEILDMIKYGANYIF---RSKDTDIRDEDIDVLLARGEQKTAEMNKKLDELGESNLRQLKFDNDESGVYSVYNFEGEDYREK 633          
The following BLAST results are available for this feature:
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHD1L0.000e+038.61chromodomain helicase DNA binding protein 1 like [... [more]
CHD1L2.751e-17238.55chromodomain helicase DNA binding protein 1 like [... [more]
CHD1L6.421e-16237.48chromodomain helicase DNA binding protein 1 like [... [more]
CHD1L1.921e-14739.80chromodomain helicase DNA binding protein 1 like [... [more]
CHD1L2.009e-13940.56chromodomain helicase DNA binding protein 1 like [... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
isw-12.491e-9334.02Chromatin-remodeling complex ATPase chain isw-1 [... [more]
chd-15.712e-8238.01Chromodomain and Helicase Domain protein [Source:... [more]
let-4188.837e-8235.62pep chromosome:WBcel235:V:5826833:5832866:1 gene:W... [more]
chd-39.825e-8235.24Chromodomain-helicase-DNA-binding protein 3 homolo... [more]
swsn-48.789e-7535.19SWI/SNF nucleosome remodeling complex component; S... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iswi5.715e-9336.91gene:FBgn0011604 transcript:FBtr0087841[more]
Iswi5.715e-9336.91gene:FBgn0011604 transcript:FBtr0087842[more]
Iswi5.715e-9336.91gene:FBgn0011604 transcript:FBtr0087843[more]
Chd11.322e-8335.71gene:FBgn0250786 transcript:FBtr0077674[more]
Chd11.503e-8335.71gene:FBgn0250786 transcript:FBtr0331654[more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd1l6.844e-17938.52chromodomain helicase DNA binding protein 1-like [... [more]
smarca12.344e-9537.41SWI/SNF related, matrix associated, actin dependen... [more]
smarca51.615e-9338.12SWI/SNF related, matrix associated, actin dependen... [more]
chd88.167e-8237.13chromodomain helicase DNA binding protein 8 [Sourc... [more]
chd88.789e-8237.07chromodomain helicase DNA binding protein 8 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa44.812e-9337.02annexin A4 [Source:Xenbase;Acc:XB-GENE-854498][more]
mettl63.168e-9136.81methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl65.712e-9136.73methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl61.238e-9036.81methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
mettl62.306e-9036.81methyltransferase like 6 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chd1l0.000e+038.43chromodomain helicase DNA binding protein 1-like [... [more]
Smarca11.111e-9636.94SWI/SNF related, matrix associated, actin dependen... [more]
Smarca11.111e-9636.94SWI/SNF related, matrix associated, actin dependen... [more]
Smarca11.227e-9636.94SWI/SNF related, matrix associated, actin dependen... [more]
Smarca13.645e-9636.17SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CXF7|CHD1L_MOUSE0.000e+038.43Chromodomain-helicase-DNA-binding protein 1-like O... [more]
sp|Q86WJ1|CHD1L_HUMAN0.000e+038.61Chromodomain-helicase-DNA-binding protein 1-like O... [more]
sp|Q3B7N1|CHD1L_BOVIN0.000e+038.01Chromodomain-helicase-DNA-binding protein 1-like O... [more]
sp|Q7ZU90|CHD1L_DANRE7.581e-17838.64Chromodomain-helicase-DNA-binding protein 1-like O... [more]
sp|F4IV45|CHR10_ARATH1.206e-12334.22Probable helicase CHR10 OS=Arabidopsis thaliana OX... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IU140.000e+038.13chromodomain-helicase-DNA-binding protein 1-like O... [more]
A0A1S3HSU40.000e+038.91chromodomain-helicase-DNA-binding protein 1-like O... [more]
A0A210PIP90.000e+039.91Chromodomain-helicase-DNA-binding protein 1-like O... [more]
A0A3B3VMG30.000e+036.75Chromodomain helicase DNA binding protein 1-like O... [more]
A0A1A8A3Q10.000e+037.21Chromodomain helicase DNA binding protein 1-like O... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd1l1.350e-17438.39chromodomain helicase DNA binding protein 1-like [... [more]
chd1l5.563e-17038.00chromodomain helicase DNA binding protein 1-like [... [more]
smarca17.805e-9736.98SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca11.148e-9636.81SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca59.194e-9337.21SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCA51.564e-9537.94SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA51.537e-9240.77SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000004254.13.729e-8439.26pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
SMARCA25.873e-7836.82SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000006729.11.070e-7433.52pep scaffold:Pmarinus_7.0:GL476370:400098:484196:-... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ISW23.556e-9538.79ATP-dependent DNA translocase involved in chromati... [more]
ISW17.119e-9437.24ATPase subunit of imitation-switch (ISWI) class ch... [more]
CHD11.879e-7733.91Chromatin remodeler that regulates various aspects... [more]
SNF24.288e-7334.32Catalytic subunit of the SWI/SNF chromatin remodel... [more]
IRC51.674e-7234.03Putative ATPase containing the DEAD/H helicase-rel... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319430.000e+038.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407611.024e-9235.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395851.482e-8235.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472984.701e-8137.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481162.192e-7135.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chd1l3.008e-17938.53chromodomain helicase DNA binding protein 1 like [... [more]
smarca51.848e-9237.23SWI/SNF related, matrix associated, actin dependen... [more]
chd34.339e-8136.24chromodomain-helicase-DNA-binding protein 3 [Sourc... [more]
ENSORLT00000046718.18.386e-8136.73chromodomain helicase DNA binding protein 4 [Sourc... [more]
ENSORLT00000043581.18.386e-8136.73chromodomain helicase DNA binding protein 4 [Sourc... [more]
back to top
BLAST of Chromodomain-helicase-DNA-binding protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081089.10.000e+098.94SMESG000081089.1[more]
SMESG000081089.10.000e+098.94SMESG000081089.1[more]
SMESG000017699.16.097e-9639.15SMESG000017699.1[more]
SMESG000017699.19.168e-9639.15SMESG000017699.1[more]
SMESG000013560.11.827e-9136.17SMESG000013560.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013596 ID=SMED30013596|Name=Chromodomain-helicase-DNA-binding protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2871bp
AAATTTTCAAATTATAAAACATTTATTGGCTAAAATTAACTAAGAGCTTT
GTTAATTTTTTAAATCGACTTTTGCATTAATGAAAAGTGATATGAATCTT
TTCAATTTGGGACTTTCTAACATTCAATTGCGCAAATATCAGATGGATGG
AGTCCAATGGTTTATAGATTCCGTCAAAAGTAACCATGGAGGTATATTAG
CAGATGAAATGGGTTTGGGCAAAACAGTTCAGACAATTTGTGCAGTGTTA
GCTTTCAAAGATATATTTCATTTTAAAAAATTTATCATTGTTTCTCCGTT
GACGGTTGTAAATAATTGGAAAAATGAATTCAATAAGATTACACCGAATT
TGAAATATTTTGTATATATGGGAAACAAAATTGAAAGAACAAACATTAGA
AATTCACACGAATGGAATGCCGAAGAATTGATTATGATAACAACTTATGA
ATATTTATTACAAGATTTTATGGAGATAAATGTCATAAATCTTGATGCAT
TTTTTATGGATGAAGGTCATAGAATAAAAAATCACGAATCTGTTCTTTAT
AACAAAGTTTCAGAGATACCAACTAAATTCAAATTTCTCTTAACTGGCAC
TCCAATGCAAAACAATTTCGATGAATTGTATAATTTGCTTGCTATAGTTG
CAAGAAATATTCTAGTAAGCCGAGATCGTTTTAAGGAAAATTTAACCTCG
AAATTATCTGATTTTTCAAAAGATGACAATTTAGATGGAATTTTAAAAAC
CGATTCAATTTTAAACAAATTGATTTTGAGAAGAACAAAAGCTGAACAGC
TGCAACATTTGCCTGAGAAAACAGAAGTTGTTATTTTTCACGGAATGACT
GATTTACAGAAAACATTATATAAATCGATTCTGATGAGAGATGTCAATCT
ATTACAGGAACTTACTAATGAAACAAATGTTGAATCAAAAAGTTCCAGTA
AAAATCTATCGAATATTTTAATGCAAATTCGTAAATGCGCTCTACATCCG
TATTTATTCAATGGAATTGAGAAAGAACCATTTGAGTTGGGAGATCATCT
CGTTGATAATTCAATAAAGCTTCAAGTGATCGATAAATTACTTTTGTATT
TGATGCCTCTGGGGCATAAGATTTTGTTGTTTTCGCAAATGACGAAAATG
TTGGACATCATTCAAGATTATTGCTATTTAAGGAGCTTTAATTATGAAAG
ATTGGATGGATCTGTACGTTCTGAAGAGCGGTTCGCTGCAATAAACAATT
TCTCTGAAACCGAGTCTACTAAATTGTTTCTTTTAAGTACTCGAGCTGGA
GGGCAAGGACTGAATCTGACAGCCGCCGATACTGTTATTTTTGTAGATAG
TGATTTTAATCCACAGGTTGATTTACAAGCGATGGCTAGAATTCATCGCC
CAGGACAATATCGACCATGTAGAATTATTCGATTGGTAGCTCGTTATTCC
GTAGAAGAAATCATTGTATCTCGAGCTCAAAGAAAACTGTCAATGACAAG
AGAGATATTGGGTCATGAAGAGAATACAATTACCAAGAAGAAATTAAACC
TTAAAGAAATGGTTTGCTATGGCGTAGATAAATTATTTTCGGATAATAAA
AACAATGATGTTGTACTATCAAATGAGTTTTTTACATCGATACTTGGTGA
CACTGATTCAGATGGACGCTGGAAACCGGTTGTCAAAAATAATGATGTCA
CACTAAAAAACATCGAAAACATCAATGATGATGTTAATCATATTTATTTA
TTTGATGGTCAGAATTATAAACCGAAACCATCGACAAGCGATTTTCAAGC
TCTTAATAGAATATTAAAAGATACAAAAGATTGCCAGCAATCTAAGAAGA
AAACGAAACTTGATTTAGATGTCAGTAGACCAGATAGGAAAATTACTATA
AATAAAAAGAAACAACAAATGTGGGATTCAAATAAATATGTTAGCCGGAA
AATCGAAATCAATGACAATGACATAGAAAATAGTGATTCGATTATGAGGA
ATCCTTCAGACGAATCTGATTTTGGTATTAATTTTATTAGCGGAAATGTA
ACGAATCCAATTGGAGATCCAGATAATTCGAAAATTATTTGCCATTTAGT
CGACAATAGTGGCTCATGGGGTAGTGGAGGTTTGTTTTCTGCAATCGACG
GAATCAATTCAAACATTTCCATCGAATACATGACAGCCGGTGAAATGAAT
GATCTGAAACTTGGAGATTGCCATGTTTTACCTTTGAAATTAAATATTCA
GTTAGCCTTATTGGTCGCCCAAACCCGAGATGATAATGGACGCTTATCGG
AAGTGAAAACTAAATATCTGGAAATGTGTTTTAAAAAAGTCCGTTGTTTC
GCAATTTCAAACAATGCTTCTATTCATTTAACAAGACTGGGATACAAAAC
TCCTCGTTTCAATTGGTACAGTATTGAAAAATTAATTAACAAGCATTTTA
CAGAACAAGGAATTGACACCTTTATATATTATTTTCCTCGAGATTTAAAA
AGAAATTCTCCCAATGCTGTCACCCTAAAATTATCAGAGAAATATTTCAA
ATCAATTTTTAGTAAGCTCATTTTTCACTTTCACGAATCTGTTGATAAGG
AAACGAAACGAATTCTTACTCGGTATATCGCTTCTTTTGACGGACAGCTA
ACCGATAATCCAATGGATGGAAATATTACTCACTTTCTGTTGAGCAACAA
GATGGAGTTTATTGAAAAAGAAATATTCAACGAGGAAATTGTCTTTGTGA
AGGTTGATTGGGTTATGAAATGTATCTCTGAAAAGGAAATATTTCCAATA
GGAAAATATATTATTTAGATGTCACTTAATTACAGTTTCTTTTCGGTTAT
ATCTGAAAGTTTAAAATTATC
back to top

protein sequence of SMED30013596-orf-1

>SMED30013596-orf-1 ID=SMED30013596-orf-1|Name=SMED30013596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=913bp
MKSDMNLFNLGLSNIQLRKYQMDGVQWFIDSVKSNHGGILADEMGLGKTV
QTICAVLAFKDIFHFKKFIIVSPLTVVNNWKNEFNKITPNLKYFVYMGNK
IERTNIRNSHEWNAEELIMITTYEYLLQDFMEINVINLDAFFMDEGHRIK
NHESVLYNKVSEIPTKFKFLLTGTPMQNNFDELYNLLAIVARNILVSRDR
FKENLTSKLSDFSKDDNLDGILKTDSILNKLILRRTKAEQLQHLPEKTEV
VIFHGMTDLQKTLYKSILMRDVNLLQELTNETNVESKSSSKNLSNILMQI
RKCALHPYLFNGIEKEPFELGDHLVDNSIKLQVIDKLLLYLMPLGHKILL
FSQMTKMLDIIQDYCYLRSFNYERLDGSVRSEERFAAINNFSETESTKLF
LLSTRAGGQGLNLTAADTVIFVDSDFNPQVDLQAMARIHRPGQYRPCRII
RLVARYSVEEIIVSRAQRKLSMTREILGHEENTITKKKLNLKEMVCYGVD
KLFSDNKNNDVVLSNEFFTSILGDTDSDGRWKPVVKNNDVTLKNIENIND
DVNHIYLFDGQNYKPKPSTSDFQALNRILKDTKDCQQSKKKTKLDLDVSR
PDRKITINKKKQQMWDSNKYVSRKIEINDNDIENSDSIMRNPSDESDFGI
NFISGNVTNPIGDPDNSKIICHLVDNSGSWGSGGLFSAIDGINSNISIEY
MTAGEMNDLKLGDCHVLPLKLNIQLALLVAQTRDDNGRLSEVKTKYLEMC
FKKVRCFAISNNASIHLTRLGYKTPRFNWYSIEKLINKHFTEQGIDTFIY
YFPRDLKRNSPNAVTLKLSEKYFKSIFSKLIFHFHESVDKETKRILTRYI
ASFDGQLTDNPMDGNITHFLLSNKMEFIEKEIFNEEIVFVKVDWVMKCIS
EKEIFPIGKYII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003678DNA helicase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0004003ATP-dependent DNA helicase activity
GO:0004386helicase activity
GO:0008026ATP-dependent helicase activity
GO:0016787hydrolase activity
GO:0016887ATPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036420BRCT_dom_sf
IPR038718SNF2-like_sf
IPR031053ALC1
IPR014001Helicase_ATP-bd
IPR001357BRCT_dom
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR031916LIG3_BRCT
IPR000330SNF2_N
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006338chromatin remodeling
GO:0006974cellular response to DNA damage stimulus
GO:0032508DNA duplex unwinding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 359..442
e-value: 1.1E-18
score: 78.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 332..441
e-value: 2.4E-15
score: 56.8
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 333..492
score: 16.728
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 13..204
e-value: 1.6E-29
score: 114.1
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 29..193
score: 19.374
IPR001357BRCT domainSMARTSM00292BRCT_7coord: 824..902
e-value: 0.0015
score: 27.8
IPR001357BRCT domainPROSITEPS50172BRCTcoord: 822..912
score: 13.868
NoneNo IPR availableGENE3DG3DSA:3.40.220.10coord: 649..810
e-value: 3.1E-32
score: 113.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 242..528
e-value: 3.2E-92
score: 310.8
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 328..453
e-value: 2.15857E-51
score: 174.587
NoneNo IPR availableCDDcd17919DEXHc_Snfcoord: 17..190
e-value: 1.79275E-59
score: 198.944
NoneNo IPR availableCDDcd17715BRCT_polymerase_lambdacoord: 827..902
e-value: 1.09448E-8
score: 50.9535
NoneNo IPR availableSUPERFAMILYSSF52949Macro domain-likecoord: 650..801
IPR036420BRCT domain superfamilyGENE3DG3DSA:3.40.50.10190coord: 816..906
e-value: 2.4E-13
score: 51.7
IPR036420BRCT domain superfamilySUPERFAMILYSSF52113BRCT domaincoord: 823..912
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 30..309
e-value: 1.0E-51
score: 175.7
IPR031916DNA ligase 3, BRCT domainPFAMPF16759LIG3_BRCTcoord: 825..902
e-value: 2.4E-7
score: 30.9
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 7..234
e-value: 7.1E-58
score: 197.5
IPR031053Chromodomain-helicase-DNA-binding protein 1-likePANTHERPTHR47157FAMILY NOT NAMEDcoord: 590..807
coord: 6..583
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 12..207
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 236..494