Fructose-bisphosphate aldolase

Overview
NameFructose-bisphosphate aldolase
Smed IDSMED30013591
Length (bp)1593
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fructose-bisphosphate aldolase (SMED30013591) t-SNE clustered cells

Violin plots show distribution of expression levels for Fructose-bisphosphate aldolase (SMED30013591) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fructose-bisphosphate aldolase (SMED30013591) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fructose-bisphosphate aldolase (SMED30013591) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013591

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30013591SMESG000027545.1 SmedASXL_007910SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013591SMESG000027545.1 dd_Smed_v4_398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013591SMESG000027546.1 SMESG000027545.1 Contig45391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013591SMESG000027546.1 SMESG000027545.1 Contig45391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013591SMESG000027545.1 Contig47146newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013591SMESG000027545.1 Contig47146uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30013591SMESG000027545.1 dd_Smed_v6_398_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30013591SMESG000027545.1 dd_Smed_v6_398_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30013591SMESG000027545.1 dd_Smed_v6_398_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOC (aldolase, fructose-bisphosphate C [Source:HGNC Symbol;Acc:HGNC:418])

HSP 1 Score: 455.292 bits (1170), Expect = 1.026e-157
Identity = 229/364 (62.91%), Postives = 265/364 (72.80%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +Q+KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+ NLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A++NG A+ GKY  S   G     SL++  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOC (aldolase, fructose-bisphosphate C [Source:HGNC Symbol;Acc:HGNC:418])

HSP 1 Score: 455.292 bits (1170), Expect = 1.026e-157
Identity = 229/364 (62.91%), Postives = 265/364 (72.80%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +Q+KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+ NLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A++NG A+ GKY  S   G     SL++  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 451.44 bits (1160), Expect = 2.973e-156
Identity = 227/364 (62.36%), Postives = 267/364 (73.35%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQG--DTTSLFVEKHVY 1188
            MP     L+ E+K EL   A  I  PGKG+LAADESTG+I  R +SI  EN EENRR YRQLL ++D  ++  I GVI+FHE+ YQK D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H++YLEGTLLKPNMVT G  C  K+ + E A+ATVTAL+RTVP AV G+ FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ +  A  N  A  GKY  S   G   + SLFV  H Y
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 451.44 bits (1160), Expect = 2.973e-156
Identity = 227/364 (62.36%), Postives = 267/364 (73.35%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQG--DTTSLFVEKHVY 1188
            MP     L+ E+K EL   A  I  PGKG+LAADESTG+I  R +SI  EN EENRR YRQLL ++D  ++  I GVI+FHE+ YQK D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H++YLEGTLLKPNMVT G  C  K+ + E A+ATVTAL+RTVP AV G+ FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ +  A  N  A  GKY  S   G   + SLFV  H Y
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Match: ALDOA (aldolase, fructose-bisphosphate A [Source:HGNC Symbol;Acc:HGNC:414])

HSP 1 Score: 451.44 bits (1160), Expect = 2.973e-156
Identity = 227/364 (62.36%), Postives = 267/364 (73.35%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQG--DTTSLFVEKHVY 1188
            MP     L+ E+K EL   A  I  PGKG+LAADESTG+I  R +SI  EN EENRR YRQLL ++D  ++  I GVI+FHE+ YQK D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H++YLEGTLLKPNMVT G  C  K+ + E A+ATVTAL+RTVP AV G+ FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ +  A  N  A  GKY  S   G   + SLFV  H Y
Sbjct:    1 MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-1 (Fructose-bisphosphate aldolase 1 [Source:UniProtKB/Swiss-Prot;Acc:P54216])

HSP 1 Score: 449.899 bits (1156), Expect = 3.895e-156
Identity = 228/365 (62.47%), Postives = 274/365 (75.07%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVK-CPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            M +++ +L++ ++ ELR  A AI  PGKG+LAADESTG++  R  SI LEN EENRR YRQLLF++ A L++ ISGVIMFHE+FYQKTD GKPF  LLQE+GIIPGIKVDKGVV +AG+  E TTQGLD L  RCA Y  DGA+FAKWRCV KI   TPS  ++ E A+ LARYASICQQNGLVPIVEPE+LPDG+H L   QK+TE VL++ Y AL+ H+V+LEGTLLKPNMVT+G      K   ++  LATVTALQR VP+AVPGV FLSGGQSE +ATLNLNAIN +  K+PWALTFS+GRALQ S L  W GK EN+ AAQ+ L+H A++N  AS+GKY    +       SLFV  H Y
Sbjct:    1 MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLARYASICQQNGLVPIVEPEILPDGEHCLARGQKITETVLSYVYHALNEHHVFLEGTLLKPNMVTSGQSFTGEKPSNADIGLATVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGKKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYTGDASADAAASQSLFVANHSY 365          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-1 (Fructose-bisphosphate aldolase 1 [Source:UniProtKB/Swiss-Prot;Acc:P54216])

HSP 1 Score: 449.899 bits (1156), Expect = 3.895e-156
Identity = 228/365 (62.47%), Postives = 274/365 (75.07%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVK-CPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            M +++ +L++ ++ ELR  A AI  PGKG+LAADESTG++  R  SI LEN EENRR YRQLLF++ A L++ ISGVIMFHE+FYQKTD GKPF  LLQE+GIIPGIKVDKGVV +AG+  E TTQGLD L  RCA Y  DGA+FAKWRCV KI   TPS  ++ E A+ LARYASICQQNGLVPIVEPE+LPDG+H L   QK+TE VL++ Y AL+ H+V+LEGTLLKPNMVT+G      K   ++  LATVTALQR VP+AVPGV FLSGGQSE +ATLNLNAIN +  K+PWALTFS+GRALQ S L  W GK EN+ AAQ+ L+H A++N  AS+GKY    +       SLFV  H Y
Sbjct:    1 MASYSQFLTKAQEDELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLARYASICQQNGLVPIVEPEILPDGEHCLARGQKITETVLSYVYHALNEHHVFLEGTLLKPNMVTSGQSFTGEKPSNADIGLATVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGKKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYTGDASADAAASQSLFVANHSY 365          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 445.277 bits (1144), Expect = 2.792e-154
Identity = 227/360 (63.06%), Postives = 267/360 (74.17%), Query Frame = 1
Query:  112 FASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY-VASENQGDTTSLFVEKHVY 1188
            F   L++ +K EL + AL I   GKG+LAADESTGTIG R  +I+LENNE NR+ YRQLLF++   L+++ISGVI++ E+F+Q TD G+ F  LL ++GI+PGIK+D GVV LAG+  E TTQGLD L ER A +   G  FAKWRCVL IG  TPS   MLENANVLARYASICQ NGLVPIVEPEVL DG+HDL  AQKVTEQVLAF Y AL+ H+VYLEGTLLKPNMVT G    +K  +    LATVTAL+R VP AVPG+ FLSGGQSEL+AT NLNAIN++   +PW LTFS+GRALQ SVLK W GK EN+ AAQK L+H +K NG+ASLGKY           SLFV KH Y
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPN-LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASKASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQLGKPWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKYAGEDAAGAAAESLFVAKHSY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 445.277 bits (1144), Expect = 2.792e-154
Identity = 227/360 (63.06%), Postives = 267/360 (74.17%), Query Frame = 1
Query:  112 FASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY-VASENQGDTTSLFVEKHVY 1188
            F   L++ +K EL + AL I   GKG+LAADESTGTIG R  +I+LENNE NR+ YRQLLF++   L+++ISGVI++ E+F+Q TD G+ F  LL ++GI+PGIK+D GVV LAG+  E TTQGLD L ER A +   G  FAKWRCVL IG  TPS   MLENANVLARYASICQ NGLVPIVEPEVL DG+HDL  AQKVTEQVLAF Y AL+ H+VYLEGTLLKPNMVT G    +K  +    LATVTAL+R VP AVPG+ FLSGGQSEL+AT NLNAIN++   +PW LTFS+GRALQ SVLK W GK EN+ AAQK L+H +K NG+ASLGKY           SLFV KH Y
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPN-LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASKASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQLGKPWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKYAGEDAAGAAAESLFVAKHSY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Match: aldo-2 (Fructose-bisphosphate aldolase 2 [Source:UniProtKB/Swiss-Prot;Acc:P46563])

HSP 1 Score: 305.449 bits (781), Expect = 4.575e-101
Identity = 154/240 (64.17%), Postives = 182/240 (75.83%), Query Frame = 1
Query:  112 FASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNK 831
            F   L++ +K EL + AL I   GKG+LAADESTGTIG R  +I+LENNE NR+ YRQLLF++   L+++ISGVI++ E+F+Q TD G+ F  LL ++GI+PGIK+D GVV LAG+  E TTQGLD L ER A +   G  FAKWRCVL IG  TPS   MLENANVLARYASICQ NGLVPIVEPEVL DG+HDL  AQKVTEQVLAF Y AL+ H+VYLEGTLLKPNMVT G    +K
Sbjct:    8 FKDSLTQAQKDELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPN-LNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLCDGEHDLARAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTPGQSSASK 246          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084995)

HSP 1 Score: 467.618 bits (1202), Expect = 4.787e-163
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084999)

HSP 1 Score: 467.618 bits (1202), Expect = 4.787e-163
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0084994)

HSP 1 Score: 467.618 bits (1202), Expect = 4.787e-163
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0310660)

HSP 1 Score: 467.618 bits (1202), Expect = 4.787e-163
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Match: Ald1 (gene:FBgn0000064 transcript:FBtr0339614)

HSP 1 Score: 467.618 bits (1202), Expect = 4.787e-163
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 461.07 bits (1185), Expect = 3.270e-160
Identity = 234/364 (64.29%), Postives = 271/364 (74.45%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+   +L+ E+K EL   A  I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI+FHE+ YQKTD GK F   L+E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  +++ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C  K    E A+ATVTAL+RTVP AVPGV FLSGGQSE EATLNLNA+N     RPWALTFS+GRALQ S LK W GK EN KA Q++ I  A  N  A +GKYV+S ++G     SLFV  H Y
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRVKPCIGGVILFHETLYQKTDDGKVFSDYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSRLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACSQKNTPQEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATLNLNAMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFIKRALNNSQACVGKYVSSGDKGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 461.07 bits (1185), Expect = 3.270e-160
Identity = 234/364 (64.29%), Postives = 271/364 (74.45%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+   +L+ E+K EL   A  I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI+FHE+ YQKTD GK F   L+E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  +++ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C  K    E A+ATVTAL+RTVP AVPGV FLSGGQSE EATLNLNA+N     RPWALTFS+GRALQ S LK W GK EN KA Q++ I  A  N  A +GKYV+S ++G     SLFV  H Y
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRVKPCIGGVILFHETLYQKTDDGKVFSDYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSRLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACSQKNTPQEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATLNLNAMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFIKRALNNSQACVGKYVSSGDKGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldoab (aldolase a, fructose-bisphosphate, b [Source:ZFIN;Acc:ZDB-GENE-040426-2299])

HSP 1 Score: 457.218 bits (1175), Expect = 8.597e-159
Identity = 228/364 (62.64%), Postives = 273/364 (75.00%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+   +LS ++K EL   A  I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI+FHE+ YQKTD GK F +L++E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  +++ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C +KY   E A+ATVTAL+RTVP AVPG+ FLSGGQSE EA++NL+ IN     +PWALTFS+GRALQ S LK W GK EN KA Q++ +  A  N  A++GKYV+  + G     SLFV  H Y
Sbjct:    1 MPHAYPFLSPDQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRIKPCIGGVILFHETLYQKTDDGKLFSQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSNLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASINLSTINQCPLSKPWALTFSYGRALQASALKAWGGKKENGKACQEEFVKRAVNNSAAAVGKYVSKGDTGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldob (aldolase b, fructose-bisphosphate [Source:NCBI gene;Acc:321664])

HSP 1 Score: 452.981 bits (1164), Expect = 5.006e-157
Identity = 224/357 (62.75%), Postives = 262/357 (73.39%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS--ENQGDTTSLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADESTGT+  RF+ I++EN EENRR++R LLFS D  +SE+I GVI+FHE+ YQK+D G  FPK++++KGI+ GIKVDKG   LAG+  E TTQGLDGL ERCA Y  DG  FAKWRCVLKI    PS   + ENANVLARYASICQQNGLVPIVEPE+LPDGDHDL   Q  TE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C  KY   E A+ATVTAL+RTVP AVPG+CFLSGGQSE EA+LNLNA+N +   RPW L+FS+GRALQ S L  W+G+  N KA+Q   +  AK+N  AS G+Y  S    Q  T SLF   + Y
Sbjct:    8 LSTEQKKELATIAERIVAPGKGILAADESTGTMAKRFQKINVENTEENRRSFRDLLFSVDDSISESIGGVILFHETLYQKSDKGVLFPKVIKDKGIVVGIKVDKGTAGLAGTDGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDSCPSALGIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKQCQYATEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCTKKYTPLEVAMATVTALRRTVPAAVPGICFLSGGQSEEEASLNLNAMNQLSLHRPWKLSFSYGRALQASALSAWKGQAANKKASQDAFVTRAKINSLASKGEYKPSGQAGQASTQSLFTASYTY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Match: aldob (aldolase b, fructose-bisphosphate [Source:NCBI gene;Acc:321664])

HSP 1 Score: 442.195 bits (1136), Expect = 8.381e-153
Identity = 216/335 (64.48%), Postives = 253/335 (75.52%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGK 1128
            LS E+K EL   A  I  PGKG+LAADESTGT+  RF+ I++EN EENRR++R LLFS D  +SE+I GVI+FHE+ YQK+D G  FPK++++KGI+ GIKVDKG   LAG+  E TTQGLDGL ERCA Y  DG  FAKWRCVLKI    PS   + ENANVLARYASICQQNGLVPIVEPE+LPDGDHDL   Q  TE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C  KY   E A+ATVTAL+RTVP AVPG+CFLSGGQSE EA+LNLNA+N +   RPW L+FS+GRALQ S L  W+G+  N KA+Q   +  AK+N  AS G+
Sbjct:    8 LSTEQKKELATIAERIVAPGKGILAADESTGTMAKRFQKINVENTEENRRSFRDLLFSVDDSISESIGGVILFHETLYQKSDKGVLFPKVIKDKGIVVGIKVDKGTAGLAGTDGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDSCPSALGIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKQCQYATEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCTKKYTPLEVAMATVTALRRTVPAAVPGICFLSGGQSEEEASLNLNAMNQLSLHRPWKLSFSYGRALQASALSAWKGQAANKKASQDAFVTRAKINSLASKGE 342          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldoc (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:407969])

HSP 1 Score: 452.981 bits (1164), Expect = 7.614e-157
Identity = 230/360 (63.89%), Postives = 261/360 (72.50%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-----SLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADES G++  R   I ++N EENRR YRQLLF  D  + E I GVI FHE+ YQ+ DCG  F K++++KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EAT+NLNAIN     RPWALTFS+GRALQ S L  W+GK EN  AA  + +  A+ NG A+LGKY   E  GD       SL+V  H Y
Sbjct:    8 LSAEQKKELADIAQKIVAPGKGILAADESVGSMAKRLSGIGVDNIEENRRLYRQLLFKGDERMQECIGGVIFFHETMYQQGDCGTNFVKMIKDKGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHACPTKYTAEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATINLNAINNCPLARPWALTFSYGRALQASALSAWRGKKENEDAATNEFLKRAEANGLAALGKY---EQSGDGCGAAGQSLYVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldoc (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:407969])

HSP 1 Score: 437.187 bits (1123), Expect = 9.966e-151
Identity = 225/360 (62.50%), Postives = 256/360 (71.11%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-----SLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADES G++  R   I ++N EENRR YRQLLF  D  + E I GVI FHE+ YQ+ DCG  F K++++KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+V        S H+VYLEGTLLKPNMVTAG  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EAT+NLNAIN     RPWALTFS+GRALQ S L  W+GK EN  AA  + +  A+ NG A+LGKY   E  GD       SL+V  H Y
Sbjct:    8 LSAEQKKELADIAQKIVAPGKGILAADESVGSMAKRLSGIGVDNIEENRRLYRQLLFKGDERMQECIGGVIFFHETMYQQGDCGTNFVKMIKDKGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVSGCN----SDHHVYLEGTLLKPNMVTAGHACPTKYTAEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATINLNAINNCPLARPWALTFSYGRALQASALSAWRGKKENEDAATNEFLKRAEANGLAALGKY---EQSGDGCGAAGQSLYVANHAY 360          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldob (aldolase, fructose-bisphosphate B [Source:NCBI gene;Acc:394736])

HSP 1 Score: 435.261 bits (1118), Expect = 5.768e-150
Identity = 215/343 (62.68%), Postives = 257/343 (74.93%), Query Frame = 1
Query:  106 PNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYV 1134
            P F +  +E+KK EL + A  I  PGKG+LAADES GT+G+R K I++EN EENRR YR+LLF++D  + ++I GVI+FHE+ YQK+  G  FPK+L++ GI+ GIKVDKG   LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI    PS  ++ ENANVLARYASICQQNGLVPIVEPE+L DG HDL   Q  TE+VL+  Y AL  H+VYLEGTLLKPNMVT G  C  KY   + A+ATVTAL+RTVP AVPG+CFLSGGQSE EA+LNLNA+N     RPW ++FS+GRALQ S L  W GK EN KAAQ+  +  AK+NG A+LGKYV
Sbjct:    5 PVFPALTAEQKK-ELSEIAQRIVAPGKGILAADESVGTMGSRLKRINVENIEENRRLYRELLFTADPSIKDSIGGVILFHETLYQKSRDGVLFPKILKDLGIVVGIKVDKGTAPLAGTDGETTTQGLDGLAERCAQYKKDGADFAKWRCVLKISDSAPSSLAIYENANVLARYASICQQNGLVPIVEPEILSDGSHDLQRCQYETEKVLSAVYAALIQHHVYLEGTLLKPNMVTGGQSCSQKYTPQDVAMATVTALRRTVPPAVPGICFLSGGQSEEEASLNLNAMNCCSLNRPWRVSFSYGRALQASALSAWVGKSENEKAAQEAFVKRAKINGLATLGKYV 346          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: aldoc (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:407969])

HSP 1 Score: 429.483 bits (1103), Expect = 1.304e-147
Identity = 222/362 (61.33%), Postives = 253/362 (69.89%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWA--LSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-----SLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADES G++  R   I ++N EENRR YRQLLF  D  + E I GVI FHE+ YQ+ DCG  F K++++KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q         T +   L  H+VYLEGTLLKPNMVTAG  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EAT+NLNAIN     RPWALTFS+GRALQ S L  W+GK EN  AA  + +  A+ NG A+LGKY   E  GD       SL+V  H Y
Sbjct:    8 LSAEQKKELADIAQKIVAPGKGILAADESVGSMAKRLSGIGVDNIEENRRLYRQLLFKGDERMQECIGGVIFFHETMYQQGDCGTNFVKMIKDKGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYAFLLPFTLTKYGTILYDHHVYLEGTLLKPNMVTAGHACPTKYTAEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEATINLNAINNCPLARPWALTFSYGRALQASALSAWRGKKENEDAATNEFLKRAEANGLAALGKY---EQSGDGCGAAGQSLYVANHAY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Match: arfgef2 (ADP ribosylation factor guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-6041969])

HSP 1 Score: 428.713 bits (1101), Expect = 2.949e-147
Identity = 222/365 (60.82%), Postives = 258/365 (70.68%), Query Frame = 1
Query:  100 SMPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYV--ASENQGDTTSLFVEKHVY 1188
            +MP+    L+ E+K EL   A  I   GKG+LAADESTG+I  R  SI  EN EENRR YRQLLF++D  ++  I GVI FHE+ Y K+D G  F +++++KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  +++ENANVLARYASICQQNG+VPIVEPEVLPDGDHDL   Q VTE+VLA  Y ALS H++YLEGTLLKPNMVT G  C  KY   E A+ATVTAL+RTVP AV G+ FLSGGQSE EAT++LNAIN     +PW LTFS+GRALQ S LK W GK EN K AQ++ +  A  N  A  GKYV           SLFV  H Y
Sbjct:    7 TMPHQYPALTPEQKKELHDIAKRIVATGKGILAADESTGSIAKRLSSIGAENTEENRRLYRQLLFTADDRVNPCIGGVITFHETLYHKSDDGVAFTEVIKKKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISEHTPSHLAIIENANVLARYASICQQNGIVPIVEPEVLPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTKKYPPQEVAMATVTALRRTVPPAVGGITFLSGGQSEEEATVHLNAINQCPLIKPWPLTFSYGRALQASALKAWGGKKENTKKAQEEYVKRALANSLACQGKYVASGEAGAAAGESLFVSNHAY 371          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoc (aldolase C, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:101863])

HSP 1 Score: 455.677 bits (1171), Expect = 4.209e-158
Identity = 230/363 (63.36%), Postives = 267/363 (73.55%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +Q+KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+LNLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A+MNG A+ G+Y  S + G    SL++  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoc (aldolase C, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:101863])

HSP 1 Score: 455.677 bits (1171), Expect = 4.209e-158
Identity = 230/363 (63.36%), Postives = 267/363 (73.55%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +Q+KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+LNLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A+MNG A+ G+Y  S + G    SL++  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYIANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoart1 (aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:MGI:2447811])

HSP 1 Score: 452.595 bits (1163), Expect = 6.717e-157
Identity = 229/364 (62.91%), Postives = 268/364 (73.63%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP     L+ E+K EL   A  I  PGKG+LAADES G++GNR +SI  EN EENRR +RQLL ++D  ++  I GVI+FHE+ Y+K D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  C  K+   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ I  A  N  A  GKY  S   G T   SLF+  H Y
Sbjct:    1 MPCPYPALTTEQKKELSDIAHRIVAPGKGILAADESIGSMGNRLQSIGTENTEENRRFFRQLLLTADDRVNPCIGGVILFHETLYEKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGKHTPSPLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLSCCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENLKAAQEEYIKRALANSLACQGKYTPSGKTGATASESLFISNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoart1 (aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:MGI:2447811])

HSP 1 Score: 454.136 bits (1167), Expect = 1.170e-156
Identity = 229/365 (62.74%), Postives = 269/365 (73.70%), Query Frame = 1
Query:  100 SMPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            +MP     L+ E+K EL   A  I  PGKG+LAADES G++GNR +SI  EN EENRR +RQLL ++D  ++  I GVI+FHE+ Y+K D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  C  K+   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ I  A  N  A  GKY  S   G T   SLF+  H Y
Sbjct:   55 TMPCPYPALTTEQKKELSDIAHRIVAPGKGILAADESIGSMGNRLQSIGTENTEENRRFFRQLLLTADDRVNPCIGGVILFHETLYEKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGKHTPSPLAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLSCCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKEENLKAAQEEYIKRALANSLACQGKYTPSGKTGATASESLFISNHAY 419          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Match: Aldoa (aldolase A, fructose-bisphosphate [Source:MGI Symbol;Acc:MGI:87994])

HSP 1 Score: 451.825 bits (1161), Expect = 1.606e-156
Identity = 229/364 (62.91%), Postives = 267/364 (73.35%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQG--DTTSLFVEKHVY 1188
            MP+    L+ E+K EL   A  I  PGKG+LAADESTG+I  R +SI  EN EENRR YRQLL ++D  ++  I GVI+FHE+ YQK D G+PFP++++ KG + GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKIG  TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  C  K+   E A+ATVTAL+RTVP AV GV FLSGGQSE EA++NLNAIN     +PWALTFS+GRALQ S LK W GK EN+KAAQ++ I  A  N  A  GKY  S   G   + SLF+  H Y
Sbjct:    1 MPHPYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSNEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9GP32|ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis OX=6211 GN=FBPA PE=2 SV=1)

HSP 1 Score: 511.146 bits (1315), Expect = 3.842e-179
Identity = 249/363 (68.60%), Postives = 282/363 (77.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS-ENQGDTTSLFVEKHVY 1188
            M  F  YL  EK  ELR+ A AI  PGKGLLAADEST TIG RF +I+LEN EENRRAYR+LLF++D   +++ISGVI+FHE+ YQKT  GKPF +LL+E+G++PGIKVD GVV L G+ DECTTQGLD L +RCA YYNDG RFAKWRCVLKI    PS+ +MLENANVLARYA ICQQNGLVPIVEPEVLPDGDHDL TAQ+VTEQVL+F Y AL+ H+VYLEGTLLKPNMVT G  C  KY   +NA ATV ALQRTVP AVPGV FLSGGQSEL+AT NLNAIN    K+PWAL+FSFGRALQ S +  WQGKPENVKA Q + + LAK NG ASLGK+    +      SLFV  H Y
Sbjct:    1 MSRFVPYLCAEKMKELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIVEPEVLPDGDHDLETAQRVTEQVLSFVYKALADHHVYLEGTLLKPNMVTCGQSCTKKYSVEDNARATVEALQRTVPVAVPGVVFLSGGQSELDATRNLNAINKYPGKKPWALSFSFGRALQASAIAAWQGKPENVKAGQAEFLQLAKANGAASLGKFEGELKTAAGQKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P53442|ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 497.664 bits (1280), Expect = 8.537e-174
Identity = 249/365 (68.22%), Postives = 283/365 (77.53%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDT---TSLFVEKHVY 1188
            M  F  YL+E ++ +LR+ A AI  PGKG+LAADEST T+G R + I +ENNEENRR YRQLLFS+D  L+ENISGVI+F E+ +QK+D GK  P LL E+ IIPGIKVDKGVV LAG+ +E TTQGLD L  RCA Y+  G RFAKWRCVLKI   TPS+ +MLENANVLARYASICQQNGLVPIVEPEVLPDGDHDL TAQ+VTEQVLAF Y AL+ H+VYLEGTLLKPNMVTAG  C   Y   ENALATV ALQRTVP AVPG+ FLSGGQSEL+AT NLN IN I   +PWALTFSFGRALQ SVL  W+GK ENV AAQ++L+ LAK NG A++GK+    N G T    SLFV  H Y
Sbjct:    1 MSRFQPYLTEAQENDLRRIAQAICAPGKGILAADESTATMGKRLQQIGVENNEENRRLYRQLLFSADHKLAENISGVILFEETLHQKSDDGKTLPTLLAERNIIPGIKVDKGVVPLAGTDNETTTQGLDDLASRCAEYWRLGCRFAKWRCVLKISSHTPSYLAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLLTAQRVTEQVLAFVYKALADHHVYLEGTLLKPNMVTAGQACKKAYTPQENALATVRALQRTVPPAVPGITFLSGGQSELDATKNLNEINKIPGPKPWALTFSFGRALQASVLATWKGKKENVHAAQEELLKLAKANGAAAVGKF--EGNMGTTLGDKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P07764|ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster OX=7227 GN=Ald1 PE=1 SV=5)

HSP 1 Score: 467.618 bits (1202), Expect = 4.798e-162
Identity = 238/362 (65.75%), Postives = 274/362 (75.69%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            M  + +Y S+E + ELR+ A  I  PGKG+LAADES  T+G R + I +EN E+NRRAYRQLLFS+D  L+ENISGVI+FHE+ YQK D G PF ++L++KGII GIKVDKGVV L GS+DE TTQGLD L  RCA Y  DG  FAKWRCVLKIG  TPS+QS+LENANVLARYASICQ   +VPIVEPEVLPDGDHDL  AQKVTE VLA  Y ALS H+VYLEGTLLKPNMVTAG +   K    E ALATV AL+RTVP AV GV FLSGGQSE EAT+NL+AIN +   RPWALTFS+GRALQ SVL+ W GK EN+ A Q +L+  AK NG+A+ GKYVA      + SLFV  H Y
Sbjct:    1 MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAG-QSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY 361          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|P09117|ALDOC_RAT (Fructose-bisphosphate aldolase C OS=Rattus norvegicus OX=10116 GN=Aldoc PE=1 SV=3)

HSP 1 Score: 458.759 bits (1179), Expect = 1.889e-158
Identity = 233/363 (64.19%), Postives = 267/363 (73.55%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT-SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +QEKGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+LNLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A+MNG A+ GKY  S + G    SL+V  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQFVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCSLPRPWALTFSYGRALQASALSAWRGQRDNAGAATEEFIKRAEMNGLAAQGKYEGSGDGGAAAQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Match: sp|Q9GKW3|ALDOC_MACFA (Fructose-bisphosphate aldolase C OS=Macaca fascicularis OX=9541 GN=ALDOC PE=2 SV=3)

HSP 1 Score: 456.447 bits (1173), Expect = 1.289e-157
Identity = 230/364 (63.19%), Postives = 266/364 (73.08%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+    LS E+K EL   AL I  PGKG+LAADES G++  R   I +EN EENRR YRQ+LFS+D  + + I GVI FHE+ YQK D G PF + +Q+KGI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++LENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA+LNLNAIN     RPWALTFS+GRALQ S L  W+G+ +N  AA ++ I  A++NG A+ GKY  S   G     SL++  H Y
Sbjct:    1 MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: K1R8R6 (Fructose-bisphosphate aldolase OS=Crassostrea gigas OX=29159 GN=CGI_10019801 PE=3 SV=1)

HSP 1 Score: 523.857 bits (1348), Expect = 0.000e+0
Identity = 258/364 (70.88%), Postives = 294/364 (80.77%), Query Frame = 1
Query:  100 SMPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS-ENQGDTTSLFVEKHVY 1188
            +MP F  YL+ +++ ELR  A AI  PGKG+LAADESTG+IG RF  I++EN+EENRR YR LLFS+D  L+ENISGVIMFHE+FYQKT  G PF K+LQ+KGIIPGIKVDKGVV LAG++DECTTQGLDGL ERCA Y  DGA+FAKWRCVLKI   TPS+Q+MLENANVLARYASICQQNGLVPIVEPEVLPDG+HDL TAQKVTEQVLAFTY AL+ H+VYLEGTLLKPNMVTAG+ C  K+   +NA AT+ AL RTVP AVPGV FLSGGQSE +AT NLN IN I   +PWALTFSFGRALQ SVLKVW+GK ENV  AQ +LI  AK NG A++GKY    ++     SLFV +H Y
Sbjct:   35 NMPVFPQYLTPKQEEELRNIANAIVAPGKGILAADESTGSIGKRFAPINVENSEENRRRYRDLLFSTDKSLAENISGVIMFHETFYQKTKDGTPFTKVLQDKGIIPGIKVDKGVVPLAGTEDECTTQGLDGLSERCAQYKKDGAQFAKWRCVLKIQQYTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGEHDLETAQKVTEQVLAFTYKALADHHVYLEGTLLKPNMVTAGMSCTKKFSKEDNARATILALSRTVPPAVPGVTFLSGGQSEEDATQNLNLINAIKGPKPWALTFSFGRALQASVLKVWEGKDENVAKAQAELITRAKANGLAAVGKYQGGLDSAAGGQSLFVAQHAY 398          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A4S2M891 (Fructose-bisphosphate aldolase OS=Opisthorchis felineus OX=147828 GN=CRM22_001954 PE=3 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 0.000e+0
Identity = 255/364 (70.05%), Postives = 292/364 (80.22%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVA--SENQGDTTSLFVEKHVY 1188
            M  FA YLSE +  ELR+ A AI  PGKG+LAADEST T+G R ++I +EN EE+RR YRQLLFSS+   S+NISGVI+FHE+ YQKTD G+P   LL+E+ IIPGIKVDKGVV LAGS +ECTTQGLDGL ERCA Y  DG  FAKWRCVLKIGP TPS+Q+MLENANVLARYASICQQNGLVPIVEPEVLPDGDHDL TAQ+VTE+VL+F Y AL+ H++YLEGTLLKPNMVTAG  CP +Y   +NA+ATV ALQRTVP AV GV FLSGGQSELEAT NLN IN +  ++PWALTFSFGRALQ SVL VW+GKPENV AAQ + + LAK NG A+LG++ A  +   GD  SLFV  H Y
Sbjct:    1 MSRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSSNPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRVTEEVLSFVYKALADHHIYLEGTLLKPNMVTAGQACPKRYTPEQNAIATVEALQRTVPPAVAGVTFLSGGQSELEATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQAEFLKLAKANGAAALGQFTADMATAAGD-KSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A1S8X7Q3 (Fructose-bisphosphate aldolase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01353 PE=3 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 0.000e+0
Identity = 255/364 (70.05%), Postives = 292/364 (80.22%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVA--SENQGDTTSLFVEKHVY 1188
            M  FA YLSE +  ELR+ A AI  PGKG+LAADEST T+G R ++I +EN EE+RR YRQLLFSS+   S+NISGVI+FHE+ YQKTD G+P   LL+E+ IIPGIKVDKGVV LAGS +ECTTQGLDGL ERCA Y  DG  FAKWRCVLKIGP TPS+Q+MLENANVLARYASICQQNGLVPIVEPEVLPDGDHDL TAQ+VTE+VL+F Y AL+ H+VYLEGTLLKPNMVTAG  CP +Y   +NA+ATV ALQRTVP AV GV FLSGGQSEL+AT NLN IN +  ++PWALTFSFGRALQ SVL VW+GKPENV AAQ + + LAK NG A+LG++ A  +   GD  SLFV  H Y
Sbjct:    1 MTRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSSNPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRVTEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYTPEQNAVATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQGEFLKLAKANGAAALGQFTADMATAAGD-KSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A2H1C7F2 (Fructose-bisphosphate aldolase OS=Fasciola hepatica OX=6192 GN=D915_006642 PE=3 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 1.644e-180
Identity = 256/364 (70.33%), Postives = 291/364 (79.95%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVA--SENQGDTTSLFVEKHVY 1188
            MP F  YL+E +  ELR+ A AI  PGKG+LAADEST TIG R ++I +EN EE+RR YRQLLFSS+   ++NISGVI+FHE+ YQKTD G+P  +LL+E+ IIPGIKVDKGVV LAGS +ECTTQGLDGL ERCA Y  DG  FAKWRCVLKI   TPS+Q+MLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAF Y AL+ H+VYLEGTLLKPNMVTAG  CP KY   ENALATV ALQRTVP AV GV FLSGGQSEL AT+NLN IN +  ++PWALTFSFGRALQ SVL VW+G+P+NV AAQ++ + LAK NG A+ G + A  +   GD  SLFV  H Y
Sbjct:    1 MPIFGEYLTESQMKELREIAQAIVAPGKGILAADESTATIGKRLQNIGVENTEEHRRQYRQLLFSSNPEAAKNISGVILFHETLYQKTDDGRPLVELLKERHIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKISSHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFVYKALADHHVYLEGTLLKPNMVTAGQGCPQKYTPQENALATVRALQRTVPPAVAGVTFLSGGQSELAATINLNEINKVPGRKPWALTFSFGRALQASVLDVWKGQPQNVAAAQEEFLKLAKANGAAAQGTFTADMATAAGD-KSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Match: A0A075AIH6 (Fructose-bisphosphate aldolase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12938 PE=3 SV=1)

HSP 1 Score: 521.161 bits (1341), Expect = 4.439e-180
Identity = 256/367 (69.75%), Postives = 293/367 (79.84%), Query Frame = 1
Query:   94 VKSMPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVA--SENQGDTTSLFVEKHVY 1188
            V  M  FA YLSE +  ELR+ A AI  PGKG+LAADEST T+G R ++I +EN EE+RR YRQLLFSS+   S+NISGVI+FHE+ YQKTD G+P   LL+E+ IIPGIKVDKGVV LAGS +ECTTQGLDGL ERCA Y  DG  FAKWRCVLKIGP TPS+Q+MLENANVLARYASICQQNGLVPIVEPEVLPDGDHDL TAQ+VTE+VL+F Y AL+ H+VYLEGTLLKPNMVTAG  CP +Y   +NA+ATV ALQRTVP AV GV FLSGGQSEL+AT NLN IN +  ++PWALTFSFGRALQ SVL VW+GKPENV AAQ + + LAK NG A+LG++ A  +   GD  SLFV  H Y
Sbjct:   29 VSIMTRFAEYLSESQMKELREIAQAIVAPGKGILAADESTATMGKRLQNIGVENTEEHRRQYRQLLFSSNPEASKNISGVILFHETLYQKTDDGRPLVALLKERNIIPGIKVDKGVVPLAGSLNECTTQGLDGLAERCAQYKKDGCHFAKWRCVLKIGPHTPSYQAMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLATAQRVTEEVLSFVYKALADHHVYLEGTLLKPNMVTAGQACPKRYTPEQNAVATVEALQRTVPPAVAGVTFLSGGQSELDATKNLNEINKVPGRKPWALTFSFGRALQASVLDVWKGKPENVAAAQGEFLKLAKANGAAALGQFTADMATAAGD-KSLFVANHAY 394          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoaa (aldolase, fructose-bisphosphate A [Source:NCBI gene;Acc:103024532])

HSP 1 Score: 467.618 bits (1202), Expect = 7.369e-163
Identity = 232/364 (63.74%), Postives = 275/364 (75.55%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT--SLFVEKHVY 1188
            MP+   +L+ E+K EL   AL I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI FHE+ YQKTD GK FP+L++E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  ++ ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C +KY   E A+ATVTAL+RTVP AVPG+ FLSGGQSE EA++NLNA+N     RPWALTFS+GRALQ S LK W GK EN KA Q++ +  A  N  AS+GKY ++ ++G     SLFV  H Y
Sbjct:    1 MPHAYPFLTPEQKKELSDNALKIVAPGKGILAADESTGSVAKRFQSINAENTEENRRFYRQLLFTADDRIKPCIGGVIFFHETLYQKTDDGKLFPQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSSLAIKENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSEHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASVNLNAMNMCPLHRPWALTFSYGRALQASALKAWGGKKENAKACQEEFVKRALANSAASIGKYASAGDKGAAAGESLFVANHAY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldob (fructose-bisphosphate aldolase B [Source:NCBI gene;Acc:103034172])

HSP 1 Score: 457.988 bits (1177), Expect = 4.610e-159
Identity = 227/357 (63.59%), Postives = 263/357 (73.67%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY--VASENQGDTTSLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADESTGT+  R + I++EN EENRR +R LLFS D  +S+NI G+I FHE+ YQK+D G PFPKL+++KGI+ GIKVDKG   L G+  E TTQGLDGL ERCA Y  DG  FAKWRCVLKI    PS  ++ ENANVLARYASICQQNGLVPIVEPE+LPDGDHDL   Q VTE+VLA TY ALS H+VYLEGTLLKPNMVTAG  CP KY   E  +ATVTAL+RTVP AVPG+CFLSGGQSE EA+LNLNA+N     RPW L+FS+GRALQ S L  W+GKPEN KA+Q      AK+N  AS G+Y      ++  T SLF   +VY
Sbjct:    8 LSPEQKKELATIAQRIVAPGKGILAADESTGTMAKRLQKINVENTEENRRYFRDLLFSVDPSISDNIGGIIFFHETLYQKSDKGIPFPKLVKDKGIVVGIKVDKGTAGLNGTDGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDGCPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLLRCQYVTEKVLAATYKALSDHHVYLEGTLLKPNMVTAGHSCPKKYTPEEVGMATVTALRRTVPAAVPGICFLSGGQSEEEASLNLNAMNQTPLHRPWKLSFSYGRALQASALAAWKGKPENRKASQDAFCTRAKINSLASKGEYKPTGQADKAATQSLFTASYVY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:103040804])

HSP 1 Score: 452.21 bits (1162), Expect = 8.974e-157
Identity = 226/356 (63.48%), Postives = 265/356 (74.44%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDT-TSLFVEKHVY 1188
            L+ E+K EL++ A  I  PGKG+LAADESTG++  R   I +EN EENRR YRQLLF++D  +   I GVI FHE+ YQ  D G PF K+++++GI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDG+HDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  CP KY   E A+ATVTAL+RTVP AVPGV FLSGGQSE EA++NLNAIN     RPWALTFS+GRALQ S L  W+G  +N KAA ++ I  A+ NG AS GKYV+S   G    SL+V  H Y
Sbjct:    8 LTPEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRLYRQLLFTADQRIDSCIGGVIFFHETLYQNADDGTPFVKMIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISETTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGEHDLKRCQYVTEKVLAACYKALSDHHVYLEGTLLKPNMVTAGHSCPTKYSNEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINNCPLSRPWALTFSYGRALQASALNAWRGARDNEKAATEEFIKRAEANGLASRGKYVSSGTAGAAGQSLYVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoaa (aldolase, fructose-bisphosphate A [Source:NCBI gene;Acc:103024532])

HSP 1 Score: 446.432 bits (1147), Expect = 1.186e-154
Identity = 219/332 (65.96%), Postives = 257/332 (77.41%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLA 1098
            MP+   +L+ E+K EL   AL I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI FHE+ YQKTD GK FP+L++E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  ++ ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C +KY   E A+ATVTAL+RTVP AVPG+ FLSGGQSE EA++NLNA+N     RPWALTFS+GRALQ S LK W GK EN KA Q++ +  A
Sbjct:    1 MPHAYPFLTPEQKKELSDNALKIVAPGKGILAADESTGSVAKRFQSINAENTEENRRFYRQLLFTADDRIKPCIGGVIFFHETLYQKTDDGKLFPQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSSLAIKENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSEHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASVNLNAMNMCPLHRPWALTFSYGRALQASALKAWGGKKENAKACQEEFVKRA 332          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Match: aldoaa (aldolase, fructose-bisphosphate A [Source:NCBI gene;Acc:103024532])

HSP 1 Score: 446.432 bits (1147), Expect = 1.475e-154
Identity = 219/332 (65.96%), Postives = 257/332 (77.41%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLA 1098
            MP+   +L+ E+K EL   AL I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  +   I GVI FHE+ YQKTD GK FP+L++E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI P TPS  ++ ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C +KY   E A+ATVTAL+RTVP AVPG+ FLSGGQSE EA++NLNA+N     RPWALTFS+GRALQ S LK W GK EN KA Q++ +  A
Sbjct:    1 MPHAYPFLTPEQKKELSDNALKIVAPGKGILAADESTGSVAKRFQSINAENTEENRRFYRQLLFTADDRIKPCIGGVIFFHETLYQKTDDGKLFPQLIKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSSLAIKENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSEHHVYLEGTLLKPNMVTAGHSCSHKYSPQEIAMATVTALRRTVPPAVPGITFLSGGQSEEEASVNLNAMNMCPLHRPWALTFSYGRALQASALKAWGGKKENAKACQEEFVKRA 332          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Match: aldob (aldolase b, fructose-bisphosphate [Source:NCBI gene;Acc:321664])

HSP 1 Score: 446.047 bits (1146), Expect = 4.773e-155
Identity = 226/357 (63.31%), Postives = 268/357 (75.07%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYV--ASENQGDTTSLFVEKHVY 1188
            L+ E+K +L + A  I   GKG+LAADESTGT+G R  +I +EN EENRR YRQLLFSSD  +++ I GVI + E+ YQKTD G PF KL++++GI+ GIKVDKG V LAG+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI   TPS  ++ ENANVLARYASICQQNGLVPIVEPE+LPDGDHDL T Q VTE+VLA TY ALS H+VYLEG+LLKPNMVT G     +    E A+ATVTAL+RTVP+AVPG+ FLSGGQSE +A+LNLNAIN +  +RPWAL+FS+GRALQ SVLK W G P N+ AA+K+    A +NG A+ GKYV   S     + SLFV  H Y
Sbjct:    8 LTPEQKKDLAEIAQRIVSTGKGILAADESTGTMGKRLSAIKVENVEENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVYLEGSLLKPNMVTVGQASKIRCSPQEVAMATVTALRRTVPSAVPGITFLSGGQSEEDASLNLNAINRVPLERPWALSFSYGRALQASVLKAWAGNPANIPAAKKEFEKRAAINGLAAQGKYVPAGSSGSAASESLFVANHNY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Match: aldoaa (aldolase a, fructose-bisphosphate, a [Source:ZFIN;Acc:ZDB-GENE-030131-8369])

HSP 1 Score: 378.252 bits (970), Expect = 2.087e-128
Identity = 201/367 (54.77%), Postives = 247/367 (67.30%), Query Frame = 1
Query:  106 PNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLD-GLGE---RCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY--VASENQGDTTSLFVEKHVY 1188
            P+F +   ++KK EL   A  I   GKG+LAADES GT+G R   I LEN +E+RR YRQLLF++D  + E+I G+I FHE+ YQK+D G PF KL+++ GI+ GIKVDKGVV LAG+  E TTQ L   +GE   RC     D +      C     P  P    +     V  + A  CQQNGLVPIVEPE+LPDGDHDL T Q +TE+VLA TY ALS H+VYLEGTLLKPNMVTAG  C  KY   +  +AT+TAL+RTVP AVPG+ FLSGGQSE +A+++LNAIN +   +PWALTFS+GRALQ SVLK W GK EN+KAAQ +L+  AK+NG AS G+Y  +A        SLFV  H Y
Sbjct:    6 PHFPALTPDQKK-ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKESIGGIIFFHETLYQKSDSGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQALAVNVGEGVARCGLRRRDASSSPMATC-----PHFPKSIKLEYGTGVDQQGAFSCQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVYLEGTLLKPNMVTAGHACATKYTPEQVGMATLTALRRTVPPAVPGITFLSGGQSEEDASIHLNAINKLHLIKPWALTFSYGRALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEYKPIAGSGAAAGESLFVANHAY 366          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Match: EDO37672 (Fructose-bisphosphate aldolase [Source:UniProtKB/TrEMBL;Acc:A7SF13])

HSP 1 Score: 459.914 bits (1182), Expect = 2.011e-160
Identity = 233/356 (65.45%), Postives = 266/356 (74.72%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQ-DECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            L+ E K EL++ A AI   GKG+LAADESTGT+G R  +I +EN EENRR YRQLLF+S   +S  ISGVI+FHE+ YQK D G PF +LL+++GIIPGIKVDKGVV LAG+   E TTQGLDGLGERCA Y  DG  FAKWRCVLKI   TPS  +M ENANVLARYASICQQNGLVPIVEPEVL DGDH L  AQKVTE VL+ TY AL  H++YLEGTLLKPNMVTAG  CP KY   + A ATVTAL RTVP A+PGV FLSGGQSE +AT++LNAIN    K+PW LTFSFGRALQ S LK W GK   VKA Q++ +  AK NG A++GKY   ++     SLFV  H Y
Sbjct:    5 LTPELKAELKRIAEAIVADGKGILAADESTGTMGKRLANIGVENTEENRRLYRQLLFTSGKEMSNAISGVILFHETVYQKADDGTPFVRLLRDQGIIPGIKVDKGVVVLAGTDAGETTTQGLDGLGERCAQYKKDGCDFAKWRCVLKITDYTPSELAMKENANVLARYASICQQNGLVPIVEPEVLCDGDHTLERAQKVTEAVLSATYKALMDHHIYLEGTLLKPNMVTAGQSCPTKYTPEQCAQATVTALARTVPPAMPGVTFLSGGQSEEQATIHLNAINQYQGKKPWKLTFSFGRALQASALKAWSGKSGCVKAGQEEFLKRAKANGQAAMGKYAGGQSLAGDQSLFVANHQY 360          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Match: EDO28958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T505])

HSP 1 Score: 82.8037 bits (203), Expect = 1.122e-19
Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  946 LNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            +N NA+      +PW LTFSFGRALQ S LK W GK + VKA Q++ +  AK NG A++GKY   ++     SLFV  H Y
Sbjct:    1 MNTNAVYKCIIIKPWKLTFSFGRALQASALKAWSGKSDCVKAGQEEFLKRAKANGQAAMGKYAGGQSLAGDQSLFVANHQY 81          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldoa (fructose-bisphosphate aldolase A [Source:NCBI gene;Acc:100049249])

HSP 1 Score: 462.996 bits (1190), Expect = 5.127e-161
Identity = 229/363 (63.09%), Postives = 274/363 (75.48%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS-ENQGDTTSLFVEKHVY 1188
            MP+   +L+ E+K EL   A  I  PGKG+LAADESTG++  RF+SI+ EN EENRR YRQLLF++D  ++  I GVI+FHE+ YQKTD GKPFP+ L+E+G++ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI P TPS  +++ENANVLARYASICQ +G+VPIVEPE+LPDGDHDL   Q +TE+VLA  Y ALS H+VYLEGTLLKPNMVTAG  C +KY   E A++TVTAL+RTVP AVPG+ FLSGGQSE EAT+NLN++N     RPWALTFS+GRALQ S LK W GK EN KA Q++ +  A  N  A +GKYV+S  +     SLFV  H Y
Sbjct:    1 MPHAYPFLTPEQKKELSDIAQRIVAPGKGILAADESTGSVAKRFQSINAENTEENRRLYRQLLFTADDRITPCIGGVILFHETMYQKTDDGKPFPQYLKERGMVVGIKVDKGVVPLAGTNGETTTQGLDGLYERCAQYKKDGADFAKWRSVLKITPTTPSHLAIIENANVLARYASICQMHGIVPIVEPEILPDGDHDLKRCQYITEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSCSHKYNSQEIAMSTVTALRRTVPPAVPGITFLSGGQSEEEATVNLNSMNQCPLHRPWALTFSYGRALQASALKAWGGKKENGKACQEEFVKRALANSQACVGKYVSSGASAAGGESLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:100049250])

HSP 1 Score: 446.432 bits (1147), Expect = 3.921e-153
Identity = 225/356 (63.20%), Postives = 265/356 (74.44%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY-VASENQGDTTSLFVEKHVY 1188
            L+ E+K EL++ A  I  PGKG+LAADESTG++  R   I +EN EENRR YRQLLF++D  +   I GVI FHE+ YQKTD G PF KL++++GI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AV GV FLSGGQSE EA++NLNAINT    +PWALTFS+GRALQ S L  W+G+  N KAA ++ I  A+ NG A+LGKY  +      + SL+V  H Y
Sbjct:  100 LTTEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRRYRQLLFTADQRIDSCIGGVIFFHETLYQKTDDGIPFAKLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHSCPTKYSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASVNLNAINTCPLLKPWALTFSYGRALQASALSAWKGELSNEKAATEEFIKRAEANGLAALGKYASSGSGSAASQSLYVANHAY 455          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldocb (aldolase, fructose-bisphosphate C [Source:NCBI gene;Acc:100049250])

HSP 1 Score: 444.506 bits (1142), Expect = 3.938e-153
Identity = 225/356 (63.20%), Postives = 265/356 (74.44%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY-VASENQGDTTSLFVEKHVY 1188
            L+ E+K EL++ A  I  PGKG+LAADESTG++  R   I +EN EENRR YRQLLF++D  +   I GVI FHE+ YQKTD G PF KL++++GI+ GIKVDKGVV LAG+  E TTQGLDGL ERCA Y  DGA FAKWR VLKI   TPS  +++ENANVLARYASICQQNG+VPIVEPE+LPDGDHDL   Q VTE+VLA  Y ALS H+VYLEGTLLKPNMVT G  CP KY   E A+ATVTAL+RTVP AV GV FLSGGQSE EA++NLNAINT    +PWALTFS+GRALQ S L  W+G+  N KAA ++ I  A+ NG A+LGKY  +      + SL+V  H Y
Sbjct:   58 LTTEQKKELQEIAQRIVAPGKGILAADESTGSMAKRLNPIGVENTEENRRRYRQLLFTADQRIDSCIGGVIFFHETLYQKTDDGIPFAKLIKDRGIVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRSVLKISDTTPSELAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHSCPTKYSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASVNLNAINTCPLLKPWALTFSYGRALQASALSAWKGELSNEKAATEEFIKRAEANGLAALGKYASSGSGSAASQSLYVANHAY 413          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldob (fructose-bisphosphate aldolase B [Source:NCBI gene;Acc:100049273])

HSP 1 Score: 437.958 bits (1125), Expect = 2.656e-151
Identity = 221/357 (61.90%), Postives = 261/357 (73.11%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKY--VASENQGDTTSLFVEKHVY 1188
            LS E+K EL   A  I  PGKG+LAADESTGT+  R + I++EN EENRR +R +LFSSD  ++ NI GVI FHE+ YQK D GK FP++++EKGI+ GIKVDKG   L G+  E TTQGLDGL ERCA Y  DG  FAKWRCVLKI    PS  ++ ENANVLARYASICQQNGLVPIVEPE+LPDGDHDL   Q VTE+VLA TY ALS H+VYLEGTLLKPNMVTAG  C  KY   E A+ATVTAL+RTVP +VPG+CFLSGGQSE EA++NLNA+N +   RPW +TFS+GRALQ S L  W GK  N  AA++   + AK+N  AS G+Y    S +Q    SL+   +VY
Sbjct:    8 LSPEQKKELSDIAQRIVAPGKGILAADESTGTMAKRLQKINVENTEENRRCFRDILFSSDQSIANNIGGVIFFHETLYQKADNGKLFPQVIKEKGIVVGIKVDKGTAGLNGTNGETTTQGLDGLSERCAQYKKDGCDFAKWRCVLKISDGCPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLQRCQYVTEKVLAATYKALSDHHVYLEGTLLKPNMVTAGHSCTKKYTPQEVAMATVTALRRTVPASVPGICFLSGGQSEEEASVNLNAMNQVPLHRPWKVTFSYGRALQASALAAWGGKAANRNAAREAFCNRAKINSLASKGEYKPSGSADQASMQSLYSASYVY 364          
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Match: aldoca (fructose-bisphosphate aldolase C [Source:NCBI gene;Acc:101163920])

HSP 1 Score: 436.802 bits (1122), Expect = 8.404e-151
Identity = 210/344 (61.05%), Postives = 257/344 (74.71%), Query Frame = 1
Query:  124 LSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGD 1155
            LSE +K +LR+TAL I  PGKG+LAADES G++  R   + +EN EENRR +RQ+LFS+D  ++  I GVI FHE+ YQ +D G  F K+++++GI+ G+KVDKGVV L G+  E TTQGLDGL ERCA Y  DGA FAKWRCVLKI    PS  +++ENANVLARY+SICQQ+G+VP++EPE+LPDGDHDL   Q VTE+VL   Y A+S H+VYLEGTLLKPNMVTAG  CP KY   E A+ATVTA++RTVP AV G+ FLSGGQSE EAT++LNAIN     +PW LTFSFGRALQ S L+ W+G  EN KAA +Q I  A+ N  A  GKY A +N GD
Sbjct:    8 LSEVQKRDLRETALRIVSPGKGILAADESVGSMAKRLAQVGVENTEENRRQFRQILFSADDRINSCIGGVIFFHETLYQHSDSGVSFVKMIRDRGIMIGVKVDKGVVPLPGTCGETTTQGLDGLSERCAQYKKDGAVFAKWRCVLKISEANPSKLAIMENANVLARYSSICQQHGIVPVIEPEILPDGDHDLKRCQYVTEKVLTAVYKAMSDHHVYLEGTLLKPNMVTAGHSCPTKYTPEEVAMATVTAMRRTVPPAVAGIAFLSGGQSEEEATVHLNAINNCPLPKPWILTFSFGRALQASALRAWRGHQENQKAATEQFIKRAEANSLACQGKYTAGDNHGD 351          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000027545.1 (SMESG000027545.1)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 361/362 (99.72%), Postives = 361/362 (99.72%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 1188
            MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLD LGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY
Sbjct:    1 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDELGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTTSLFVEKHVY 362          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000006056.1 (SMESG000006056.1)

HSP 1 Score: 509.99 bits (1312), Expect = 1.041e-179
Identity = 248/363 (68.32%), Postives = 284/363 (78.24%), Query Frame = 1
Query:  103 MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLENNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQEKGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENALATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTFSFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVAS-ENQGDTTSLFVEKHVY 1188
            MP +A YL+ E++ ELR  A AI  PGKG+LAADEST TIG RF +I +ENN +NR++YR LLFS D  L  +ISGVI++HE+ YQK D G  F KLL+++GIIPGIKVD GVV LAGS DE TTQGLDGL ERCA Y  DGA+FAKWRCVLKIGP +PS Q+MLENANVLARYASICQQNG+VPIVEPEVLPDG+H L  AQKVTEQVLA+ Y AL+ H+VYLEGTLLKPNMVTAG  CP KY   +NA ATV ALQRTVP AV GV FLSGGQSE +AT+NLNAIN    ++PW LTFSFGRALQ SVL+ W+GK ENVKAAQ QL+HLA  NG A+LGK+    +      SLFV  H Y
Sbjct:    1 MPVYAKYLTTEQEDELRAIAEAIVAPGKGILAADESTATIGKRFANIGVENNVDNRKSYRHLLFSGDKSLGNHISGVILYHETLYQKADDGTTFVKLLKDRGIIPGIKVDSGVVPLAGSHDEVTTQGLDGLAERCAQYKKDGAQFAKWRCVLKIGPHSPSHQAMLENANVLARYASICQQNGIVPIVEPEVLPDGNHTLEEAQKVTEQVLAYVYKALADHHVYLEGTLLKPNMVTAGQTCPTKYTMEQNAEATVKALQRTVPPAVAGVTFLSGGQSESDATINLNAINKYHGRKPWPLTFSFGRALQASVLEAWKGKKENVKAAQDQLMHLASANGAAALGKFTGDLKTAAGGKSLFVANHAY 363          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.698e-36
Identity = 64/98 (65.31%), Postives = 71/98 (72.45%), Query Frame = 1
Query:  436 GVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQV 729
              VN   ++    +   +GL ERCA Y  DG  FAKWR VLKIG   PS+ +MLENANVLARYA ICQ+NGLVPIVEPEVLPDG HDL TAQKVTE V
Sbjct:    3 AAVNQESARSRYNSWNQNGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQKVTEDV 100          

HSP 2 Score: 50.8322 bits (120), Expect = 4.141e-7
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 1018 LQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT----SLFVEKHVY 1188
            +Q SV++ W+GK ENV  AQ +L+ LA+ NG AS+G++   E   DTT    SLFV  H Y
Sbjct:  130 IQASVIQKWKGKMENVIPAQMELLKLAQANGAASMGRF---EGVLDTTAGAQSLFVANHAY 187          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.444e-35
Identity = 64/110 (58.18%), Postives = 74/110 (67.27%), Query Frame = 1
Query:  436 GVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTY----WAL 753
              VN   ++    +   +GL ERCA Y  DG  FAKWR VLKIG   PS+ +MLENANVLARYA ICQ+NGLVPIVEPEVLPDG HDL TAQK+   +L   Y    W+L
Sbjct:    3 AAVNQESARSRYNSWNQNGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQKIIIYILKVPYLNQIWSL 112          

HSP 2 Score: 50.8322 bits (120), Expect = 4.203e-7
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 1018 LQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT----SLFVEKHVY 1188
            +Q SV++ W+GK ENV  AQ +L+ LA+ NG AS+G++   E   DTT    SLFV  H Y
Sbjct:  133 IQASVIQKWKGKMENVIPAQMELLKLAQANGAASMGRF---EGVLDTTAGAQSLFVANHAY 190          
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Match: SMESG000034563.1 (SMESG000034563.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.686e-35
Identity = 64/110 (58.18%), Postives = 74/110 (67.27%), Query Frame = 1
Query:  436 GVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRCVLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLPTAQKVTEQVLAFTY----WAL 753
              VN   ++    +   +GL ERCA Y  DG  FAKWR VLKIG   PS+ +MLENANVLARYA ICQ+NGLVPIVEPEVLPDG HDL TAQK+   +L   Y    W+L
Sbjct:    2 AAVNQESARSRYNSWNQNGLDERCAIYKKDGCHFAKWRSVLKIGQHNPSYLAMLENANVLARYAMICQKNGLVPIVEPEVLPDGTHDLFTAQKIIIYILKVPYLNQIWSL 111          

HSP 2 Score: 50.8322 bits (120), Expect = 4.384e-7
Identity = 29/61 (47.54%), Postives = 39/61 (63.93%), Query Frame = 1
Query: 1018 LQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQGDTT----SLFVEKHVY 1188
            +Q SV++ W+GK ENV  AQ +L+ LA+ NG AS+G++   E   DTT    SLFV  H Y
Sbjct:  132 IQASVIQKWKGKMENVIPAQMELLKLAQANGAASMGRF---EGVLDTTAGAQSLFVANHAY 189          
The following BLAST results are available for this feature:
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDOC1.026e-15762.91aldolase, fructose-bisphosphate C [Source:HGNC Sym... [more]
ALDOC1.026e-15762.91aldolase, fructose-bisphosphate C [Source:HGNC Sym... [more]
ALDOA2.973e-15662.36aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA2.973e-15662.36aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
ALDOA2.973e-15662.36aldolase, fructose-bisphosphate A [Source:HGNC Sym... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldo-13.895e-15662.47Fructose-bisphosphate aldolase 1 [Source:UniProtK... [more]
aldo-13.895e-15662.47Fructose-bisphosphate aldolase 1 [Source:UniProtK... [more]
aldo-22.792e-15463.06Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
aldo-22.792e-15463.06Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
aldo-24.575e-10164.17Fructose-bisphosphate aldolase 2 [Source:UniProtK... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ald14.787e-16365.75gene:FBgn0000064 transcript:FBtr0084995[more]
Ald14.787e-16365.75gene:FBgn0000064 transcript:FBtr0084999[more]
Ald14.787e-16365.75gene:FBgn0000064 transcript:FBtr0084994[more]
Ald14.787e-16365.75gene:FBgn0000064 transcript:FBtr0310660[more]
Ald14.787e-16365.75gene:FBgn0000064 transcript:FBtr0339614[more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldoaa3.270e-16064.29aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
aldoaa3.270e-16064.29aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
aldoab8.597e-15962.64aldolase a, fructose-bisphosphate, b [Source:ZFIN;... [more]
aldob5.006e-15762.75aldolase b, fructose-bisphosphate [Source:NCBI gen... [more]
aldob8.381e-15364.48aldolase b, fructose-bisphosphate [Source:NCBI gen... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldoc7.614e-15763.89aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldoc9.966e-15162.50aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldob5.768e-15062.68aldolase, fructose-bisphosphate B [Source:NCBI gen... [more]
aldoc1.304e-14761.33aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
arfgef22.949e-14760.82ADP ribosylation factor guanine nucleotide exchang... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldoc4.209e-15863.36aldolase C, fructose-bisphosphate [Source:MGI Symb... [more]
Aldoc4.209e-15863.36aldolase C, fructose-bisphosphate [Source:MGI Symb... [more]
Aldoart16.717e-15762.91aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:M... [more]
Aldoart11.170e-15662.74aldolase 1 A, retrogene 1 [Source:MGI Symbol;Acc:M... [more]
Aldoa1.606e-15662.91aldolase A, fructose-bisphosphate [Source:MGI Symb... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GP32|ALF_ECHMU3.842e-17968.60Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
sp|P53442|ALF_SCHMA8.537e-17468.22Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
sp|P07764|ALF_DROME4.798e-16265.75Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
sp|P09117|ALDOC_RAT1.889e-15864.19Fructose-bisphosphate aldolase C OS=Rattus norvegi... [more]
sp|Q9GKW3|ALDOC_MACFA1.289e-15763.19Fructose-bisphosphate aldolase C OS=Macaca fascicu... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R8R60.000e+070.88Fructose-bisphosphate aldolase OS=Crassostrea giga... [more]
A0A4S2M8910.000e+070.05Fructose-bisphosphate aldolase OS=Opisthorchis fel... [more]
A0A1S8X7Q30.000e+070.05Fructose-bisphosphate aldolase (Fragment) OS=Opist... [more]
A0A2H1C7F21.644e-18070.33Fructose-bisphosphate aldolase OS=Fasciola hepatic... [more]
A0A075AIH64.439e-18069.75Fructose-bisphosphate aldolase (Fragment) OS=Opist... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldoaa7.369e-16363.74aldolase, fructose-bisphosphate A [Source:NCBI gen... [more]
aldob4.610e-15963.59fructose-bisphosphate aldolase B [Source:NCBI gene... [more]
aldocb8.974e-15763.48aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldoaa1.186e-15465.96aldolase, fructose-bisphosphate A [Source:NCBI gen... [more]
aldoaa1.475e-15465.96aldolase, fructose-bisphosphate A [Source:NCBI gen... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aldob4.773e-15563.31aldolase b, fructose-bisphosphate [Source:NCBI gen... [more]
aldoaa2.087e-12854.77aldolase a, fructose-bisphosphate, a [Source:ZFIN;... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO376722.011e-16065.45Fructose-bisphosphate aldolase [Source:UniProtKB/... [more]
EDO289581.122e-1948.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldoa5.127e-16163.09fructose-bisphosphate aldolase A [Source:NCBI gene... [more]
aldocb3.921e-15363.20aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldocb3.938e-15363.20aldolase, fructose-bisphosphate C [Source:NCBI gen... [more]
aldob2.656e-15161.90fructose-bisphosphate aldolase B [Source:NCBI gene... [more]
aldoca8.404e-15161.05fructose-bisphosphate aldolase C [Source:NCBI gene... [more]
back to top
BLAST of Fructose-bisphosphate aldolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027545.10.000e+099.72SMESG000027545.1[more]
SMESG000006056.11.041e-17968.32SMESG000006056.1[more]
SMESG000034563.11.698e-3665.31SMESG000034563.1[more]
SMESG000034563.11.444e-3558.18SMESG000034563.1[more]
SMESG000034563.11.686e-3558.18SMESG000034563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013591 ID=SMED30013591|Name=Fructose-bisphosphate aldolase|organism=Schmidtea mediterranea sexual|type=transcript|length=1593bp
AAATCTATATAAATCTTATATGTATTTGATTTCTTTAAATTTTTCAATAT
AACACCCTGGATATAAATTTTTGTACTTTGAATTATAAACAAAGTAAAAA
GTATGCCTAATTTTGCTAGCTACTTATCGGAGGAGAAAAAGTTAGAATTA
AGAAAAACGGCATTAGCCATTGCTCATCCGGGTAAAGGCTTACTGGCGGC
AGATGAAAGCACTGGCACAATTGGAAACAGATTCAAATCAATTAGCTTAG
AGAATAACGAAGAAAACCGAAGAGCGTATAGGCAACTTTTATTTTCATCA
GATGCTGTTTTATCTGAAAACATTTCTGGAGTAATTATGTTCCACGAATC
ATTTTATCAAAAAACTGACTGTGGAAAACCTTTCCCTAAACTATTGCAAG
AGAAGGGAATAATACCAGGCATTAAGGTTGATAAAGGAGTGGTTAATCTA
GCTGGTTCCCAAGACGAATGTACAACGCAAGGTCTTGATGGACTAGGCGA
AAGATGCGCAACTTACTACAATGACGGAGCTAGGTTTGCAAAGTGGCGTT
GCGTTTTAAAAATCGGTCCGGAAACTCCATCATTTCAATCAATGCTCGAA
AATGCTAATGTACTGGCAAGATATGCTTCAATATGCCAACAAAACGGTTT
GGTACCAATTGTGGAGCCCGAAGTATTGCCTGATGGAGATCATGACCTAC
CCACAGCACAAAAGGTTACAGAGCAAGTACTAGCGTTTACGTATTGGGCA
CTGTCTGTGCACAACGTTTACTTGGAAGGAACTCTATTAAAACCGAATAT
GGTAACAGCCGGAGTGAAATGTCCGAATAAATACCTCTATTCTGAAAATG
CTTTGGCGACTGTAACTGCTCTACAAAGAACAGTGCCAACAGCGGTTCCA
GGGGTATGCTTCCTATCCGGAGGTCAATCTGAGCTTGAGGCAACGCTCAA
CTTGAATGCCATTAATACTATTGATGCCAAAAGGCCTTGGGCCTTGACAT
TCAGTTTCGGTCGTGCCTTACAGGGCTCTGTTCTTAAGGTTTGGCAGGGT
AAGCCGGAAAATGTCAAAGCTGCTCAAAAGCAACTCATCCATTTGGCAAA
AATGAATGGCAATGCATCGCTGGGGAAATATGTCGCCTCCGAAAATCAAG
GGGACACGACGTCCCTATTTGTGGAGAAGCATGTCTATTAGTCATTGTGA
ATGTATTCATTGTAACGAGACAATTTGTTTAGTTTATGGTTTGGTAATAC
AGTTTAGCATTTGATTACAGTTATCATTAGGTAAATGTGACCCTATTTGG
GTCATACTCTGGAAATATTTTATTAAAAGTTGTTTAATGAAAATTTTGCT
GAAAATTTTATGAAAGTTGGTATGTGTGTATATGTTTGGATAAAGTGGTC
GGCGTATAATTTTTCTTGAAATTTTATTCTGCTCTGCATGTAATTTTTTT
AATTTTTAAAGTTTTTACATTCGAAAAATATTTTAAATGATTTTTGGACA
GACAACTCTTGGTTCGATTATTTGATTAATATGGCAATGGACAGAATTCA
ATTTAGAGCTTTATAAAGGTTTAGTATTTATTCTAATTTTGAG
back to top

protein sequence of SMED30013591-orf-1

>SMED30013591-orf-1 ID=SMED30013591-orf-1|Name=SMED30013591-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MPNFASYLSEEKKLELRKTALAIAHPGKGLLAADESTGTIGNRFKSISLE
NNEENRRAYRQLLFSSDAVLSENISGVIMFHESFYQKTDCGKPFPKLLQE
KGIIPGIKVDKGVVNLAGSQDECTTQGLDGLGERCATYYNDGARFAKWRC
VLKIGPETPSFQSMLENANVLARYASICQQNGLVPIVEPEVLPDGDHDLP
TAQKVTEQVLAFTYWALSVHNVYLEGTLLKPNMVTAGVKCPNKYLYSENA
LATVTALQRTVPTAVPGVCFLSGGQSELEATLNLNAINTIDAKRPWALTF
SFGRALQGSVLKVWQGKPENVKAAQKQLIHLAKMNGNASLGKYVASENQG
DTTSLFVEKHVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013785Aldolase_TIM
IPR000741FBA_I
IPR029768Aldolase_I_AS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004332fructose-bisphosphate aldolase activity
GO:0016829lyase activity
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000741Fructose-bisphosphate aldolase, class-IPFAMPF00274Glycolyticcoord: 15..362
e-value: 1.2E-172
score: 573.5
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 3..362
e-value: 6.7E-168
score: 559.9
NoneNo IPR availablePANTHERPTHR11627FRUCTOSE-BISPHOSPHATE ALDOLASEcoord: 12..362
NoneNo IPR availablePANTHERPTHR11627:SF20FRUCTOSE-BISPHOSPHATE ALDOLASEcoord: 12..362
NoneNo IPR availableCDDcd00948FBP_aldolase_I_acoord: 13..343
e-value: 0.0
score: 608.094
NoneNo IPR availableSUPERFAMILYSSF51569Aldolasecoord: 5..362
IPR029768Fructose-bisphosphate aldolase class-I active sitePROSITEPS00158ALDOLASE_CLASS_Icoord: 222..232