DNA-directed RNA polymerase III subunit RPC8

Overview
NameDNA-directed RNA polymerase III subunit RPC8
Smed IDSMED30013558
Length (bp)1864
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase III subunit RPC8 (SMED30013558) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase III subunit RPC8 (SMED30013558) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase III subunit RPC8 (SMED30013558) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase III subunit RPC8 (SMED30013558) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013558

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013558h1SMcG0020668 Contig1197newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013558h1SMcG0020668 Contig1197uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013558h1SMcG0022115 Contig1197newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013558h1SMcG0022115 Contig1197uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30013558h1SMcG0020668 SmedASXL_019939SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30013558h1SMcG0020668 dd_Smed_v4_9660_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013558h1SMcG0020668 dd_Smed_v4_5373_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013558h1SMcG0020668 dd_Smed_v4_21173_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 145.591 bits (366), Expect = 1.426e-39
Identity = 76/187 (40.64%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FR V+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  +     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 145.591 bits (366), Expect = 1.426e-39
Identity = 76/187 (40.64%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FR V+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  +     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 145.591 bits (366), Expect = 1.426e-39
Identity = 76/187 (40.64%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FR V+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  +     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 98.2117 bits (243), Expect = 1.103e-23
Identity = 47/98 (47.96%), Postives = 64/98 (65.31%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQ 322
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FR V+F PF++EI+ G +  CSPEG+ 
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVH 98          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 94.7449 bits (234), Expect = 7.061e-22
Identity = 61/187 (32.62%), Postives = 91/187 (48.66%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +                              +VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  +     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHT-----------------------------KVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLV 158          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Celegans
Match: rpc-25 (RNA Polymerase, Class III (C) [Source:UniProtKB/TrEMBL;Acc:Q23645])

HSP 1 Score: 111.694 bits (278), Expect = 1.432e-27
Identity = 58/164 (35.37%), Postives = 94/164 (57.32%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVW--TIENGE----ITIDVQDKINFKVTEYIWQDTFP 502
            MF +  + DTV I+P          I++ LN +L+NK++ + GL IC++DI + GD  I P +G     V FR ++F+PF++E+I   V   S +GL ++I+FF+DI +P   +P+   F+ E   W W    E+GE    + +D    + F+VTE I++D  P
Sbjct:    1 MFILSLLHDTVAIQPHQLSSDQQIVIKKRLNERLANKIIPDLGLCICVYDINEIGDSYILPGEGDCRARVKFRMIVFRPFVDEVIEAKVIGSSRQGLCLTIQFFEDIFVPAEKLPEPHVFEEEGQVWYWEYAQEDGEPPAKLYMDPGKIVRFRVTEIIFKDLKP 164          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Fly
Match: CG7339 (gene:FBgn0036188 transcript:FBtr0331530)

HSP 1 Score: 141.354 bits (355), Expect = 6.396e-38
Identity = 72/175 (41.14%), Postives = 103/175 (58.86%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVW--TIENG---EITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQ 538
            MF +  +KD VRI P  F L  V  +  E++RKL+NKVLLN GL I L DI+   D  I P DGA +  V FRYV+F+P +  +I G +  CS EG+ V++ FFDDI+IP A +     F   + +WVW   +E+G   ++ +DV + I F+V+  I+++T PI     E    Q
Sbjct:    1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWEYPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQ 175          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Fly
Match: CG7339 (gene:FBgn0036188 transcript:FBtr0076107)

HSP 1 Score: 141.354 bits (355), Expect = 6.396e-38
Identity = 72/175 (41.14%), Postives = 103/175 (58.86%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVW--TIENG---EITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQ 538
            MF +  +KD VRI P  F L  V  +  E++RKL+NKVLLN GL I L DI+   D  I P DGA +  V FRYV+F+P +  +I G +  CS EG+ V++ FFDDI+IP A +     F   + +WVW   +E+G   ++ +DV + I F+V+  I+++T PI     E    Q
Sbjct:    1 MFVLAELKDNVRIAPDQFHLKLVDAVRDEIDRKLANKVLLNVGLCIALKDIVSLKDSIILPGDGASHTEVLFRYVVFRPMVGTVITGKIRNCSREGVHVTLGFFDDILIPHAALQHPSRFDEAEQAWVWEYPLEDGAKHDLFMDVGEPIKFRVSREIFEETSPIGPPKTEAQTQQ 175          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Fly
Match: Rpb7 (gene:FBgn0051155 transcript:FBtr0083137)

HSP 1 Score: 50.8322 bits (120), Expect = 4.621e-7
Identity = 32/148 (21.62%), Postives = 66/148 (44.59%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV 472
            MF  ++++  + + PR+F    ++ ++Q+L  ++        G  I +  I   G   I P  G     V ++ ++F+PF  E++   V + +  G+   I       I   +IP   +F    N   +  ++ ++ I  +DKI  K+
Sbjct:    1 MFYHISLEQEILLHPRYFGPQLLETVKQKLYSEVEGTCTGKYGFVIAVTTIDQIGSGVIQPGQGFVVYPVKYKAIVFRPFKGEVLDAVVKQINKVGMFAEIGPL-SCFISHHSIPADMQFCPNGNPPCYKSKDEDVVISGEDKIRLKI 147          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Zebrafish
Match: polr3h (polymerase (RNA) III (DNA directed) polypeptide H [Source:ZFIN;Acc:ZDB-GENE-040718-179])

HSP 1 Score: 149.058 bits (375), Expect = 6.169e-41
Identity = 74/169 (43.79%), Postives = 107/169 (63.31%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEIT----IDVQDKINFKVTEYIWQDTFPISNSVDE 523
            MF +V ++DTVRI P  F+    + + +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F PF++EI+ G +  CS EG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E T    +D  ++I F+VT+ ++ DT P   S D+
Sbjct:    1 MFVLVEMRDTVRIPPWSFQRPLNEAVAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILLGKIKGCSAEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETDEGTHDLYMDQGEEIRFRVTDEVFVDTSPSGPSADK 169          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Zebrafish
Match: polr2gl (polymerase (RNA) II (DNA directed) polypeptide G-like [Source:NCBI gene;Acc:324088])

HSP 1 Score: 53.9138 bits (128), Expect = 5.719e-8
Identity = 38/167 (22.75%), Postives = 73/167 (43.71%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + ++ I   D+I  K+  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDVVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Xenopus
Match: myadml2 (myeloid-associated differentiation marker-like 2 [Source:Xenbase;Acc:XB-GENE-967754])

HSP 1 Score: 147.902 bits (372), Expect = 3.385e-40
Identity = 82/201 (40.80%), Postives = 118/201 (58.71%), Query Frame = 2
Query:    2 LYIFKLYIL--MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRV-----QQERSTAPFTVV 571
            LY+F   +L  MF +V + DTVR  P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F+PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +DV + I F++ +  + DT P   S  E +       +  R  AP+T+V
Sbjct:   10 LYLFPRLLLAKMFVLVEMVDTVRTNPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKMDDSYIFPGDGASHTKVQFRYVVFRPFLDEILMGKIKGCSPEGVHVSLGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDVGEDIRFRMVDETFIDTSPTGPSSAEASSSTAVAEETPRKEAPYTLV 210          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Xenopus
Match: myadml2 (myeloid-associated differentiation marker-like 2 [Source:Xenbase;Acc:XB-GENE-967754])

HSP 1 Score: 142.895 bits (359), Expect = 8.780e-39
Identity = 71/164 (43.29%), Postives = 101/164 (61.59%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPIS 508
            MF +V + DTVR  P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F+PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +DV + I F++ +  + DT P  
Sbjct:    1 MFVLVEMVDTVRTNPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKMDDSYIFPGDGASHTKVQFRYVVFRPFLDEILMGKIKGCSPEGVHVSLGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDVGEDIRFRMVDETFIDTSPTG 164          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Xenopus
Match: polr2g (polymerase (RNA) II (DNA directed) polypeptide G [Source:NCBI gene;Acc:549819])

HSP 1 Score: 53.9138 bits (128), Expect = 8.149e-8
Identity = 38/167 (22.75%), Postives = 73/167 (43.71%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + ++ I   D+I  K+  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDVVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Xenopus
Match: polr2g (polymerase (RNA) II (DNA directed) polypeptide G [Source:NCBI gene;Acc:549819])

HSP 1 Score: 49.6766 bits (117), Expect = 2.075e-6
Identity = 31/144 (21.53%), Postives = 63/144 (43.75%), Query Frame = 2
Query:   41 VNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV 472
            ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + ++ I   D+I  K+
Sbjct:    4 ISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDVVIQQDDEIRLKI 146          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Mouse
Match: Polr3h (polymerase (RNA) III (DNA directed) polypeptide H [Source:MGI Symbol;Acc:MGI:1926179])

HSP 1 Score: 142.51 bits (358), Expect = 1.117e-38
Identity = 77/187 (41.18%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQ--ERSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FRYV+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  E     +   +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Mouse
Match: Polr3h (polymerase (RNA) III (DNA directed) polypeptide H [Source:MGI Symbol;Acc:MGI:1926179])

HSP 1 Score: 88.5817 bits (218), Expect = 6.913e-20
Identity = 61/187 (32.62%), Postives = 90/187 (48.13%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQ--ERSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +                              +VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  E     +   +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHT-----------------------------KVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKKEAPYTLV 158          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Mouse
Match: Polr2g (polymerase (RNA) II (DNA directed) polypeptide G [Source:MGI Symbol;Acc:MGI:1914960])

HSP 1 Score: 54.6842 bits (130), Expect = 2.966e-8
Identity = 39/167 (23.35%), Postives = 73/167 (43.71%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + +I I   D+I  K+  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Match: sp|Q9Y535|RPC8_HUMAN (DNA-directed RNA polymerase III subunit RPC8 OS=Homo sapiens OX=9606 GN=POLR3H PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 6.847e-39
Identity = 76/187 (40.64%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FR V+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  +     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRCVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Match: sp|Q2T9X1|RPC8_BOVIN (DNA-directed RNA polymerase III subunit RPC8 OS=Bos taurus OX=9913 GN=POLR3H PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.038e-38
Identity = 70/162 (43.21%), Postives = 103/162 (63.58%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFP 502
            MF +V + DTVRI P  F+      I++ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FRYV+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D+ +++ F+V +  + DT P
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIDEELNKKLANKVMYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDIGEEVRFRVVDESFVDTSP 162          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Match: sp|Q9D2C6|RPC8_MOUSE (DNA-directed RNA polymerase III subunit RPC8 OS=Mus musculus OX=10090 GN=Polr3h PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 7.816e-38
Identity = 77/187 (41.18%), Postives = 111/187 (59.36%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQ--ERSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FRYV+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  E     +   +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEAASSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Match: sp|P35718|RPC8_YEAST (DNA-directed RNA polymerase III subunit RPC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPC25 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.971e-31
Identity = 65/175 (37.14%), Postives = 105/175 (60.00%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVS-IEFFDDIIIPKANIPQSFEFQSEKNSWVWTI-ENGEITIDVQDKINFKVTEYIWQDTFPISNSVDE-NNRVQQE 544
            MF +  I D VRI P  F   T+  I  +LN K +NK++ N GL I ++D+L   + ++ P DG+ Y+ V+FR V+FKPF+ EI+ G ++KC+ EG++VS +  FDDI IP+  + +   +  E+++W+W + E  ++  DV +KI F++   ++ D  P S    E   R Q E
Sbjct:    1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKPKSPKERELEERAQLE 175          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Match: sp|O94285|RPC8_SCHPO (DNA-directed RNA polymerase III subunit rpc8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc25 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.440e-29
Identity = 63/189 (33.33%), Postives = 105/189 (55.56%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTI------ENGEITIDVQDKINFKVTEYIWQDTFPISN-SVDENNRVQQERSTAPFTVVV 574
            MF +    D + I P +F   T + + +E+++K +NKV+ N GL IC++D L  G+  I   DG+ Y+ V FR +IF+PF  E++ G +  CS EG++V+I FFDDI IPK  +     F+ ++ +WVW I      E  E+  D+ ++I F++    + D  P  N +       +   S +P+T++ 
Sbjct:    1 MFLLSRFSDIISIHPSNFWKPTKEALAEEIHKKYANKVIQNIGLAICVYDFLKIGEGIIKYGDGSSYMNVVFRLIIFRPFRGEVMLGKIKSCSEEGIRVTISFFDDIFIPKDMLFDPCVFRPDERAWVWKIEGEDGSEGTELYFDIDEEIRFQIESEDFVDISPKRNKNATAITGTEALESVSPYTLIA 189          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Match: A0A091RK12 (DNA-directed RNA polymerase III subunit RPC8 OS=Merops nubicus OX=57421 GN=N331_08853 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 6.051e-39
Identity = 79/189 (41.80%), Postives = 114/189 (60.32%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDE----NNRVQQERSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F PF++EI+ G +  C+PEG+ VSI FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D+ ++I F+V +  + DT P   S  E    N   + ++  AP+T+V
Sbjct:    1 MFVLVEMTDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILIGQIKSCTPEGVHVSIGFFDDIVIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDIGEEIRFRVVDETFVDTSPTGPSSAEASTSNATEEVQKKEAPYTLV 189          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Match: K9IV91 (Putative dna-directed rna polymerase iii subunit rpc8 (Fragment) OS=Desmodus rotundus OX=9430 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.739e-39
Identity = 77/187 (41.18%), Postives = 113/187 (60.43%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FRYV+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D+ +++ F+V +  + DT P   S  E     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDSYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQMWVWEYETEEGAHDLYMDIGEEVRFRVVDESFVDTSPSGPSSAEAASTSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Match: A0A1Y2GJV7 (DNA-directed RNA polymerase III subunit RPC8 OS=Lobosporangium transversale OX=64571 GN=BCR41DRAFT_337925 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.314e-38
Identity = 79/189 (41.80%), Postives = 110/189 (58.20%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKVTEYIWQDTFPI----SNSVDENNRVQQERSTAPFTVVVRLD 583
            MF++  IKDT++IEP  F+    + I  E+NRK +NKVL N GL I + DIL   +  I+  DG  YVTV FR VIF+PFI EII G +  CS EG++VS+ FFDDI IP   + Q  EF SE+  WVW  +  E+ +D+ + I F+V    + DT P        VD  +        AP+++V  ++
Sbjct:    1 MFNLAEIKDTIKIEPSGFRKKKPQAITDEINRKYANKVLQNVGLCIAMHDILSASEGFIHHGDGCSYVTVHFRMVIFRPFIGEIIIGKIRSCSREGIRVSLGFFDDIFIPAGYLQQGTEFNSEEQVWVWMYDENEMFMDIDESIRFRVESEQFFDTSPSVRPKKEGVDTPDLSANSTKQAPYSLVCSIN 189          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Match: M3W6B9 (RNA polymerase III subunit H OS=Felis catus OX=9685 GN=POLR3H PE=4 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 1.758e-38
Identity = 78/187 (41.71%), Postives = 112/187 (59.89%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQE--RSTAPFTVV 571
            MF +V + DTVRI P  F+      I +ELN+KL+NKV+ N GL ICL+DI    D  ++P DGA +  V FRYV+F PF++EI+ G +  CSPEG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V +  + DT P   S  E     +E  +  AP+T+V
Sbjct:    1 MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSAEGTSSSEELPKKEAPYTLV 187          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Match: A0A4W6DKG8 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=polr3h PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.587e-38
Identity = 77/192 (40.10%), Postives = 118/192 (61.46%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVVVRLDLIV 592
            MF +V + DTVRI P +F+    + I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F PF++EI+ G +  CS EG+ V++ FFDDI+IP  ++ Q  +F   +  W+W  E  E    + +D  ++I F+VT+ ++ DT P   +    +  ++E   AP+T++VR    V
Sbjct:    1 MFVLVEMVDTVRIPPWNFQRQLNEAIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILVGKIKYCSQEGVHVTMGFFDDILIPPESLQQPAKFDEAEQVWLWEYETDEGAHDLYMDQGEEIRFRVTDEVFVDTSPTGPATAATDTPKKE---APYTLIVRTHFTV 189          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Cavefish
Match: polr3h (RNA polymerase III subunit H [Source:NCBI gene;Acc:103032147])

HSP 1 Score: 144.436 bits (363), Expect = 1.453e-39
Identity = 75/188 (39.89%), Postives = 110/188 (58.51%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVVVRL 580
            MF VV + DTVRI P +F       I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F PF++EI+ G +  CS EG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V + ++ DT P   + D           +P+T++  +
Sbjct:    1 MFVVVEMVDTVRIPPWNFHRQLNDAIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILVGKIKYCSQEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETDEGAHDLYMDQGEEIRFRVVDELFLDTSPTGPTTDPEKE-------SPYTLMASI 181          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Cavefish
Match: polr3h (RNA polymerase III subunit H [Source:NCBI gene;Acc:103032147])

HSP 1 Score: 143.665 bits (361), Expect = 5.060e-39
Identity = 73/168 (43.45%), Postives = 103/168 (61.31%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPISNSVD 520
            MF VV + DTVRI P +F       I +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FRYV+F PF++EI+ G +  CS EG+ VS+ FFDDI+IP  ++ Q  +F   +  WVW  E  E    + +D  ++I F+V + ++ DT P   + D
Sbjct:    1 MFVVVEMVDTVRIPPWNFHRQLNDAIAEELNKKLANKVVYNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRYVVFHPFLDEILVGKIKYCSQEGVHVSLGFFDDILIPPESLQQPAKFDEAEQVWVWEYETDEGAHDLYMDQGEEIRFRVVDELFLDTSPTGPTTD 168          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Cavefish
Match: polr2gl (RNA polymerase II subunit G [Source:NCBI gene;Acc:103034356])

HSP 1 Score: 54.299 bits (129), Expect = 2.983e-8
Identity = 39/167 (23.35%), Postives = 73/167 (43.71%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + +I I   D+I  K+  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Sea Lamprey
Match: POLR3H (RNA polymerase III subunit H [Source:HGNC Symbol;Acc:HGNC:30349])

HSP 1 Score: 103.99 bits (258), Expect = 5.539e-26
Identity = 52/130 (40.00%), Postives = 78/130 (60.00%), Query Frame = 2
Query:  125 KLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEIT----IDVQDKINFKVTEYIWQDTFP 502
             L  +V+ N GL +CL+DI    D  ++P DGA +  V FR+V+F+PF++EI+ G +  CS EG+QVS+ FFDDI IP  ++ Q  +    +  WVW  E  E T    +DV + + F+V +  + DT P
Sbjct:    5 SLFRQVVYNVGLCVCLYDITKMEDSFVFPGDGASHTKVHFRFVVFRPFLDEILIGKIKCCSQEGVQVSLGFFDDIRIPPESLQQPSKSDDGEQVWVWEYETEEGTHDLFMDVGEDVRFRVMDETFVDTTP 134          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Yeast
Match: RPC25 (RNA polymerase III subunit C25; required for transcription initiation; forms a heterodimer with Rpc17p; paralog of Rpb7p [Source:SGD;Acc:S000001627])

HSP 1 Score: 125.176 bits (313), Expect = 2.838e-33
Identity = 65/175 (37.14%), Postives = 105/175 (60.00%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVS-IEFFDDIIIPKANIPQSFEFQSEKNSWVWTI-ENGEITIDVQDKINFKVTEYIWQDTFPISNSVDE-NNRVQQE 544
            MF +  I D VRI P  F   T+  I  +LN K +NK++ N GL I ++D+L   + ++ P DG+ Y+ V+FR V+FKPF+ EI+ G ++KC+ EG++VS +  FDDI IP+  + +   +  E+++W+W + E  ++  DV +KI F++   ++ D  P S    E   R Q E
Sbjct:    1 MFILSKIADLVRIPPDQFHRDTISAITHQLNNKFANKIIPNVGLCITIYDLLTVEEGQLKPGDGSSYINVTFRAVVFKPFLGEIVTGWISKCTAEGIKVSLLGIFDDIFIPQNMLFEGCYYTPEESAWIWPMDEETKLYFDVNEKIRFRIEREVFVDVKPKSPKERELEERAQLE 175          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Yeast
Match: RPB7 (RNA polymerase II subunit B16; forms dissociable heterodimer with Rpb4p; Rpb4/7 dissociates from RNAPII as Ser2 CTD phosphorylation increases; Rpb4/7 regulates cellular lifespan via mRNA decay process; involved in recruitment of 3'-end processing factors to transcribing RNA polymerase II complex, export of mRNA to cytoplasm under stress conditions; also involved in translation initiation [Source:SGD;Acc:S000002812])

HSP 1 Score: 60.4622 bits (145), Expect = 3.710e-11
Identity = 39/156 (25.00%), Postives = 73/156 (46.79%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICL--WDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKVTEYIWQ 490
            MF + ++   + + P  F     + ++ +L  ++        G  +C+  +D +D     I P+DG+    V +R V+FKPF  E++ GTV  CS  G +V +     + + K  +PQ   F +  N   +  ++ E  I ++ +I  K+   I Q
Sbjct:    1 MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPM-KVFVTKHLMPQDLTFNAGSNPPSY--QSSEDVITIKSRIRVKIEGCISQ 153          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Nematostella
Match: EDO38289 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDD0])

HSP 1 Score: 143.28 bits (360), Expect = 1.648e-39
Identity = 75/190 (39.47%), Postives = 113/190 (59.47%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTI-----ENGEITIDVQDKINFKVTEYIWQDTFPISNSVDENNRV----QQERSTAPFTVV 571
            MF +  IKDTV+I+P  F L   + I  +LN KL+NKV+ N GL I L DIL  GD  + P DG+ +  V+FR+V+F+PF++EI+ G +  C+ EG+QVS+EFFDDIIIP  N+ Q  +F  ++  WVW       E   + +DV ++I F+V +  + D  P        +++     QE   +P+T+ 
Sbjct:    1 MFVLAEIKDTVQIKPWLFSLDIQEAISNKLNMKLANKVVHNVGLCIVLHDILSIGDSYLVPGDGSSHTPVTFRFVVFRPFVDEILKGRIRSCNHEGVQVSMEFFDDIIIPYENLQQPSKFDEDEQVWVWEYTQEGDETHSMFMDVNEEIRFRVVDETFTDVTPSGPEAASKDQIATKDDQEIRKSPYTIT 190          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Nematostella
Match: EDO39159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAY0])

HSP 1 Score: 51.6026 bits (122), Expect = 1.047e-7
Identity = 35/167 (20.96%), Postives = 74/167 (44.31%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    ++ ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   + + +  GL   I       + + +IP   EF    N   +  ++ ++     D+I  +V  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLQTVKQKLFTEVEGTCSGKYGFIIAVTTIDNIGVGHIQPGRGFVVYPVKYKAIVFRPFKGEVLDAVITQVNKLGLFTEIGPL-SCFVSRHSIPPDMEFDPNSNPPCYKTKDEDVVYQQDDEIRLRVVGTRVDANDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Medaka
Match: polr3h (RNA polymerase III subunit H [Source:NCBI gene;Acc:101173470])

HSP 1 Score: 142.51 bits (358), Expect = 1.295e-38
Identity = 73/181 (40.33%), Postives = 109/181 (60.22%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGE----ITIDVQDKINFKVTEYIWQDTFPIS-NSVDENNRVQQERSTA 556
            MF +V + DTVRI P  F     + + +ELN+KL+NKV+ N GL ICL+DI    D  I+P DGA +  V FR+V+F PF+ EI+ G +  CS EG+ V++ FFDDI+IP  ++ Q  +F   +  W+W  E  E    + +D  ++I F+VT+ ++ DT P    +   +N  Q  +STA
Sbjct:    1 MFVLVEMVDTVRIPPWCFHRQLNEAVAEELNKKLANKVVFNVGLCICLYDITKLEDSYIFPGDGASHTKVHFRFVVFHPFLEEILVGKIKYCSQEGVHVTMGFFDDILIPPESLQQPAKFDEAEQVWLWEYETDEGAHDLYMDQGEEIRFRVTDEVFVDTSPTGPAAATPDNAAQPGQSTA 181          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Medaka
Match: polr2gl (RNA polymerase II subunit G [Source:NCBI gene;Acc:101162220])

HSP 1 Score: 54.299 bits (129), Expect = 2.965e-8
Identity = 39/167 (23.35%), Postives = 73/167 (43.71%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            MF  ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + +I I   D+I  K+  T     D F I + +D+
Sbjct:    1 MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 166          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Medaka
Match: polr2gl (RNA polymerase II subunit G [Source:NCBI gene;Acc:101162220])

HSP 1 Score: 53.9138 bits (128), Expect = 5.475e-8
Identity = 39/169 (23.08%), Postives = 74/169 (43.79%), Query Frame = 2
Query:   23 ILMFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV--TEYIWQDTFPISNSVDE 523
            I+M   ++++  + + PR+F    +  ++Q+L  ++        G  I +  I + G   I P  G     V ++ ++F+PF  E++   V + +  GL   I       I + +IP   EF    N   +   + +I I   D+I  K+  T     D F I + +D+
Sbjct:    2 IMMCLQISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPM-SCFISRHSIPSEMEFDPNSNPPCYKTVDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDD 169          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Planmine SMEST
Match: SMESG000019826.1 (SMESG000019826.1)

HSP 1 Score: 370.548 bits (950), Expect = 3.578e-126
Identity = 184/194 (94.85%), Postives = 187/194 (96.39%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVVVRLDLIVVAISLP 610
            MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVV  ++  V  + LP
Sbjct:    1 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVVGTIN--VHGLGLP 192          
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Planmine SMEST
Match: SMESG000034943.1 (SMESG000034943.1)

HSP 1 Score: 48.1358 bits (113), Expect = 3.515e-6
Identity = 30/148 (20.27%), Postives = 66/148 (44.59%), Query Frame = 2
Query:   29 MFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLNTGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAKCSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQDKINFKV 472
            MF  +N+K  + + P++     ++ I+ +L  ++      N G  I +  I   GD  +    G   + + ++ ++F+PF+ E++   V   +  G+      F  I I    +PQ+F++  +     +  E  +  I   D+I  ++
Sbjct:    1 MFYHLNLKHEINLHPKYLGPNIIETIKAKLLSEVEGICTPNYGFIIAVTSIDKIGDGVVQQGRGFTLIPIEYKAIVFRPFVGEVLDAVVLNVTKIGIFAMAGAF-QIFISVYAVPQNFQYDGDTVPPCYKTEEDDQVIQEDDEIRVRI 147          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR3H1.426e-3940.64RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
POLR3H1.426e-3940.64RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
POLR3H1.426e-3940.64RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
POLR3H1.103e-2347.96RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
POLR3H7.061e-2232.62RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpc-251.432e-2735.37RNA Polymerase, Class III (C) [Source:UniProtKB/T... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG73396.396e-3841.14gene:FBgn0036188 transcript:FBtr0331530[more]
CG73396.396e-3841.14gene:FBgn0036188 transcript:FBtr0076107[more]
Rpb74.621e-721.62gene:FBgn0051155 transcript:FBtr0083137[more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
polr3h6.169e-4143.79polymerase (RNA) III (DNA directed) polypeptide H ... [more]
polr2gl5.719e-822.75polymerase (RNA) II (DNA directed) polypeptide G-l... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
myadml23.385e-4040.80myeloid-associated differentiation marker-like 2 [... [more]
myadml28.780e-3943.29myeloid-associated differentiation marker-like 2 [... [more]
polr2g8.149e-822.75polymerase (RNA) II (DNA directed) polypeptide G [... [more]
polr2g2.075e-621.53polymerase (RNA) II (DNA directed) polypeptide G [... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Polr3h1.117e-3841.18polymerase (RNA) III (DNA directed) polypeptide H ... [more]
Polr3h6.913e-2032.62polymerase (RNA) III (DNA directed) polypeptide H ... [more]
Polr2g2.966e-823.35polymerase (RNA) II (DNA directed) polypeptide G [... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y535|RPC8_HUMAN6.847e-3940.64DNA-directed RNA polymerase III subunit RPC8 OS=Ho... [more]
sp|Q2T9X1|RPC8_BOVIN3.038e-3843.21DNA-directed RNA polymerase III subunit RPC8 OS=Bo... [more]
sp|Q9D2C6|RPC8_MOUSE7.816e-3841.18DNA-directed RNA polymerase III subunit RPC8 OS=Mu... [more]
sp|P35718|RPC8_YEAST1.971e-3137.14DNA-directed RNA polymerase III subunit RPC8 OS=Sa... [more]
sp|O94285|RPC8_SCHPO3.440e-2933.33DNA-directed RNA polymerase III subunit rpc8 OS=Sc... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091RK126.051e-3941.80DNA-directed RNA polymerase III subunit RPC8 OS=Me... [more]
K9IV918.739e-3941.18Putative dna-directed rna polymerase iii subunit r... [more]
A0A1Y2GJV71.314e-3841.80DNA-directed RNA polymerase III subunit RPC8 OS=Lo... [more]
M3W6B91.758e-3841.71RNA polymerase III subunit H OS=Felis catus OX=968... [more]
A0A4W6DKG82.587e-3840.10Uncharacterized protein OS=Lates calcarifer OX=818... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
polr3h1.453e-3939.89RNA polymerase III subunit H [Source:NCBI gene;Acc... [more]
polr3h5.060e-3943.45RNA polymerase III subunit H [Source:NCBI gene;Acc... [more]
polr2gl2.983e-823.35RNA polymerase II subunit G [Source:NCBI gene;Acc:... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
POLR3H5.539e-2640.00RNA polymerase III subunit H [Source:HGNC Symbol;A... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPC252.838e-3337.14RNA polymerase III subunit C25; required for trans... [more]
RPB73.710e-1125.00RNA polymerase II subunit B16; forms dissociable h... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO382891.648e-3939.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391591.047e-720.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
polr3h1.295e-3840.33RNA polymerase III subunit H [Source:NCBI gene;Acc... [more]
polr2gl2.965e-823.35RNA polymerase II subunit G [Source:NCBI gene;Acc:... [more]
polr2gl5.475e-823.08RNA polymerase II subunit G [Source:NCBI gene;Acc:... [more]
back to top
BLAST of DNA-directed RNA polymerase III subunit RPC8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019826.13.578e-12694.85SMESG000019826.1[more]
SMESG000034943.13.515e-620.27SMESG000034943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013558 ID=SMED30013558|Name=DNA-directed RNA polymerase III subunit RPC8|organism=Schmidtea mediterranea sexual|type=transcript|length=1864bp
ACTATACATTTTTAAACTATACATTTTAATGTTTGACGTAGTTAATATTA
AAGATACAGTTCGCATTGAGCCTAGACATTTTAAATTAGGAACAGTAAAG
TGCATTGAACAAGAGTTAAATAGAAAACTTTCAAATAAAGTTTTACTAAA
TACTGGTTTGGGCATATGTTTGTGGGATATTTTAGATTATGGGGATCGCG
AAATTTATCCCAGTGATGGTGCATATTACGTTACAGTTAGTTTTAGATAT
GTAATTTTTAAACCATTTATTAACGAAATTATTGCTGGAACTGTTGCAAA
ATGTTCCCCAGAAGGTCTTCAGGTGTCGATAGAATTTTTCGATGATATTA
TTATACCTAAGGCAAATATTCCTCAGTCATTCGAATTCCAGTCAGAAAAG
AATTCCTGGGTTTGGACAATTGAAAATGGGGAAATCACCATCGATGTACA
GGATAAAATCAACTTCAAGGTTACAGAATATATCTGGCAGGATACTTTCC
CAATATCGAATTCGGTCGATGAGAACAATCGAGTTCAGCAGGAGAGGTCG
ACGGCTCCATTCACTGTTGTGGTAAGGCTGGATTTGATTGTCGTGGCGAT
TTCATTACCGTTACCAGGGTACCATAAACGTGCACGGATTGGGACTGCCG
TGCTGGTGGGATGACAACTGATGGCAAACATCGATTTCCTTAATAAATAA
TTAGATTGTCTATTTCATCCAATCACAGCGAATGCGGCCTGCTATTGGTC
AGTTTTCTAGAATGTCTGCAGCCAATCGTTTTTCATCTAATCAATGGTTG
CTCTTTATTTATTTTCTACTGTTTTCTGGTTGGTTTTACGTGTAATCTGC
TTGCGTTCATATTTTGTTTAAATTTTACTGTTCTTGTGTCGGTTGCCTTT
CACTTTTGGCTATTTTTAATGATTAACTTGGTGGGTTCCAGTCCAACCGA
GGGATAAGGAGAAGGCCAAAACGGTTGGTGAGAGACACACTAGCTATCAG
CACCTCTGTAAACCCAGAGGTGCTCCGTGTCTGACAGTCAGCCATTTTAC
ACAGTTCTAAACATCACTAGCAACTAATGTCAATTGGTAGAAGGAGAAAG
CTACATTTGGTTTTTTAGGCATGTAAACTCATTTTTTTGTACAAGTTAGG
TTGAAATTGATGCTAAGTTTATTTAAAATCACTGCTCTTATGCTCGTTTA
AGCAATCACATAGGTATTGGTATCAAAAGAATTTGGTATCAAAACCTTGA
AAGCAAAAAGTTTAGATGTCAAACCCTTGCATAGACAATCTTAGTTTAGC
ATAGTTCTAATTATGAACAAGGAAATTAAAATTGCCCAAATCCTTATATG
AATAGATGAGAATCCATTAAGGAGAATTAGTAAGGAGTAGCTTTGGCGAC
GGAGATCAAATGTCTCGTGGTTTGCAACCTTATTGCATATTTCTGATATC
GTGGTATATATGCGCTTTTATCGTTAATTAATTGCAGAAATCATTGGACG
TTTTGAGATTAATTACAACCAGGGCAAATTAATGACCCAAAAAGAAAACA
TCAGCAGAATTGTAAGCATTAATTGCTAATTATAGAGTTCTTGATCAACC
TATAGAAAGTAAAAATCATTTCTTCGGCATTTAAGCTTCAAGATTTGCAT
GCTCTATTCATTCACAGCGATAATTTCAATATCATTTTGAATCATTGTCC
TTATTACCTGAACAAACAGTTGTTCTCTCACCGAATGAATTACAGTGAAT
AAGTGATGTAATCCGCTCAAATATTAATAACAGAATCTATTGTTGATGAA
AATCTTTAAACGAATTTCAAAAAATATTAATTTGAGCTTTACTGTTTGAA
ATGTATAACCTTAC
back to top

protein sequence of SMED30013558-orf-1

>SMED30013558-orf-1 ID=SMED30013558-orf-1|Name=SMED30013558-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
LYIFKLYILMFDVVNIKDTVRIEPRHFKLGTVKCIEQELNRKLSNKVLLN
TGLGICLWDILDYGDREIYPSDGAYYVTVSFRYVIFKPFINEIIAGTVAK
CSPEGLQVSIEFFDDIIIPKANIPQSFEFQSEKNSWVWTIENGEITIDVQ
DKINFKVTEYIWQDTFPISNSVDENNRVQQERSTAPFTVVVRLDLIVVAI
SLPLPGYHKRARIGTAVLVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036898RNA_pol_Rpb7-like_N_sf
IPR013238RNA_pol_III_Rbc25
IPR012340NA-bd_OB-fold
IPR005576Rpb7-like_N
Vocabulary: molecular function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0002376immune system process
GO:0006384transcription initiation from RNA polymerase III promoter
GO:0045087innate immune response
GO:0051607defense response to virus
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005666DNA-directed RNA polymerase III complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036898RNA polymerase Rpb7-like, N-terminal domain superfamilyGENE3DG3DSA:3.30.1490.120coord: 10..88
e-value: 1.8E-25
score: 90.7
IPR036898RNA polymerase Rpb7-like, N-terminal domain superfamilySUPERFAMILYSSF88798N-terminal, heterodimerisation domain of RBP7 (RpoE)coord: 10..87
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 89..195
e-value: 4.8E-23
score: 83.9
NoneNo IPR availablePANTHERPTHR12709DNA-DIRECTED RNA POLYMERASE II, IIIcoord: 10..190
NoneNo IPR availablePANTHERPTHR12709:SF1DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC8coord: 10..190
IPR013238RNA polymerase III, subunit Rpc25PFAMPF08292RNA_pol_Rbc25coord: 88..181
e-value: 7.7E-24
score: 84.4
IPR005576RNA polymerase Rpb7-like , N-terminalPFAMPF03876SHS2_Rpb7-Ncoord: 17..86
e-value: 3.6E-12
score: 46.5
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 88..163