Abhydrolase domain containing protein

Overview
NameAbhydrolase domain containing protein
Smed IDSMED30013589
Length (bp)1436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abhydrolase domain containing protein (SMED30013589) t-SNE clustered cells

Violin plots show distribution of expression levels for Abhydrolase domain containing protein (SMED30013589) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abhydrolase domain containing protein (SMED30013589) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abhydrolase domain containing protein (SMED30013589) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013589

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30013589SMESG000080893.1 dd_Smed_v4_7573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Match: ABHD4 (abhydrolase domain containing 4 [Source:HGNC Symbol;Acc:HGNC:20154])

HSP 1 Score: 219.164 bits (557), Expect = 1.008e-66
Identity = 117/317 (36.91%), Postives = 171/317 (53.94%), Query Frame = 2
Query:  326 NNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRPAF  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +  +DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I  A HHVYA+  + FN  V  IC++V
Sbjct:   67 DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAP--PAWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFEDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSV 341          
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 209.534 bits (532), Expect = 5.993e-63
Identity = 132/376 (35.11%), Postives = 191/376 (50.80%), Query Frame = 2
Query:  143 WLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WL  WCP+S      AE ++L           VP  +KK  +R      N   + +      N  P+VL+HG G GL +W  N   L   R VY FDL+GFG SSRP F  +  +VEN F++SIE+WR  LGL K I+LGH+LGG+LA +Y +K+   + H+IL +PWGF E     +    +   +  L       NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  +  +I V+ I+G +S +D  +G   Q LR +S V    I  AGH+VYA+   +FN  V  IC+ V
Sbjct:   23 WLPTWCPTSISHLKEAEEKMLK---------CVPCTYKKEPVRI--SNGNKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTV 348          
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 209.534 bits (532), Expect = 5.993e-63
Identity = 132/376 (35.11%), Postives = 191/376 (50.80%), Query Frame = 2
Query:  143 WLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WL  WCP+S      AE ++L           VP  +KK  +R      N   + +      N  P+VL+HG G GL +W  N   L   R VY FDL+GFG SSRP F  +  +VEN F++SIE+WR  LGL K I+LGH+LGG+LA +Y +K+   + H+IL +PWGF E     +    +   +  L       NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  +  +I V+ I+G +S +D  +G   Q LR +S V    I  AGH+VYA+   +FN  V  IC+ V
Sbjct:   23 WLPTWCPTSISHLKEAEEKMLK---------CVPCTYKKEPVRI--SNGNKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTV 348          
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 204.142 bits (518), Expect = 2.498e-61
Identity = 108/297 (36.36%), Postives = 157/297 (52.86%), Query Frame = 2
Query:  377 WCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            W  N   L   R VY FDL+GFG SSRP F  +  +VEN F++SIE+WR  LGL K I+LGH+LGG+LA +Y +K+   + H+IL +PWGF E     +    +   +  L       NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  +  +I V+ I+G +S +D  +G   Q LR +S V    I  AGH+VYA+   +FN  V  IC+ V
Sbjct:   50 WALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTV 307          
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 204.142 bits (518), Expect = 2.498e-61
Identity = 108/297 (36.36%), Postives = 157/297 (52.86%), Query Frame = 2
Query:  377 WCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            W  N   L   R VY FDL+GFG SSRP F  +  +VEN F++SIE+WR  LGL K I+LGH+LGG+LA +Y +K+   + H+IL +PWGF E     +    +   +  L       NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  +  +I V+ I+G +S +D  +G   Q LR +S V    I  AGH+VYA+   +FN  V  IC+ V
Sbjct:   50 WALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTV 307          
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Match: abhd-5.2 (Abhydrolase domain-containing protein abhd-5.2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZ86])

HSP 1 Score: 220.32 bits (560), Expect = 2.393e-67
Identity = 131/368 (35.60%), Postives = 190/368 (51.63%), Query Frame = 2
Query:  155 CPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGY----QAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYV 1246
            CPS S     AE R+L+ +       L+ +  K   I T+ V     N E E+ I    YPIVL+HG GAG+A+W   +  LA+ + V+ FDL GFG SSRP FS +    E   I SIE WR  + L+K  ++GHS GGYLA SY +K+   + ++ILADPWGF E    F     +      + ++ +  NPL  +RL G + P ++R +R DL                                         LK++E     ++DY+Y  N+R P+GE  FK LS+ +GWA +PM KR ++LD+ + VTFI+G +SW+DW+T      + +H      V   ++D AGHHVYA+ ++ F   V
Sbjct:   22 CPSKSQRLAEAEGRILSALGIKYLARLIQIPFKNTEISTITV-----NCESEQPIVKAKYPIVLIHGFGAGVALWGSAIKRLAQFQTVHAFDLPGFGRSSRPKFSSDPETAETEMIDSIEQWRDKMNLEKMNLVGHSFGGYLATSYALKYPKRVENLILADPWGFNEMDPEFAQK--LTSRQKNIFWVIQQFNPLAVLRLVGGYGPSLVRRLRPDLA----------------------------------------LKYSED----VYDYIYLANSRDPTGEEVFKCLSENLGWAKQPMSKRFHELDNTVPVTFIHGERSWIDWRTTRRLFGELEH------VESHIMDSAGHHVYADDADKFVQLV 332          
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Match: abhd-5.2 (Abhydrolase domain-containing protein abhd-5.2 [Source:UniProtKB/Swiss-Prot;Acc:H2KZ86])

HSP 1 Score: 222.246 bits (565), Expect = 4.793e-67
Identity = 133/377 (35.28%), Postives = 196/377 (51.99%), Query Frame = 2
Query:  128 TFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGY----QAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYV 1246
            +++PY+   CPS S     AE R+L+ +       L+ +  K   I T+ V     N E E+ I    YPIVL+HG GAG+A+W   +  LA+ + V+ FDL GFG SSRP FS +    E   I SIE WR  + L+K  ++GHS GGYLA SY +K+   + ++ILADPWGF E    F     +      + ++ +  NPL  +RL G + P ++R +R DL                                         LK++E     ++DY+Y  N+R P+GE  FK LS+ +GWA +PM KR ++LD+ + VTFI+G +SW+DW+T      + +H      V   ++D AGHHVYA+ ++ F   V
Sbjct:  100 SWFPYFS--CPSKSQRLAEAEGRILSALGIKYLARLIQIPFKNTEISTITV-----NCESEQPIVKAKYPIVLIHGFGAGVALWGSAIKRLAQFQTVHAFDLPGFGRSSRPKFSSDPETAETEMIDSIEQWRDKMNLEKMNLVGHSFGGYLATSYALKYPKRVENLILADPWGFNEMDPEFAQK--LTSRQKNIFWVIQQFNPLAVLRLVGGYGPSLVRRLRPDLA----------------------------------------LKYSED----VYDYIYLANSRDPTGEEVFKCLSENLGWAKQPMSKRFHELDNTVPVTFIHGERSWIDWRTTRRLFGELEH------VESHIMDSAGHHVYADDADKFVQLV 417          
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Match: lid-1 (Abhydrolase domain-containing protein lid-1 [Source:UniProtKB/Swiss-Prot;Acc:O02218])

HSP 1 Score: 219.164 bits (557), Expect = 8.015e-67
Identity = 126/374 (33.69%), Postives = 183/374 (48.93%), Query Frame = 2
Query:  143 WLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEA 1264
            W+ +   S     + E RL        E   VPV  K+  + T+ V      +        N   IV + G+GAG+AM+  N ++ A+   V+ FD +GFG SSR  FSD+N   E   ++ +EDWR  +G++K  I+GH+ GGYLA +Y ++    + H+IL DPWGF E     E        +S L  +  Y NP  P+R  GP+AP I++ +R DL + F                       L + D                   I+ YVY+ N   P+GE AF  ++ P+GWA RPMIKR N +D  + V+FIYG KSW+D       Q  R N+ V++K++  AG HVYA+    FN  V+ + E 
Sbjct:   16 WMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAEN-------LNGEAIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYAWMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRFP---------------------GLHDYD-------------------IYKYVYYLNLPNPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENAYVDIKIVRGAGTHVYADDPAAFNEIVSDVVEG 342          
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Match: lid-1 (Abhydrolase domain-containing protein lid-1 [Source:UniProtKB/Swiss-Prot;Acc:O02218])

HSP 1 Score: 219.164 bits (557), Expect = 8.015e-67
Identity = 126/374 (33.69%), Postives = 183/374 (48.93%), Query Frame = 2
Query:  143 WLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEA 1264
            W+ +   S     + E RL        E   VPV  K+  + T+ V      +        N   IV + G+GAG+AM+  N ++ A+   V+ FD +GFG SSR  FSD+N   E   ++ +EDWR  +G++K  I+GH+ GGYLA +Y ++    + H+IL DPWGF E     E        +S L  +  Y NP  P+R  GP+AP I++ +R DL + F                       L + D                   I+ YVY+ N   P+GE AF  ++ P+GWA RPMIKR N +D  + V+FIYG KSW+D       Q  R N+ V++K++  AG HVYA+    FN  V+ + E 
Sbjct:   16 WMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAEN-------LNGEAIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYAWMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRFP---------------------GLHDYD-------------------IYKYVYYLNLPNPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENAYVDIKIVRGAGTHVYADDPAAFNEIVSDVVEG 342          
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Match: lid-1 (Abhydrolase domain-containing protein lid-1 [Source:UniProtKB/Swiss-Prot;Acc:O02218])

HSP 1 Score: 216.083 bits (549), Expect = 1.355e-65
Identity = 128/382 (33.51%), Postives = 188/382 (49.21%), Query Frame = 2
Query:  143 WLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMN-WT-------LSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEA 1264
            W+ +   S     + E RL        E   VPV  K+  + T+ V      +        N   IV + G+GAG+AM+  N ++ A+   V+ FD +GFG SSR  FSD+N   E   ++ +EDWR  +G++K  I+GH+ GGYLA +Y ++    + H+IL DPWGF E   + E+   +N W        +S L  +  Y NP  P+R  GP+AP I++ +R DL + F                       L + D                   I+ YVY+ N   P+GE AF  ++ P+GWA RPMIKR N +D  + V+FIYG KSW+D       Q  R N+ V++K++  AG HVYA+    FN  V+ + E 
Sbjct:   16 WMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAEN-------LNGEAIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAE---KVETTEKLNTWLQIKPYAWMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRFP---------------------GLHDYD-------------------IYKYVYYLNLPNPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENAYVDIKIVRGAGTHVYADDPAAFNEIVSDVVEG 347          
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Match: CG1882 (gene:FBgn0033226 transcript:FBtr0339119)

HSP 1 Score: 234.187 bits (596), Expect = 3.039e-72
Identity = 112/309 (36.25%), Postives = 173/309 (55.99%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICE 1261
            P+VL+HG+GAG+A+W  NLDA A+ R VY  D++GFG SSRP F+ + +  E  F++S+E+WR  + +   I+LGHS+GG++A SY +     + H+ILADPWGF E  S   +   +   +  ++ +   LNPL+ +R  GPF  ++++  R D+   F                                         E D+  +  Y++ CN + PSGE+AF  +    GWA  PMI RI D+ S+I +TFIYG +SW+D  +G + +  R ++ V++K++  AGHHVYA+  + FN YVN  C+
Sbjct:   47 PLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQ-------------------------------------STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCD 318          
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Match: CG1882 (gene:FBgn0033226 transcript:FBtr0088836)

HSP 1 Score: 234.187 bits (596), Expect = 3.039e-72
Identity = 112/309 (36.25%), Postives = 173/309 (55.99%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICE 1261
            P+VL+HG+GAG+A+W  NLDA A+ R VY  D++GFG SSRP F+ + +  E  F++S+E+WR  + +   I+LGHS+GG++A SY +     + H+ILADPWGF E  S   +   +   +  ++ +   LNPL+ +R  GPF  ++++  R D+   F                                         E D+  +  Y++ CN + PSGE+AF  +    GWA  PMI RI D+ S+I +TFIYG +SW+D  +G + +  R ++ V++K++  AGHHVYA+  + FN YVN  C+
Sbjct:   47 PLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQ-------------------------------------STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCD 318          
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Match: CG1882 (gene:FBgn0033226 transcript:FBtr0088837)

HSP 1 Score: 234.187 bits (596), Expect = 3.039e-72
Identity = 112/309 (36.25%), Postives = 173/309 (55.99%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICE 1261
            P+VL+HG+GAG+A+W  NLDA A+ R VY  D++GFG SSRP F+ + +  E  F++S+E+WR  + +   I+LGHS+GG++A SY +     + H+ILADPWGF E  S   +   +   +  ++ +   LNPL+ +R  GPF  ++++  R D+   F                                         E D+  +  Y++ CN + PSGE+AF  +    GWA  PMI RI D+ S+I +TFIYG +SW+D  +G + +  R ++ V++K++  AGHHVYA+  + FN YVN  C+
Sbjct:   47 PLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQ-------------------------------------STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCD 318          
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Match: CG1882 (gene:FBgn0033226 transcript:FBtr0088835)

HSP 1 Score: 234.187 bits (596), Expect = 3.039e-72
Identity = 112/309 (36.25%), Postives = 173/309 (55.99%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICE 1261
            P+VL+HG+GAG+A+W  NLDA A+ R VY  D++GFG SSRP F+ + +  E  F++S+E+WR  + +   I+LGHS+GG++A SY +     + H+ILADPWGF E  S   +   +   +  ++ +   LNPL+ +R  GPF  ++++  R D+   F                                         E D+  +  Y++ CN + PSGE+AF  +    GWA  PMI RI D+ S+I +TFIYG +SW+D  +G + +  R ++ V++K++  AGHHVYA+  + FN YVN  C+
Sbjct:   47 PLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQ-------------------------------------STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCD 318          
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Match: CG1882 (gene:FBgn0033226 transcript:FBtr0088834)

HSP 1 Score: 236.113 bits (601), Expect = 3.120e-72
Identity = 123/377 (32.63%), Postives = 193/377 (51.19%), Query Frame = 2
Query:  131 FWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICE 1261
             W +   W  SS  +    E ++L+ V        V +         ++    N  S+E         P+VL+HG+GAG+A+W  NLDA A+ R VY  D++GFG SSRP F+ + +  E  F++S+E+WR  + +   I+LGHS+GG++A SY +     + H+ILADPWGF E  S   +   +   +  ++ +   LNPL+ +R  GPF  ++++  R D+   F                                         E D+  +  Y++ CN + PSGE+AF  +    GWA  PMI RI D+ S+I +TFIYG +SW+D  +G + +  R ++ V++K++  AGHHVYA+  + FN YVN  C+
Sbjct:   54 LWKWLCNWTSSSPTMLRAVEKKILSYVKLPYRGFFVDIGPAVGEADKIWTISMNTESKE--------VPLVLLHGLGAGIALWVMNLDAFAKGRPVYAMDILGFGRSSRPLFAKDALVCEKQFVKSVEEWRREMNINDMILLGHSMGGFIASSYALSHPERVKHLILADPWGFPEKPSDSTNGKTIPLWVRAIARVLTPLNPLWALRAAGPFGQWVVQKTRPDIMRKFQ-------------------------------------STIEEDINLLPQYIHQCNAQNPSGESAFHTMMQSFGWAKHPMIHRIKDVRSDIPITFIYGSRSWIDSSSGEKIKSQRGSNMVDIKIVTGAGHHVYADKPDVFNRYVNETCD 385          
BLAST of Abhydrolase domain containing protein vs. Ensembl Zebrafish
Match: abhd4 (abhydrolase domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-050417-83])

HSP 1 Score: 241.506 bits (615), Expect = 6.811e-75
Identity = 136/389 (34.96%), Postives = 195/389 (50.13%), Query Frame = 2
Query:  134 WPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECK-----------SRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            W +W  W P+S  L   AE ++L  + +      V  L  +  I TL V       ++E+       P+V+VHG G G+ +W +NLDAL+  R VY FDL+GFG SSRP+F  +    E  F+ SIE WR  +GL++ I+LGHSLGGYLA SY I++   + H+IL DPWGF E             S  +      W  +L S +F + NPL  +R  GP+ P ++   R D    F       ++  DD +                                   Y+YHCN + PSGE  FK + + +GWA RPM++R++ L   + V+ +YG  SW+D  TG     +R  S  +V +I+DA HHVYA+   +FN  V +IC  V
Sbjct:   49 WSWWPSWRPTSMSLLKSAEAKILACIRNEVWSRFV-TLPNQTRIWTLKVTNKTTRKQKEQAA---QTPLVMVHGFGGGVGLWIRNLDALSRSRPVYAFDLLGFGRSSRPSFPADASLAEEQFVSSIEQWRESMGLERMILLGHSLGGYLATSYTIQYPERVSHLILVDPWGFPERPQPQVQGSAGQGSEVKRVGPPRWVKALAS-VFSFFNPLAVIRAAGPWGPGLVNRFRPDFKRKFE------DLFDDDTMT---------------------------------QYIYHCNAQNPSGEVGFKAMCESLGWAKRPMVQRVHLLPPLMPVSLLYGSLSWVDSSTGNTVAQIRGKSPTSVTLIEDASHHVYADQPEEFNRVVENICNTV 393          
BLAST of Abhydrolase domain containing protein vs. Ensembl Zebrafish
Match: abhd5b (abhydrolase domain containing 5b [Source:ZFIN;Acc:ZDB-GENE-110411-277])

HSP 1 Score: 177.948 bits (450), Expect = 5.020e-51
Identity = 124/385 (32.21%), Postives = 190/385 (49.35%), Query Frame = 2
Query:  140 YWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQI--YFNNYPIVLVHGMGAGLAMWCKNLDALAER-RQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFES--PFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQ 1279
            +W  WCP+S      AE ++L+ ++       V V   +  IRTL      FN E  R          +VL+HG GA + +W  NL ALA+  R V   DL+GFG SSRP FS +  + E   ++++E WR    ++  I+LGH LG Y++ +Y + +   + H+IL +PWGF    S  E   PF++     +        NPL  +RL GP  P +L+L+R D    ++ A  S N +                                       DY+YH NT+T SGE  FK ++ P GW   P+++R++ +   + ++FIYG +S +D Q+G   Q +R  S   V VI  AGH+V+A+   DFN  V  IC +V++++
Sbjct:   21 WWPSWCPTSPTHLSRAEDKILSALSISFSRGFVSVSSGQQ-IRTLV-----FNGEGLRGAGSAGEGPALVLLHGFGAAVGLWVLNLQALAQAGRPVLALDLLGFGRSSRPVFSTDPQQAEQQQVEALEHWRSQQRVESMILLGHHLGAYISAAYALAYPQRVKHLILVEPWGFSARPSAPERWVPFWIK----VFGAAMNPFNPLALLRLAGPLGPLLLQLLRSDFKQKYS-ALFSDNTVP--------------------------------------DYIYHINTQTASGEVGFKNMTVPYGWPQHPLLERMDKISPSLPISFIYGSRSCIDGQSGRILQEMRPGSHTEVIVIQGAGHYVFADQPEDFNRAVLEICNSVKHTE 356          
BLAST of Abhydrolase domain containing protein vs. Ensembl Zebrafish
Match: abhd5b (abhydrolase domain containing 5b [Source:ZFIN;Acc:ZDB-GENE-110411-277])

HSP 1 Score: 85.5001 bits (210), Expect = 1.393e-18
Identity = 55/158 (34.81%), Postives = 83/158 (52.53%), Query Frame = 2
Query:  140 YWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQI--YFNNYPIVLVHGMGAGLAMWCKNLDALAER-RQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKF 604
            +W  WCP+S      AE ++L+ ++       V V   +  IRTL      FN E  R          +VL+HG GA + +W  NL ALA+  R V   DL+GFG SSRP FS +  + E   ++++E WR    ++  I+LGH LG Y++ +Y + +
Sbjct:   21 WWPSWCPTSPTHLSRAEDKILSALSISFSRGFVSVSSGQQ-IRTLV-----FNGEGLRGAGSAGEGPALVLLHGFGAAVGLWVLNLQALAQAGRPVLALDLLGFGRSSRPVFSTDPQQAEQQQVEALEHWRSQQRVESMILLGHHLGAYISAAYALAY 172          
BLAST of Abhydrolase domain containing protein vs. Ensembl Xenopus
Match: jmjd4 (jumonji domain containing 4 [Source:Xenbase;Acc:XB-GENE-1007413])

HSP 1 Score: 239.195 bits (609), Expect = 2.748e-74
Identity = 137/375 (36.53%), Postives = 193/375 (51.47%), Query Frame = 2
Query:  152 WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFREC---KSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WCP+S       E+R+L  + +      V  L  ++ I TL V     + E +++      P+V+VHG G G+ +W +NLD L+  R ++ FDL+GFG SSRP F  +    E  F+ SIE WR  +G++  I+LGHSLGG+LA SY IKF   + H+IL DPWGF       S   SP    W  +L + L +  NPL  VR  GP+ P +++  R DL   F          +DD                                  I +Y+YHCN +TPSGE+AFK + +  GWA RPM+ RIN +  ++ +TFIYG ++W+D  TG + +  R +S V    I  A HHVYA+    FN  V  IC+A 
Sbjct:   30 WCPTSMSKLKAVESRILQCIKNKFSAQYV-SLPDQNKIWTLTV-----SPELQKKT-----PLVMVHGFGGGIGLWIQNLDHLSSSRTLHAFDLLGFGRSSRPNFPSDPEGAEEQFVSSIEQWREQMGIRNMILLGHSLGGFLAASYSIKFPERVKHLILVDPWGFPSMPTDPSEIRSP--PTWVKALAAVLGRS-NPLAVVRAAGPWGPGLVQRFRPDLKRKFQ------EYFEDD---------------------------------TIMEYIYHCNAQTPSGESAFKTMMERFGWAKRPMMSRINQIPKDLPITFIYGAETWIDRSTGERVKEERSDSFVKTLAIKGASHHVYADQPGTFNALVEEICDAA 351          
BLAST of Abhydrolase domain containing protein vs. Ensembl Xenopus
Match: jmjd4 (jumonji domain containing 4 [Source:Xenbase;Acc:XB-GENE-1007413])

HSP 1 Score: 238.424 bits (607), Expect = 3.535e-74
Identity = 137/375 (36.53%), Postives = 193/375 (51.47%), Query Frame = 2
Query:  152 WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFREC---KSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WCP+S       E+R+L  + +      V  L  ++ I TL V     + E +++      P+V+VHG G G+ +W +NLD L+  R ++ FDL+GFG SSRP F  +    E  F+ SIE WR  +G++  I+LGHSLGG+LA SY IKF   + H+IL DPWGF       S   SP    W  +L + L +  NPL  VR  GP+ P +++  R DL   F          +DD                                  I +Y+YHCN +TPSGE+AFK + +  GWA RPM+ RIN +  ++ +TFIYG ++W+D  TG + +  R +S V    I  A HHVYA+    FN  V  IC+A 
Sbjct:   19 WCPTSMSKLKAVESRILQCIKNKFSAQYV-SLPDQNKIWTLTV-----SPELQKKT-----PLVMVHGFGGGIGLWIQNLDHLSSSRTLHAFDLLGFGRSSRPNFPSDPEGAEEQFVSSIEQWREQMGIRNMILLGHSLGGFLAASYSIKFPERVKHLILVDPWGFPSMPTDPSEIRSP--PTWVKALAAVLGRS-NPLAVVRAAGPWGPGLVQRFRPDLKRKFQ------EYFEDD---------------------------------TIMEYIYHCNAQTPSGESAFKTMMERFGWAKRPMMSRINQIPKDLPITFIYGAETWIDRSTGERVKEERSDSFVKTLAIKGASHHVYADQPGTFNALVEEICDAA 340          
BLAST of Abhydrolase domain containing protein vs. Ensembl Xenopus
Match: abhd5 (abhydrolase domain containing 5 [Source:NCBI gene;Acc:549643])

HSP 1 Score: 230.335 bits (586), Expect = 1.157e-70
Identity = 128/395 (32.41%), Postives = 203/395 (51.39%), Query Frame = 2
Query:   92 TFSPGSIYQQENTFWPYWL-KWCPSSSYLAILAETRLLNRVNSV--KEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
             + PG   ++E+ + P WL  WCP+S      AE ++L  +  +  KE I++   ++        V+  +F     +Q   N  P+VL+HG G G+ +W  N + +   R VY  D++GFG SSRP F  +  K E  F+QSIE+WR  LGL+K I+LGH+LG +LA +Y +K+   +  IIL +PWGF +     +    +   +  +  +    NPL  +RL GP    +++ +R D    ++      ++  DD                                  + +Y+YHCN ++PSGE AF+ ++ P GWA RPM++RI+ +  +I +T IYG +S +D  +G   Q LR NS V    I  AGH+V+A+   +FN  V  IC++V
Sbjct:   28 VYVPGGQPERESGWLPSWLPAWCPTSIPHLEEAEEKMLKSITRIYSKEHIVISDGNR--------VWTLSF-----KQTLSNKTPLVLLHGFGGGVGLWVLNFENICRDRTVYALDILGFGRSSRPHFEGDAEKAEEQFVQSIEEWRNTLGLEKMILLGHNLGAFLASAYSLKYPSRVKSIILVEPWGFPDRPGNADEGRPIPIWIKAVGAMLSPFNPLAGLRLAGPLGLSLVQRLRPDFKKKYS------SMFDDD---------------------------------TVTEYIYHCNAQSPSGETAFRNMTVPYGWAQRPMLQRIDKMHPDIPITVIYGARSCIDGNSGSTIQSLRPNSYVKTIAIRGAGHYVFADQPEEFNQKVTEICDSV 370          
BLAST of Abhydrolase domain containing protein vs. Ensembl Xenopus
Match: abhd5 (abhydrolase domain containing 5 [Source:NCBI gene;Acc:549643])

HSP 1 Score: 224.942 bits (572), Expect = 6.865e-69
Identity = 126/388 (32.47%), Postives = 200/388 (51.55%), Query Frame = 2
Query:  113 YQQENTFWPYWL-KWCPSSSYLAILAETRLLNRVNSV--KEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            Y++ + + P WL  WCP+S      AE ++L  +  +  KE I++   ++        V+  +F     +Q   N  P+VL+HG G G+ +W  N + +   R VY  D++GFG SSRP F  +  K E  F+QSIE+WR  LGL+K I+LGH+LG +LA +Y +K+   +  IIL +PWGF +     +    +   +  +  +    NPL  +RL GP    +++ +R D    ++      ++  DD                                  + +Y+YHCN ++PSGE AF+ ++ P GWA RPM++RI+ +  +I +T IYG +S +D  +G   Q LR NS V    I  AGH+V+A+   +FN  V  IC++V
Sbjct:    6 YRRISGWLPSWLPAWCPTSIPHLEEAEEKMLKSITRIYSKEHIVISDGNR--------VWTLSF-----KQTLSNKTPLVLLHGFGGGVGLWVLNFENICRDRTVYALDILGFGRSSRPHFEGDAEKAEEQFVQSIEEWRNTLGLEKMILLGHNLGAFLASAYSLKYPSRVKSIILVEPWGFPDRPGNADEGRPIPIWIKAVGAMLSPFNPLAGLRLAGPLGLSLVQRLRPDFKKKYS------SMFDDD---------------------------------TVTEYIYHCNAQSPSGETAFRNMTVPYGWAQRPMLQRIDKMHPDIPITVIYGARSCIDGNSGSTIQSLRPNSYVKTIAIRGAGHYVFADQPEEFNQKVTEICDSV 341          
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Match: Abhd4 (abhydrolase domain containing 4 [Source:MGI Symbol;Acc:MGI:1915938])

HSP 1 Score: 218.779 bits (556), Expect = 5.504e-67
Identity = 116/317 (36.59%), Postives = 170/317 (53.63%), Query Frame = 2
Query:  326 NNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRP F  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +  +DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I+ A HHVYA+  + FN  V  IC +V
Sbjct:   43 DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAP--PTWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFEDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKKVKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSV 317          
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Match: Abhd4 (abhydrolase domain containing 4 [Source:MGI Symbol;Acc:MGI:1915938])

HSP 1 Score: 219.935 bits (559), Expect = 6.547e-67
Identity = 133/390 (34.10%), Postives = 199/390 (51.03%), Query Frame = 2
Query:  110 IYQQENTFWPYWLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            + QQ   +   WL  W P+S       E R+L  + + K +     L  ++ I T+ V      S E++    +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRP F  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +  +DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I+ A HHVYA+  + FN  V  IC +V
Sbjct:   18 LEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQN-KFLARYVSLPNQNKIWTVTV------SPEQK----DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAP--PTWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFEDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKKVKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSV 354          
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Match: Abhd5 (abhydrolase domain containing 5 [Source:MGI Symbol;Acc:MGI:1914719])

HSP 1 Score: 209.92 bits (533), Expect = 3.444e-63
Identity = 136/385 (35.32%), Postives = 200/385 (51.95%), Query Frame = 2
Query:  143 WLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRT-------LYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECK--SRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WL  WCP+S+     AE ++L           VP  +KK  +R          ++ +N +S+          P+VL+HG G GL +W  N + L+  R VY FDL+GFG SSRP F  +  +VEN F++SIE+WR  L L K I+LGH+LGG+LA +Y +K+   + H+IL +PWGF E    +  E P  + W  +L + L  + NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  L  +I V+ I+G +S +D  +G   Q LR  S V    I  AGH+VYA+   +FN  V  IC  V
Sbjct:   25 WLPTWCPTSTSHLKEAEEKMLK---------CVPCTYKKEPVRISNGNRIWTLMFSHNISSKT---------PLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPDLADQERPIPV-WIRALGAALTPF-NPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTV 350          
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Match: Abhd4 (abhydrolase domain containing 4 [Source:MGI Symbol;Acc:MGI:1915938])

HSP 1 Score: 131.724 bits (330), Expect = 1.472e-35
Identity = 65/150 (43.33%), Postives = 93/150 (62.00%), Query Frame = 2
Query:  326 NNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPF 766
            +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRP F  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+
Sbjct:   43 DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAP--PTWVKAVASVLGRS-NPLAVLRVAGPW 189          
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Match: Abhd5 (abhydrolase domain containing 5 [Source:MGI Symbol;Acc:MGI:1914719])

HSP 1 Score: 121.324 bits (303), Expect = 1.166e-31
Identity = 73/223 (32.74%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  605 GHTLLHIILADPWGFRECK--SRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            G  + H+IL +PWGF E    +  E P  + W  +L + L  + NPL  +R+ GPF   +++ +R D    ++      ++ +DD                                  + +Y+YHCN +TPSGE AFK ++ P GWA RPM++RI  L  +I V+ I+G +S +D  +G   Q LR  S V    I  AGH+VYA+   +FN  V  IC  V
Sbjct:   16 GGGVSHLILVEPWGFPERPDLADQERPIPV-WIRALGAALTPF-NPLAGLRIAGPFGLSLVQRLRPDFKRKYS------SMFEDD---------------------------------TVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGGLHPDIPVSVIFGARSCIDGNSGTSIQSLRPKSYVKTIAILGAGHYVYADQPEEFNQKVKEICHTV 197          
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Match: sp|Q8VD66|ABHD4_MOUSE ((Lyso)-N-acylphosphatidylethanolamine lipase OS=Mus musculus OX=10090 GN=Abhd4 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 3.954e-66
Identity = 133/390 (34.10%), Postives = 199/390 (51.03%), Query Frame = 2
Query:  110 IYQQENTFWPYWLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            + QQ   +   WL  W P+S       E R+L  + + K +     L  ++ I T+ V      S E++    +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRP F  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +  +DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I+ A HHVYA+  + FN  V  IC +V
Sbjct:    5 LEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQN-KFLARYVSLPNQNKIWTVTV------SPEQK----DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFPRDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSEIRAP--PTWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFEDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKKVKMQRPDSYVRDMEIEGASHHVYADQPHIFNAVVEEICNSV 341          
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Match: sp|Q8TB40|ABHD4_HUMAN ((Lyso)-N-acylphosphatidylethanolamine lipase OS=Homo sapiens OX=9606 GN=ABHD4 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 4.841e-66
Identity = 117/317 (36.91%), Postives = 171/317 (53.94%), Query Frame = 2
Query:  326 NNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRPAF  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S   +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +  +DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I  A HHVYA+  + FN  V  IC++V
Sbjct:   67 DRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSEIRAP--PAWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFEDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSV 341          
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Match: sp|H2KZ86|ABH52_CAEEL (Abhydrolase domain-containing protein abhd-5.2 OS=Caenorhabditis elegans OX=6239 GN=abhd-5.2 PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 6.097e-66
Identity = 133/377 (35.28%), Postives = 196/377 (51.99%), Query Frame = 2
Query:  128 TFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGY----QAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYV 1246
            +++PY+   CPS S     AE R+L+ +       L+ +  K   I T+ V     N E E+ I    YPIVL+HG GAG+A+W   +  LA+ + V+ FDL GFG SSRP FS +    E   I SIE WR  + L+K  ++GHS GGYLA SY +K+   + ++ILADPWGF E    F     +      + ++ +  NPL  +RL G + P ++R +R DL                                         LK++E     ++DY+Y  N+R P+GE  FK LS+ +GWA +PM KR ++LD+ + VTFI+G +SW+DW+T      + +H      V   ++D AGHHVYA+ ++ F   V
Sbjct:  100 SWFPYFS--CPSKSQRLAEAEGRILSALGIKYLARLIQIPFKNTEISTITV-----NCESEQPIVKAKYPIVLIHGFGAGVALWGSAIKRLAQFQTVHAFDLPGFGRSSRPKFSSDPETAETEMIDSIEQWRDKMNLEKMNLVGHSFGGYLATSYALKYPKRVENLILADPWGFNEMDPEFAQK--LTSRQKNIFWVIQQFNPLAVLRLVGGYGPSLVRRLRPDLA----------------------------------------LKYSED----VYDYIYLANSRDPTGEEVFKCLSENLGWAKQPMSKRFHELDNTVPVTFIHGERSWIDWRTTRRLFGELEH------VESHIMDSAGHHVYADDADKFVQLV 417          
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Match: sp|O02218|LID1_CAEEL (Abhydrolase domain-containing protein lid-1 OS=Caenorhabditis elegans OX=6239 GN=lid-1 PE=1 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.020e-65
Identity = 126/374 (33.69%), Postives = 183/374 (48.93%), Query Frame = 2
Query:  143 WLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEA 1264
            W+ +   S     + E RL        E   VPV  K+  + T+ V      +        N   IV + G+GAG+AM+  N ++ A+   V+ FD +GFG SSR  FSD+N   E   ++ +EDWR  +G++K  I+GH+ GGYLA +Y ++    + H+IL DPWGF E     E        +S L  +  Y NP  P+R  GP+AP I++ +R DL + F                       L + D                   I+ YVY+ N   P+GE AF  ++ P+GWA RPMIKR N +D  + V+FIYG KSW+D       Q  R N+ V++K++  AG HVYA+    FN  V+ + E 
Sbjct:   16 WMTFTDDSKEQLKIVEGRLFQSCEVSYEAKYVPVRFKRGEVYTVTVRPREAEN-------LNGEAIVFIPGLGAGVAMFTANFNSCAKNHAVHSFDPLGFGRSSRSRFSDDNAIAELEMVEVMEDWRKAMGIEKMYIIGHAFGGYLASAYALENPSRVAHLILVDPWGFAEKVETTEKLIKPYAWMSFLGGVAGYFNPFSPMRWMGPYAPAIVKKLRPDLLLRFP---------------------GLHDYD-------------------IYKYVYYLNLPNPTGETAFMNMTLPVGWAKRPMIKRFNGIDKNVGVSFIYGSKSWIDPGPAIDIQSTRENAYVDIKIVRGAGTHVYADDPAAFNEIVSDVVEG 342          
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Match: sp|Q5EA59|ABHD4_BOVIN ((Lyso)-N-acylphosphatidylethanolamine lipase OS=Bos taurus OX=9913 GN=ABHD4 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.911e-65
Identity = 134/390 (34.36%), Postives = 199/390 (51.03%), Query Frame = 2
Query:  110 IYQQENTFWPYWLK-WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF---RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            + QQ   +   WL  W P+S       E R+L  + + K +     L  ++ I T+ V      S E R    +  P+V+VHG G G+ +W  N+D+L+ RR ++ FDL+GFG SSRP F  +    E+ F+ SIE WR  +G+   I+LGHSLGG+LA SY IK+   + H+IL DPWGF       S+  +P    W  ++ S L +  NPL  +R+ GP+ P +++  R D    F       +   DD                                  I +Y+YHCN + PSGE AFK + +  GWA RPM++RI+ +  ++ +T IYG  +W+D  TG + +  R +S V    I+ A HHVYA+  + FN  V  IC++V
Sbjct:    5 LEQQPQGWLSSWLPTWRPTSMSQLKNVEARILQCLQN-KFLARYVSLPNQNKIWTVTV------SPELR----DRTPLVMVHGFGGGVGLWILNMDSLSTRRTLHTFDLLGFGRSSRPTFPRDPEGAEDEFVTSIETWRESMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPADPSQVRAP--PTWVKAVASVLGRS-NPLAVLRVAGPWGPGLVQRFRPDFKRKFA------DFFDDD---------------------------------TISEYIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGANTWIDTSTGKKVKLQRPDSYVRDLEIEGASHHVYADQPHIFNAVVEEICDSV 341          
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Match: A0A419Q013 (Abhydrolase domain-containing protein 4 OS=Clonorchis sinensis OX=79923 GN=ABHD4 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.242e-90
Identity = 162/423 (38.30%), Postives = 226/423 (53.43%), Query Frame = 2
Query:  113 YQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMN-----WTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDL------------GVTFTP---------------------AQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            Y+ +    P WL+W  +S  L + AE +LLNR+ S  +   VP+      IRTL     NF  +   Q      P+VL+HG  +GL +WCKN+D+LA  R VY FDL+GFG SSRPAFSD+  + E  FI S E+WR  + L+KFI++GHSLGGYL++SY I     + H+IL DPWGF+E    F+    M      W    +  + +  NPL  +R  GP     +  VRQDL            G    P                     ++I++    D    +  P    G++D+  D + F       D  A  DYVYH N + PSGE  F+ L   +GWA RPM+KR+ +LD  + +TFIYG +SWMD  +G   + LR +S V+VK+I+ AGH VYA+A+++FN YVN +   V
Sbjct:   10 YEVDRNPLPVWLRWIRTSPELLVGAEQKLLNRLRSTLQTSFVPIFGNTCFIRTLVA--QNF-PDGPLQGGRARVPMVLMHGFASGLGLWCKNIDSLAAHRPVYAFDLLGFGRSSRPAFSDDAAEAEAQFINSFEEWRSAMNLEKFILVGHSLGGYLSYSYAIAHPSRIAHLILVDPWGFKEAP--FDEEAVMQNKKRAWVFRSVRNMLQSSNPLSILRAIGPLGRKAINYVRQDLIRVFDQHPLASGGFIEVPTEAEEEAARRGFASSADFVADSEITVTGAADQPSATGMPDASFGDLDKSVDPRDF-------DGTAALDYVYHINVQRPSGEVGFRALCHHLGWAKRPMLKRVTELDRLVPITFIYGSRSWMDMSSGTSTRLLRPDSYVDVKIIEGAGHQVYAQAASEFNAYVNLVAHRV 420          
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Match: A0A074Z6L9 (AB hydrolase-1 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_10435 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 2.111e-90
Identity = 166/438 (37.90%), Postives = 231/438 (52.74%), Query Frame = 2
Query:   68 KFYEFLQMTFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMN-----WTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTF---------------------------------TPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +  E    T SP   Y+ +    P WL+W  +S  L I AE +LLNR+ S  +   VP+      IRTL     NF  +   Q      P+VL+HG  +GL +WCKN+D+LA  R VY FDL+GFG SSRPAFSD+  + E  FI S E+WR  + L+KFI++GHSLGGYL++SY I   + + H+IL DPWGF+E    F+    M      W    +  + +  NPL  +R  GP     +  VRQDL   F                                   ++I++    D    +  P    G++D+  D + F       D  A  DYVYH N + PSGE  F+ L   +GWA RPM+KR+ +LD  + +TFIYG +SWMD  +G   + LR +S V+VK+I+ AGH VYA+A+++FN YVN +   V
Sbjct:   11 RCLEMQPNTVSPE--YEVDRNPLPMWLRWIRTSPELLIGAEQKLLNRLRSTLQTSFVPIFGNTCFIRTLVA--QNF-PDGPPQGGRARVPMVLMHGFASGLGLWCKNIDSLAAHRPVYAFDLLGFGRSSRPAFSDDAAEAEAQFINSFEEWRSSMDLEKFILVGHSLGGYLSYSYAIAHPNRIAHLILVDPWGFKEAP--FDEDAVMQNKKRAWVFRSVRNMLQSSNPLSILRAIGPLGRKAINYVRQDLIRVFDQHPLVSGEFIEVPTEEEEEAARQGFASSADVAADSEITVTGAADQPAATRMPDSRFGDLDKSVDPRDF-------DGTAALDYVYHINVQRPSGEVGFRALCHHLGWAKRPMLKRVTELDRLVPITFIYGSRSWMDMSSGTTTRILRPDSYVDVKIIEGAGHQVYAQAASEFNAYVNLVAHRV 434          
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Match: A0A4S2M4E4 (AB hydrolase-1 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002787 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.724e-89
Identity = 167/430 (38.84%), Postives = 232/430 (53.95%), Query Frame = 2
Query:   92 TFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMN-----WTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTF------------TPAQI-----------SLNIIKDDKLI----SSQPT------GDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            T SP   Y+ +    P WL+W  +S  L I AE +LLNR+ S  +   VP+      IRTL     NF  +   Q      P+VL+HG  +GL +WCKN+D+LA  R VY FDL+GFG SSRPAFSD+  + E  FI S E+WR  + L+KFI++GHSLGGYL++SY I     + H+IL DPWGF+E    F+    M      W    +  + +  NPL  +R  GP     +  VRQDL   F             P +            S +++ D ++     + QP+         G +D+  D + F       D  A  DYVYH N + PSGE  F+ L   +GWA RPM+KR+ +LD  + +TFIYG +SWMD  +G   + LR +S V+VK+I+ AGH VYA+A+++FN YVN +   V
Sbjct:    5 TVSPE--YEVDRNPLPVWLRWIRTSPELLIGAEQKLLNRLRSTLQTSFVPIFGNTCFIRTLIA--QNF-PDGPLQGGRVRVPMVLMHGFASGLGLWCKNIDSLAAHRPVYAFDLLGFGRSSRPAFSDDAAEAEAQFINSFEEWRSAMNLEKFILVGHSLGGYLSYSYAIAHPSRIAHLILVDPWGFKEAP--FDEDAVMQNKKRAWVFRSVRNMLQSSNPLSILRAIGPLGRKAINYVRQDLIRVFDQHPLASGEFIEVPTEAEEEAARRGFVSSADVVADSEITVTGAADQPSATRVLDASFGELDKSVDPRDF-------DGTAALDYVYHINVQRPSGEVGFRALCHHLGWAKRPMLKRVIELDRLVPITFIYGSRSWMDMSSGTSTRLLRPDSYVDVKIIEGAGHQVYAQAASEFNAYVNLVAHRV 420          
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Match: A0A564YI81 (AB hydrolase-1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6172 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.230e-87
Identity = 148/397 (37.28%), Postives = 228/397 (57.43%), Query Frame = 2
Query:  104 GSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESP--FYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIK-------DDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            G ++      W  W KW P+S+   + AE ++L R     E   VP+      +RT+ V RN   +  E +      PI+L+HG  +G+ +WCKNLD+L++ R+VY FDL+GFG SSRP F +   +VEN F++ IE+WR  + L KFI+LGHS+GG+LA SY +    +++H++L DPWGF      F  P      W L  L+  F+ L  +   R+ GPF  + +R +RQD+   ++   +S            DD + +   +G+   +         + K +  D   +++Y+YH N R P+GE AF+ LS  +GWAARPM+ RI+   +++ +TFIYGG+SW+D  +G + + LR NS V+V VI+  GH+ YA+ + DFN+YVN+I   V
Sbjct:   10 GDLHDTSKDSWWQWFKWIPTSNDKLVQAENKILERCKCKLEKFFVPIFDSTFYLRTI-VARNYLTNAHENECE-KRVPILLIHGFASGVGLWCKNLDSLSKTRRVYAFDLLGFGRSSRPPFPETAEEVENKFVEVIEEWRKRMDLDKFILLGHSMGGFLAASYALSHPQSIVHLVLIDPWGFVGKDESFHKPPDGVRGWLLKKLTS-FRALTTM---RMIGPFGLHAMRSMRQDIEQIYSEPALSSEETSGLDRESLDDSMENPWSSGE-AQLKIGKSKCDDIEKLSPYDPSVVYNYIYHINCRHPTGEDAFRNLSQMLGWAARPMLPRISQAATDLPITFIYGGRSWIDMSSGLRIRTLRPNSYVDVMVIEGGGHYAYAQYAEDFNSYVNAIAGLV 399          
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Match: A0A0R3U1I0 (AB hydrolase-1 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS221 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 2.048e-87
Identity = 154/425 (36.24%), Postives = 239/425 (56.24%), Query Frame = 2
Query:   83 LQMTFSPGS--IYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPF--YMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIK------DDKLISSQPTGDLGNIDEK----DDHQGFVLKHTES----------DLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNL 1285
            + +T SP    +Y +    W +W+KW P+S+   + AE ++L R     E   +P+ +    +RT+ + RN ++ +     + +  P+VL+HG  +G+ +WCKNLD+L+  R VY FD++GFG SSRP F +   +VEN F++ IE+WR  + L KFI+LGHS+GG+LA SY +     ++H++L DPWGF   +     P   +  W L  LS        L  +R+ GPF    +R VRQD    F      L+ ++      + +   S+PT     +  K    +  Q  + K T++          D   +++Y+YH N R PSGE AF+ +S  +GWAARPM+ RI  LDS++ +TFIYGG+SW+D  +G + + LR NS V+V VI+  GHH YA+ +++FN YVN+I   V    + 
Sbjct:    1 MTLTVSPSDSDLYDKSEDSWWHWIKWIPTSNEKLVQAEDKILQRCKCKLEKFFLPIFNSTLFLRTI-IARNWYSDDCTE--FESRVPLVLIHGFASGVGLWCKNLDSLSASRTVYAFDMLGFGRSSRPPFPNTAEEVENKFVEVIEEWRKTMNLDKFILLGHSMGGFLASSYALSHPERVVHLVLIDPWGFIGQQESTTIPVSGFRAWLLRKLS----SFRALATMRMVGPFGLNAMRKVRQDFEQVFYQQPWPLDEVEMLPQLGEIQSDISEPTERRSELPLKASSVETTQTSIHKQTKNNTDFDSISPFDPAVVYNYIYHINVRHPSGEDAFRSMSQVLGWAARPMLHRIPLLDSDVPITFIYGGRSWVDMSSGLRVRSLRPNSYVDVMVIEGGGHHAYAQYADEFNAYVNAIARLVDRGHDF 418          
BLAST of Abhydrolase domain containing protein vs. Ensembl Cavefish
Match: abhd4 (abhydrolase domain containing 4 [Source:NCBI gene;Acc:111194531])

HSP 1 Score: 248.44 bits (633), Expect = 4.504e-78
Identity = 142/389 (36.50%), Postives = 194/389 (49.87%), Query Frame = 2
Query:  134 WPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKS-----------RFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            W +W  W P+S  L   AE ++L  + +      V  L  ++ I TL V         E+    +  P+V+VHG G G+ +W +NLDAL+ RR VY FDL+GFG SSRP+F  +    E  FI SIE WR  LGL++ I+LGHSLGGYLA SY I++   + H+IL DPWGF E                + P    W  +LL  +    NPL  +R  GP+ P ++   R D    F                           D  DD+              + +Y+YHCN +TPSGE  FK L+  + WA RPM++R+N L   + VT +YG  SWMD  +G     +R   +  V +IDDA HHVYA+   +FN  V +IC  V
Sbjct:   14 WSWWPSWRPTSMSLLKTAEAKILACIQNEVWSRFV-TLPNQNRIWTLTVSNKTAQKTSEQA---SQTPLVMVHGFGGGVGLWIRNLDALSRRRPVYAFDLLGFGRSSRPSFPADASLAEEQFISSIEQWRQSLGLERMILLGHSLGGYLATSYSIQYPERVSHLILVDPWGFPERPQPQPEGSSSQDLEVKRPGPPRWVKALLP-VVSLFNPLAIIRAAGPWGPGLVNRFRPDFKRKFE--------------------------DLFDDN-------------TMTEYLYHCNAQTPSGEVGFKALTGYMAWAKRPMLQRVNLLPPSLPVTLLYGASSWMDSSSGKLMAQIRGQDSTRVVLIDDASHHVYADQPEEFNRVVENICNTV 358          
BLAST of Abhydrolase domain containing protein vs. Ensembl Cavefish
Match: ABHD5 (abhydrolase domain containing 5 [Source:NCBI gene;Acc:103032876])

HSP 1 Score: 234.572 bits (597), Expect = 9.056e-73
Identity = 133/383 (34.73%), Postives = 194/383 (50.65%), Query Frame = 2
Query:  134 WPYWL-----KWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            W +W+      WCP+S       E R+L  + S      V      H      ++   FNS  + +      P+VL+HG G G+ +W  NL+AL ++R VY FDL+GFG SSRP FS +    E  F++S+E+WR  LGL+  I+LGH+LGGYLA +Y + +   + H+IL +PWGF E          +   +  L  L    NPL  +RL GP  P++++ +R D    F        I  D+                                  + +Y+YH N +TPSGE AFK ++ P GWA RPM++RI  + S+I +T IYG +S +D  +G   + +R NS V +  I  AGH+VYA+   DFN+ V  +CE V
Sbjct:   13 WTWWITSWLPSWCPTSHSKLKEVEERMLQSIKSKFSKQFV------HISNDNKLWTLAFNSGVDCKT-----PLVLLHGFGGGVGLWTMNLEALFQQRPVYAFDLLGFGQSSRPQFSTDAQVAETQFVESVEEWREKLGLETMILLGHNLGGYLAAAYSLNYPSRVKHLILVEPWGFPERPEPGNQDRPIPVWIKALGDLLSPFNPLAGLRLAGPLGPFLVQTLRPDFKKKFA------TIFNDN---------------------------------TVTEYIYHLNVQTPSGETAFKNMTIPYGWAKRPMLQRIGLIHSDIPITVIYGSRSSIDGHSGNSIKEMRPNSHVEIIAIRGAGHYVYADQPEDFNHRVLHVCETV 345          
BLAST of Abhydrolase domain containing protein vs. Ensembl Cavefish
Match: ABHD5 (abhydrolase domain containing 5 [Source:NCBI gene;Acc:103032876])

HSP 1 Score: 206.068 bits (523), Expect = 7.527e-62
Identity = 120/356 (33.71%), Postives = 177/356 (49.72%), Query Frame = 2
Query:  134 WPYWL-----KWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKV 1186
            W +W+      WCP+S       E R+L  + S      V      H      ++   FNS  + +      P+VL+HG G G+ +W  NL+AL ++R VY FDL+GFG SSRP FS +    E  F++S+E+WR  LGL+  I+LGH+LGGYLA +Y + +   + H+IL +PWGF E          +   +  L  L    NPL  +RL GP  P++++ +R D    F        I  D+                                  + +Y+YH N +TPSGE AFK ++ P GWA RPM++RI  + S+I +T IYG +S +D  +G   + +R NS V + V
Sbjct:   13 WTWWITSWLPSWCPTSHSKLKEVEERMLQSIKSKFSKQFV------HISNDNKLWTLAFNSGVDCKT-----PLVLLHGFGGGVGLWTMNLEALFQQRPVYAFDLLGFGQSSRPQFSTDAQVAETQFVESVEEWREKLGLETMILLGHNLGGYLAAAYSLNYPSRVKHLILVEPWGFPERPEPGNQDRPIPVWIKALGDLLSPFNPLAGLRLAGPLGPFLVQTLRPDFKKKFA------TIFNDN---------------------------------TVTEYIYHLNVQTPSGETAFKNMTIPYGWAKRPMLQRIGLIHSDIPITVIYGSRSSIDGHSGNSIKEMRPNSHVEIIV 318          
BLAST of Abhydrolase domain containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000038558.1 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5-like [Source:NCBI gene;Acc:103045728])

HSP 1 Score: 199.904 bits (507), Expect = 3.818e-59
Identity = 139/391 (35.55%), Postives = 210/391 (53.71%), Query Frame = 2
Query:  107 SIYQQENTFWPYWL-KWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNS----EEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAER-RQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF-RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSIC 1258
            ++Y Q + +   WL  WCPSS +L   AE ++L  +        VP+    + I TL +     ++    EE+ Q+ F     VL+HG G GL +W KNL ALA+  R VY  DL+GFG SSRP       +VE  F+QS+E+WR  +G++  ++LGH+LGGY++ +Y +K+ H + H++L +PWGF  + + R  +     W ++L + +  + NPL  +RL GP  P +L+ +R D        Q   ++ KDD                                  + DY+YH N +TPSGE AFK ++ P GWA RPM+ RI  +D  I ++ I G +S +D Q+G   Q +R +S  +V VI  AGH+V+A+ S DFN  V +IC
Sbjct:    9 TVYNQRSWWILSWLPSWCPSSPFLLKTAEDKILQPIKLQFNRGHVPISDGNY-IWTLSINEAQLSAQASAEEDPQVSF-----VLLHGFGGGLGLWVKNLSALAQTGRPVYALDLLGFGRSSRPMAGSQAEEVEEQFVQSLEEWREAVGVELMVLLGHNLGGYVSTAYALKYPHRVKHLVLVEPWGFPAKPEIRQMNCKVPMWIIALGTSMNPF-NPLALLRLVGPLGPLLLQALRSDF------KQKYYSVFKDD---------------------------------TVPDYIYHLNVQTPSGEIAFKNMTIPYGWAQRPMMHRIEMIDPAIRISVICGSRSCIDGQSGRTIQEMRPHSQTDVIVISGAGHYVFADQSEDFNQAVLNIC 353          
BLAST of Abhydrolase domain containing protein vs. Ensembl Sea Lamprey
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 172.555 bits (436), Expect = 6.529e-50
Identity = 121/380 (31.84%), Postives = 180/380 (47.37%), Query Frame = 2
Query:  143 WL-KWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFN-NYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF--RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFA-PYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WL  W P+S+ L  +AE ++L  + S      V VL +   + ++ V     N E ER    + + P+VLVHG G G+ +W  NLD++A RR+V+ FDL+  G    P         + + +++  +  +   +K  + LG  +  YL      +    +  +IL DPWGF  R      E P  M W +  + F+    NPL  +R  GP+A P +++  R D    F+      N+  DD                                  I +Y+YHCN +TPSGE AFK ++ P GWA RPM+ RI DLD  I +  IYG +SW+D  +G +    R  S   +  I  AGHHVYA+   DFN  V  IC+++
Sbjct:   12 WLPSWSPTSNGLLKVAEEKVLQCLKSKWVGRYVDVLDEDR-LWSITVT----NPELERSGTADTSTPLVLVHGFGGGVGLWALNLDSMARRRRVHAFDLLETGRRGDPV-ERRGQPFDQSHVRASSECGV---IKPSVSLGVFVCCYLCVCVHFR----VKQLILVDPWGFPERPLNPDQERPVPM-W-VKAIGFVLSPFNPLAGLRAAGPWAGPGMVQRFRPDFKRKFS------NLFDDD---------------------------------TICEYIYHCNAQTPSGETAFKAMTIPYGWAKRPMLHRIGDLDPAIPIAIIYGARSWIDSSSGGKVVEARPGSRTRLVQIRGAGHHVYADQPEDFNKMVEQICDSI 337          
BLAST of Abhydrolase domain containing protein vs. Ensembl Sea Lamprey
Match: ABHD5 (abhydrolase domain containing 5 [Source:HGNC Symbol;Acc:HGNC:21396])

HSP 1 Score: 168.318 bits (425), Expect = 3.112e-48
Identity = 121/380 (31.84%), Postives = 177/380 (46.58%), Query Frame = 2
Query:  143 WL-KWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFN-NYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF--RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFA-PYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            WL  W P+S+ L  +AE ++L  + S      V VL +   + ++ V     N E ER    + + P+VLVHG G G+ +W  NLD++A RR+V+ FDL+   ++  P  S         +   +        +K  + LG  +  YL      +    +  +IL DPWGF  R      E P  M W +  + F+    NPL  +R  GP+A P +++  R D    F+      N+  DD                                  I +Y+YHCN +TPSGE AFK ++ P GWA RPM+ RI DLD  I +  IYG +SW+D  +G +    R  S   +  I  AGHHVYA+   DFN  V  IC+++
Sbjct:   15 WLPSWSPTSNGLLKVAEEKVLQCLKSKWVGRYVDVLDEDR-LWSITVT----NPELERSGTADTSTPLVLVHGFGGGVGLWALNLDSMARRRRVHAFDLLVCRSNHLPPPSHPPRLRRPQYRSHVRASSECGVIKPSVSLGVFVCCYLCVCVHFR----VKQLILVDPWGFPERPLNPDQERPVPM-W-VKAIGFVLSPFNPLAGLRAAGPWAGPGMVQRFRPDFKRKFS------NLFDDD---------------------------------TICEYIYHCNAQTPSGETAFKAMTIPYGWAKRPMLHRIGDLDPAIPIAIIYGARSWIDSSSGGKVVEARPGSRTRLVQIRGAGHHVYADQPEDFNKMVEQICDSI 344          
BLAST of Abhydrolase domain containing protein vs. Ensembl Yeast
Match: ICT1 (Lysophosphatidic acid acyltransferase; responsible for enhanced phospholipid synthesis during organic solvent stress; null displays increased sensitivity to Calcofluor white; highly expressed during organic solvent stress; ICT1 has a paralog, ECM18, that arose from the whole genome duplication; human ABHD5 can complement ict1 null mutant [Source:SGD;Acc:S000004089])

HSP 1 Score: 72.4034 bits (176), Expect = 2.530e-14
Identity = 89/422 (21.09%), Postives = 146/422 (34.60%), Query Frame = 2
Query:  131 FWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEE----RQIYFNN-------YPIVLVHGMGAGLAMWCKNLDALAER-RQVYVFDLIGFGNSSRPAFSDNNIK----------------------------------VENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYL-NPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHC-----NTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVID--DAGHHVYAEASNDF 1234
             W    KWC  +      A+ ++   V  +K +        +  I      R + N+        Q +F+N        P VL+HG  A    + +  + L++  + +Y  DL   G S  PA   N  K                                   E+ F+  IE WR    L+K  ++GHS GGY++F Y +K+  ++  + L  P G                  S+ +   K+  N  +P+    P + Y  R     L V     +  LN++K            +G I  K         + +       DY+ H       T  P     F  L +    A  P+I  +  L+    V F+YG   WMD   GY      + +      ++  DAGH+++ +    F
Sbjct:    1 MWTNTFKWCSKTEKETTTADAKVCASVQGLKAL--------QQQIMDSTTVRGSVNNTMTPGGINQWHFHNKRANKVCTPTVLIHGYAASSMAFYRTFENLSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKHIEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKYPDSIEKLCLISPLGVEN---------------SIHAITHKWEPNTTYPLTFTDPSSRYYTR----KLNVPRFIFENQLNVLK-----------WMGPIGSKLCSNYISTAYVKVPDQIYKDYLLHSFVGKNQTVQPQTIKVFTHLFERNLIARDPIINNVRFLNPATPVMFMYGEHDWMDKYAGYLTTESMLKNKAKASYVEVPDAGHNLFLDNPQHF 384          
BLAST of Abhydrolase domain containing protein vs. Ensembl Yeast
Match: ECM18 (Protein of unknown function; ECM18 has a paralog, ICT1, that arose from the whole genome duplication [Source:SGD;Acc:S000002532])

HSP 1 Score: 58.151 bits (139), Expect = 1.145e-9
Identity = 38/136 (27.94%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAER-RQVYVFDLIGFGNSSRPAFS---------------DNNIKV----------------ENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWG 646
            P +L+HG  A    + +N   L++  R +Y  D+   G SS P+                 +N  KV                E+ ++  IE WRI   L K  ++GHS GGYL+F Y +K+ +++  + L  P G
Sbjct:  128 PTLLIHGYAASSMSFFRNYPGLSKHIRNLYSIDMPASGLSSVPSLEINTTTPLPLDIKFIGENKFKVPYTINANHNKFVIQMYEDFYLDRIEQWRIDNKLGKMNVVGHSFGGYLSFKYAVKYPNSVNKLCLVSPLG 263          
BLAST of Abhydrolase domain containing protein vs. Ensembl Yeast
Match: CLD1 (Mitochondrial cardiolipin-specific phospholipase; functions upstream of Taz1p to generate monolyso-cardiolipin; transcription increases upon genotoxic stress; involved in restricting Ty1 transposition; has homology to mammalian CGI-58 [Source:SGD;Acc:S000003342])

HSP 1 Score: 53.9138 bits (128), Expect = 2.419e-8
Identity = 40/117 (34.19%), Postives = 56/117 (47.86%), Query Frame = 2
Query:  338 IVLVHGMGAGLAMWCKNLD---ALAERRQVYVFDLIGFGNSSRPAFS-----DNNIKVENTFIQSIEDWRIYLGL----KKFIILGHSLGGYLAFSYGIKFGH--TLLHIILADPWG 646
            +V +HG GAGL  + KN +    L     ++  DL G+G SSRP F      DN   V++ F + I  W     L    +K I++ HSLG YL   Y  K+    +   +IL  P G
Sbjct:  143 LVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWFHERIHTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQKYKESPSFKKLILCSPAG 259          
BLAST of Abhydrolase domain containing protein vs. Ensembl Nematostella
Match: EDO34526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP35])

HSP 1 Score: 250.751 bits (639), Expect = 1.487e-79
Identity = 137/389 (35.22%), Postives = 210/389 (53.98%), Query Frame = 2
Query:  143 WLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLLTRKILSN 1309
            WL WCP+S  L  +AE R+L  + +  E   V V  K H I TL+     FN   ++       P+V+VHG G G+ +W  N+D+L++ R VY FDL+GFG SSRP FS      E  F++SIE+WR  LG++KFI++GHSLGG+L  SY ++    + H++L DPWGF E     E    +   + +L  +    NPL  +R+ GP+ P +++  R D    ++       +  DD                                  I +Y+YHCN + PSGE AFK +S P GWA  PM+ RI +L  ++ ++FI G +SW++ ++ Y+ + +R +S V+++VI  AGHHVYA+    FN  ++ I   V NS ++   ++ S+
Sbjct:    1 WLSWCPTSDRLLEIAEARILKHLKAHYERKYVHV-DKGHKIWTLH-----FNPNADKT------PVVMVHGFGGGVGLWALNVDSLSKDRSVYAFDLLGFGRSSRPDFSTEADIAEQEFVESIENWRKELGIEKFILMGHSLGGFLTSSYALQHPEHVKHLVLVDPWGFPEKPPADELTGRIPGWVKVLGAVLSPFNPLAGLRVAGPWGPSLVQRFRPDFQKKYS------ALFDDD---------------------------------TILNYIYHCNAQRPSGETAFKYMSIPYGWAKYPMVNRIGELHRQVPISFIVGARSWVNNESSYEIKRIREDSFVDIQVIRGAGHHVYADRPELFNATMHKIYTMVDNSNDIEPVQVESS 338          
BLAST of Abhydrolase domain containing protein vs. Ensembl Nematostella
Match: EDO40607 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6S7])

HSP 1 Score: 228.794 bits (582), Expect = 1.037e-70
Identity = 137/384 (35.68%), Postives = 203/384 (52.86%), Query Frame = 2
Query:  152 WCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFR-----ECKSRFESPFYMN----WTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSI-CEAVQN 1273
            W P+S      AE+++L R+    E   V V  K   I TL V     + E          P+VLVHG  +G+  W ++ D L+E+R VY FDL GFG SSRP FS    + E+ F+Q IE+WR  +GL+KFI+LGHSLGGYL  +Y +K+   + H+IL+DPWGF            +SPF  N    W L L ++    LN L PVRL GP  PY + L R      F P +      KD  L                              GA+F+Y+YHCN +TP+GE AF+ ++  +GWA  PMIKR  ++D ++ ++ +YG  +++D +T Y+ + +R   +V+V ++ DAGH ++ + +  FN  +  I C+  ++
Sbjct:   19 WLPTSQERLQDAESKILQRIQKPWEGNFVKV-GKNVEIWTLKVNTQEASGET---------PLVLVHGFISGVCWWVQSFDVLSEKRTVYAFDLPGFGRSSRPEFSSTPEEAEDEFVQYIEEWRKAVGLEKFILLGHSLGGYLVTAYALKYPDRVHHLILSDPWGFSILPYGAVDRHPDSPFSYNQLPKW-LHLGNYFTNTLNFLTPVRLLGPLGPYAVSLAR------FDPNK------KDSALWKE---------------------------GAVFEYIYHCNAQTPTGENAFRNMNFLLGWAKHPMIKRAREIDPKMRISIMYGSWTFLDHRTAYELKCIRPELSVDVYIVKDAGHDIHVDNAGKFNEIMADILCKCARD 352          
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Match: abhd4 (abhydrolase domain containing 4 [Source:NCBI gene;Acc:105356204])

HSP 1 Score: 241.891 bits (616), Expect = 1.921e-75
Identity = 135/389 (34.70%), Postives = 194/389 (49.87%), Query Frame = 2
Query:  140 YWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF-------------RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +W  W P+S  L   AE+++L R+ +      V  L  +  I TL +     +   E        P+V+VHG G G+ +W +NLD L+  R V+ FDL+GFG SSRP F  +  K E  F+ SIE WR  +GL+  I+LGHSLGGYLA SY I++   + H+IL DPWGF              E    F  P ++     ++SF     NPL  +R  GP+ P ++   R D    F       ++  DD +                                   Y+YHCN +TPSGE  F+ +S+ +GWA RPM++R++ L   + VT +YG  SW+D  +G +A  +R  +   V +IDDA HHVYA+    FN  V +IC +V
Sbjct:   24 WWPSWRPTSMSLLKAAESKILARIQNNLWARFV-KLPNQDRIWTLTLTNKTVHKPAEEP---PKTPLVMVHGFGGGVGLWVRNLDGLSRSRPVHAFDLLGFGRSSRPHFPSDAAKAEEQFVDSIERWRQSVGLESMILLGHSLGGYLATSYAIQYPSRVSHLILVDPWGFPERPKAENQESQGTEAVKTFRPPRWVKVIAGIVSF----FNPLAVIRAAGPWGPGLVNRFRPDFRRKFE------DLFDDDTMT---------------------------------QYIYHCNAQTPSGEVGFRAMSESLGWAKRPMLQRVHLLPPSMPVTMLYGAVSWVDSSSGDKAAEIRGKAHTRVMLIDDASHHVYADQPETFNKVVENICNSV 365          
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Match: abhd4 (abhydrolase domain containing 4 [Source:NCBI gene;Acc:105356204])

HSP 1 Score: 240.736 bits (613), Expect = 3.452e-75
Identity = 135/389 (34.70%), Postives = 194/389 (49.87%), Query Frame = 2
Query:  140 YWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF-------------RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            +W  W P+S  L   AE+++L R+ +      V  L  +  I TL +     +   E        P+V+VHG G G+ +W +NLD L+  R V+ FDL+GFG SSRP F  +  K E  F+ SIE WR  +GL+  I+LGHSLGGYLA SY I++   + H+IL DPWGF              E    F  P ++     ++SF     NPL  +R  GP+ P ++   R D    F       ++  DD +                                   Y+YHCN +TPSGE  F+ +S+ +GWA RPM++R++ L   + VT +YG  SW+D  +G +A  +R  +   V +IDDA HHVYA+    FN  V +IC +V
Sbjct:    9 WWPSWRPTSMSLLKAAESKILARIQNNLWARFV-KLPNQDRIWTLTLTNKTVHKPAEEP---PKTPLVMVHGFGGGVGLWVRNLDGLSRSRPVHAFDLLGFGRSSRPHFPSDAAKAEEQFVDSIERWRQSVGLESMILLGHSLGGYLATSYAIQYPSRVSHLILVDPWGFPERPKAENQESQGTEAVKTFRPPRWVKVIAGIVSF----FNPLAVIRAAGPWGPGLVNRFRPDFRRKFE------DLFDDDTMT---------------------------------QYIYHCNAQTPSGEVGFRAMSESLGWAKRPMLQRVHLLPPSMPVTMLYGAVSWVDSSSGDKAAEIRGKAHTRVMLIDDASHHVYADQPETFNKVVENICNSV 350          
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Match: abhd4 (abhydrolase domain containing 4 [Source:NCBI gene;Acc:105356204])

HSP 1 Score: 231.876 bits (590), Expect = 6.153e-72
Identity = 120/324 (37.04%), Postives = 169/324 (52.16%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGF-------------RECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            P+V+VHG G G+ +W +NLD L+  R V+ FDL+GFG SSRP F  +  K E  F+ SIE WR  +GL+  I+LGHSLGGYLA SY I++   + H+IL DPWGF              E    F  P ++     ++SF     NPL  +R  GP+ P ++   R D    F       ++  DD +                                   Y+YHCN +TPSGE  F+ +S+ +GWA RPM++R++ L   + VT +YG  SW+D  +G +A  +R  +   V +IDDA HHVYA+    FN  V +IC +V
Sbjct:   53 PLVMVHGFGGGVGLWVRNLDGLSRSRPVHAFDLLGFGRSSRPHFPSDAAKAEEQFVDSIERWRQSVGLESMILLGHSLGGYLATSYAIQYPSRVSHLILVDPWGFPERPKAENQESQGTEAVKTFRPPRWVKVIAGIVSF----FNPLAVIRAAGPWGPGLVNRFRPDFRRKFE------DLFDDDTMT---------------------------------QYIYHCNAQTPSGEVGFRAMSESLGWAKRPMLQRVHLLPPSMPVTMLYGAVSWVDSSSGDKAAEIRGKAHTRVMLIDDASHHVYADQPETFNKVVENICNSV 333          
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Match: ENSORLT00000004565.2 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Source:NCBI gene;Acc:101170702])

HSP 1 Score: 228.794 bits (582), Expect = 2.863e-70
Identity = 137/385 (35.58%), Postives = 200/385 (51.95%), Query Frame = 2
Query:  131 FW-PYWL-KWCPSSSYLAILAETRLLNRVNS--VKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKS--RFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            FW P WL  WCP+S  L   AE ++L  VN+   K+ I    +     + TL +  +            +  P+VL+HG G G+ +W +NLDAL+  R V+  DL+GFG SSRP FS      E+ F+ SIE WR  +GL+  I+LGH+LGGYLA SY IK    + HIIL +PWGF E +   + + P  + W +  L  +F+  NPL  +RL GP  P +++ +R D    F+      ++ KD+                                  + +Y+YH N + PSGE AFK ++D  GWA RPM++R+  L   I +T IYG +S +D  +    +  R +S V++  I  AGH+V+A+   DFN  V  +CE V
Sbjct:   38 FWIPAWLPSWCPTSHKLLQAAEEKMLRCVNTSLTKQFI---CMSNGDQLWTLSLVSDAVK---------DKTPMVLLHGFGGGVGLWAQNLDALSACRPVFALDLLGFGQSSRPEFSTQPEAAEDQFVDSIEQWRDKMGLESMILLGHNLGGYLAVSYSIKHPDRVKHIILLEPWGFSESQGSPKIDRPIPV-W-IKALGAVFRPFNPLAGLRLVGPLGPVLVQTLRPDFKRKFS------SMFKDN---------------------------------TVSEYIYHLNVQFPSGETAFKNMTDTGGWAQRPMLQRMEQLQPHIPMTIIYGSRSSIDSISADSLRERRPHSNVDMITIRGAGHYVFADHPEDFNKTVVQVCEKV 369          
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Match: ENSORLT00000031658.1 (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Source:NCBI gene;Acc:101165076])

HSP 1 Score: 217.238 bits (552), Expect = 4.303e-66
Identity = 113/319 (35.42%), Postives = 179/319 (56.11%), Query Frame = 2
Query:  335 PIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMN---WTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQN 1282
            P+VL+HG G GLA+W +NLDA + R  VY  DL+GFG SSRP FS +  + E  F+ ++E+WR  +GL++ ++LGH+LGGYLA +Y +K    + H++L +PWGF    +R ++P + +   W  ++ + +  + NPL  +RL GP  P +++ +R D    ++        + DD  +S                                DY+YH N +TPSGE AFK ++ P GWA RPM++RI+ + + I ++FIYG +S +D ++G   +  R +  V + VI  AGH+V+A+   DFN  V  I    +  Q+
Sbjct:   81 PLVLLHGFGGGLALWAQNLDAFSSRGPVYALDLLGFGRSSRPQFSTDPGEAEEQFVTALEEWREKVGLEEMMLLGHNLGGYLAAAYTLKHPSRVKHLLLVEPWGF---PARPDNPNHYSIPVWIRAMGAIMSPF-NPLAGLRLAGPLGPMLVQTIRSDFKQKYS-------SVLDDNTVS--------------------------------DYIYHLNAQTPSGETAFKNMTIPYGWAKRPMLERIHQVQAHIPISFIYGSRSSIDSKSGCALKETRPD--VGITVIRGAGHYVFADQPEDFNQTVLQILARAEEKQS 354          
BLAST of Abhydrolase domain containing protein vs. Planmine SMEST
Match: SMESG000080893.1 (SMESG000080893.1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 2
Query:   89 MTFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLLTRKILSN 1309
            MTFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLLTRKILSN
Sbjct:    1 MTFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLLTRKILSN 407          
BLAST of Abhydrolase domain containing protein vs. Planmine SMEST
Match: SMESG000011680.1 (SMESG000011680.1)

HSP 1 Score: 297.745 bits (761), Expect = 5.732e-97
Identity = 150/381 (39.37%), Postives = 221/381 (58.01%), Query Frame = 2
Query:  125 NTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAV 1267
            ++FWP WL W  +S     +AE++L N V +   +  V + +  + +RTL+ ++     E   +   N  PIV+VHG+ +G+ +WCKN+D+++  R++Y  D++GFG SSRP FS++ ++VEN FI SIE+WR  +GLK+FI+LGHSLGG++A SY IK+   + H+IL DPWGF +      S          +  +  Y NPL  VR  GPF P +++  R+D+G  F                            E D++      H   D   +FDY+YHCN + PSGE AFK L+  + WA  PMI R  +LD  I V+FIYGG++WMD    YQ ++ R +S V+V++I   GHHVYAE +++FN  VN IC+ V
Sbjct:   14 DSFWPTWLSWKQTSFLSLSIAESKLFNYVKNQYNLSFVSICNNAYYLRTLFAHK----VETVNKPNVNKVPIVMVHGLCSGIGLWCKNIDSISNNRKLYAMDVLGFGFSSRPKFSNDPVQVENLFIDSIEEWRKSMGLKQFILLGHSLGGFIACSYAIKYPENVSHLILVDPWGFNQFDESKLSGIRKRLFTRFIFSISSYFNPLGIVRGAGPFGPSLVKF-RKDIGSYF----------------------------EGDENMKASDSHVSVDSNDVFDYIYHCNAQNPSGEPAFKTLTSNVIWAYNPMINRALELDKSIPVSFIYGGETWMDKNAAYQFKNKRPDSFVDVRIIKGCGHHVYAECADEFNQMVNEICDNV 361          
BLAST of Abhydrolase domain containing protein vs. Planmine SMEST
Match: SMESG000011690.1 (SMESG000011690.1)

HSP 1 Score: 291.197 bits (744), Expect = 2.504e-94
Identity = 147/395 (37.22%), Postives = 222/395 (56.20%), Query Frame = 2
Query:  104 GSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILVPVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKNLDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGLKKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYMNWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLNIIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTRTPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTGYQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLL 1288
            G I + +N FW   + WC +S    I  E +L N + +  ++  +P+ ++   +R+L  Y+  F S++ R +Y N  PIVL+HG+G G+ +W KNLD+++E R+VY  DL+GFG SSRP F ++ + VEN F++S+E WR  + L KFI+LGHSLGGYLA +Y IKF   + H+ILADPWG  +      +    +  L     + K  NP+  VR+ GPF   +++    D G  F                         N ++ +D  G  +     D   + DY+YHCN + PSGE AFK L    G A R M+ R N++D  I ++FIYGGKSWM+   G +    R +S V+++V+ D GHH+Y + + +FN  VN ICE + +  ++L
Sbjct:    6 GGIIESKNNFWFSKINWCSTSYQSLISCEMKLFNYLKNKSDLSFIPIENQAQFMRSLECYKA-FKSDDGRNLYDNKIPIVLIHGLGGGVGLWIKNLDSISEFRKVYAMDLLGFGFSSRPKFPEDPVGVENMFVESLEQWRKVMKLNKFILLGHSLGGYLACAYAIKFPEYIRHLILADPWGIIQSDPTEMTILKKSTILRTAYPILKSFNPMALVRMSGPFGKNLIKRFMSDFGNFFE------------------------NENDAEDGSGKCVSVKSDD---VLDYIYHCNAQYPSGETAFKTLLIDFGTAYRSMVDRTNEMDKSIPISFIYGGKSWMNVSGGLRIFEKRSDSYVDIRVLPDIGHHIYVQNAQEFNTTVNEICETIDSYSDIL 372          
The following BLAST results are available for this feature:
BLAST of Abhydrolase domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABHD41.008e-6636.91abhydrolase domain containing 4 [Source:HGNC Symbo... [more]
ABHD55.993e-6335.11abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
ABHD55.993e-6335.11abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
ABHD52.498e-6136.36abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
ABHD52.498e-6136.36abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd-5.22.393e-6735.60Abhydrolase domain-containing protein abhd-5.2 [S... [more]
abhd-5.24.793e-6735.28Abhydrolase domain-containing protein abhd-5.2 [S... [more]
lid-18.015e-6733.69Abhydrolase domain-containing protein lid-1 [Sour... [more]
lid-18.015e-6733.69Abhydrolase domain-containing protein lid-1 [Sour... [more]
lid-11.355e-6533.51Abhydrolase domain-containing protein lid-1 [Sour... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG18823.039e-7236.25gene:FBgn0033226 transcript:FBtr0339119[more]
CG18823.039e-7236.25gene:FBgn0033226 transcript:FBtr0088836[more]
CG18823.039e-7236.25gene:FBgn0033226 transcript:FBtr0088837[more]
CG18823.039e-7236.25gene:FBgn0033226 transcript:FBtr0088835[more]
CG18823.120e-7232.63gene:FBgn0033226 transcript:FBtr0088834[more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
abhd46.811e-7534.96abhydrolase domain containing 4 [Source:ZFIN;Acc:Z... [more]
abhd5b5.020e-5132.21abhydrolase domain containing 5b [Source:ZFIN;Acc:... [more]
abhd5b1.393e-1834.81abhydrolase domain containing 5b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
jmjd42.748e-7436.53jumonji domain containing 4 [Source:Xenbase;Acc:XB... [more]
jmjd43.535e-7436.53jumonji domain containing 4 [Source:Xenbase;Acc:XB... [more]
abhd51.157e-7032.41abhydrolase domain containing 5 [Source:NCBI gene;... [more]
abhd56.865e-6932.47abhydrolase domain containing 5 [Source:NCBI gene;... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abhd45.504e-6736.59abhydrolase domain containing 4 [Source:MGI Symbol... [more]
Abhd46.547e-6734.10abhydrolase domain containing 4 [Source:MGI Symbol... [more]
Abhd53.444e-6335.32abhydrolase domain containing 5 [Source:MGI Symbol... [more]
Abhd41.472e-3543.33abhydrolase domain containing 4 [Source:MGI Symbol... [more]
Abhd51.166e-3132.74abhydrolase domain containing 5 [Source:MGI Symbol... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VD66|ABHD4_MOUSE3.954e-6634.10(Lyso)-N-acylphosphatidylethanolamine lipase OS=Mu... [more]
sp|Q8TB40|ABHD4_HUMAN4.841e-6636.91(Lyso)-N-acylphosphatidylethanolamine lipase OS=Ho... [more]
sp|H2KZ86|ABH52_CAEEL6.097e-6635.28Abhydrolase domain-containing protein abhd-5.2 OS=... [more]
sp|O02218|LID1_CAEEL1.020e-6533.69Abhydrolase domain-containing protein lid-1 OS=Cae... [more]
sp|Q5EA59|ABHD4_BOVIN1.911e-6534.36(Lyso)-N-acylphosphatidylethanolamine lipase OS=Bo... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A419Q0131.242e-9038.30Abhydrolase domain-containing protein 4 OS=Clonorc... [more]
A0A074Z6L92.111e-9037.90AB hydrolase-1 domain-containing protein OS=Opisth... [more]
A0A4S2M4E42.724e-8938.84AB hydrolase-1 domain-containing protein OS=Opisth... [more]
A0A564YI811.230e-8737.28AB hydrolase-1 domain-containing protein OS=Hymeno... [more]
A0A0R3U1I02.048e-8736.24AB hydrolase-1 domain-containing protein OS=Mesoce... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
abhd44.504e-7836.50abhydrolase domain containing 4 [Source:NCBI gene;... [more]
ABHD59.056e-7334.73abhydrolase domain containing 5 [Source:NCBI gene;... [more]
ABHD57.527e-6233.71abhydrolase domain containing 5 [Source:NCBI gene;... [more]
ENSAMXT00000038558.13.818e-5935.551-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ABHD56.529e-5031.84abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
ABHD53.112e-4831.84abhydrolase domain containing 5 [Source:HGNC Symbo... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ICT12.530e-1421.09Lysophosphatidic acid acyltransferase; responsible... [more]
ECM181.145e-927.94Protein of unknown function; ECM18 has a paralog, ... [more]
CLD12.419e-834.19Mitochondrial cardiolipin-specific phospholipase; ... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO345261.487e-7935.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406071.037e-7035.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abhd41.921e-7534.70abhydrolase domain containing 4 [Source:NCBI gene;... [more]
abhd43.452e-7534.70abhydrolase domain containing 4 [Source:NCBI gene;... [more]
abhd46.153e-7237.04abhydrolase domain containing 4 [Source:NCBI gene;... [more]
ENSORLT00000004565.22.863e-7035.581-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ENSORLT00000031658.14.303e-6635.421-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
back to top
BLAST of Abhydrolase domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000080893.10.000e+0100.00SMESG000080893.1[more]
SMESG000011680.15.732e-9739.37SMESG000011680.1[more]
SMESG000011690.12.504e-9437.22SMESG000011690.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013589 ID=SMED30013589|Name=Abhydrolase domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1436bp
GTTTCATTAAATGTATAATAGTTTATGCTAACTTACCTTACGATTTTGTT
TTAAAACTCAAATTTGAAAATTTTATGAATTTCTACAAATGACTTTTTCG
CCAGGAAGTATTTATCAGCAAGAAAATACTTTTTGGCCTTATTGGCTTAA
GTGGTGTCCTTCCTCAAGTTATTTAGCGATTCTTGCTGAAACTCGTTTAC
TAAATCGCGTAAATTCAGTGAAAGAAATTATTTTGGTGCCAGTTTTACAC
AAGAAGCATTGCATTCGAACATTATATGTATATAGAAATAATTTCAACTC
CGAAGAAGAAAGACAAATTTATTTTAATAACTATCCGATTGTGCTTGTAC
ATGGAATGGGCGCAGGCTTAGCCATGTGGTGTAAAAATTTGGATGCTCTC
GCAGAGCGTCGACAAGTTTATGTATTTGATTTAATTGGATTTGGAAATAG
TTCTAGGCCAGCATTTTCTGATAATAATATTAAAGTCGAAAACACTTTTA
TTCAATCAATTGAGGATTGGAGAATTTATTTAGGATTAAAAAAATTCATT
ATTCTTGGTCACAGTTTAGGTGGTTACCTTGCTTTTTCATATGGAATTAA
ATTTGGACACACATTATTACACATTATACTTGCTGACCCGTGGGGTTTCC
GAGAATGTAAAAGTCGATTTGAATCACCATTTTATATGAACTGGACTCTT
AGTTTATTGAGTTTTTTATTTAAATATTTAAACCCATTATTTCCCGTCAG
ACTCTTTGGTCCATTTGCTCCATATATACTTCGATTGGTAAGACAGGATC
TTGGTGTTACTTTTACACCAGCTCAAATATCATTGAATATTATTAAAGAT
GACAAATTAATATCTAGTCAACCAACAGGAGACCTTGGAAATATTGATGA
AAAAGATGATCATCAAGGATTTGTGCTTAAACATACTGAATCTGATTTAG
GGGCGATTTTTGATTATGTTTATCATTGTAATACTAGAACTCCAAGTGGA
GAAGCTGCTTTTAAACGCTTATCTGACCCGATTGGCTGGGCAGCTAGGCC
AATGATAAAAAGAATTAATGATTTAGATTCTGAAATCGATGTCACGTTTA
TCTATGGTGGCAAGTCGTGGATGGATTGGCAAACTGGCTATCAAGCTCAA
CATTTAAGAATGAATTCGACAGTAAATGTTAAAGTGATAGATGATGCTGG
TCACCATGTATACGCTGAAGCTAGTAATGATTTCAATAATTACGTTAATT
CAATATGTGAAGCTGTTCAAAATTCTCAAAATCTATTAACCAGAAAAATA
CTTTCAAATTAATTTTGCGATAAAATATTGATTAGTGTTAATTAAATTCG
TTCAGTTTTATTAGTGTATAATTGAAAGATTATAAAAAATATTTTAACTG
AATCAAAGTATTTTATGCTCATGTTGACAATCTAAA
back to top

protein sequence of SMED30013589-orf-1

>SMED30013589-orf-1 ID=SMED30013589-orf-1|Name=SMED30013589-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=408bp
MTFSPGSIYQQENTFWPYWLKWCPSSSYLAILAETRLLNRVNSVKEIILV
PVLHKKHCIRTLYVYRNNFNSEEERQIYFNNYPIVLVHGMGAGLAMWCKN
LDALAERRQVYVFDLIGFGNSSRPAFSDNNIKVENTFIQSIEDWRIYLGL
KKFIILGHSLGGYLAFSYGIKFGHTLLHIILADPWGFRECKSRFESPFYM
NWTLSLLSFLFKYLNPLFPVRLFGPFAPYILRLVRQDLGVTFTPAQISLN
IIKDDKLISSQPTGDLGNIDEKDDHQGFVLKHTESDLGAIFDYVYHCNTR
TPSGEAAFKRLSDPIGWAARPMIKRINDLDSEIDVTFIYGGKSWMDWQTG
YQAQHLRMNSTVNVKVIDDAGHHVYAEASNDFNNYVNSICEAVQNSQNLL
TRKILSN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
IPR000073AB_hydrolase_1
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000073Alpha/beta hydrolase fold-1PFAMPF00561Abhydrolase_1coord: 83..184
e-value: 1.0E-16
score: 61.4
NoneNo IPR availablePANTHERPTHR42886:SF341-ACYLGLYCEROL-3-PHOSPHATE O-ACYLTRANSFERASE ABHD5coord: 17..239
NoneNo IPR availablePANTHERPTHR42886FAMILY NOT NAMEDcoord: 17..239
coord: 289..393
NoneNo IPR availablePANTHERPTHR42886:SF341-ACYLGLYCEROL-3-PHOSPHATE O-ACYLTRANSFERASE ABHD5coord: 289..393
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 81..386