Beta-1,4-galactosyltransferase 4

Overview
NameBeta-1,4-galactosyltransferase 4
Smed IDSMED30013547
Length (bp)1123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-1,4-galactosyltransferase 4 (SMED30013547) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-1,4-galactosyltransferase 4 (SMED30013547) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013547

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30013547h1SMcG0000691 dd_Smed_v4_56517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013547h1SMcG0000691 dd_Smed_v4_56517_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT4 (beta-1,4-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:927])

HSP 1 Score: 155.606 bits (392), Expect = 6.074e-44
Identity = 80/189 (42.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAAD 956
            S G + P  C    +VA+L+P+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q + + FNR KLLN+GYL +     ++C I HDVD +PEND   Y C+  P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L+ ++  R   +   + ++ H  D
Sbjct:  109 SRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLV--VGRNSTGYRLR---YSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRD 292          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT4 (beta-1,4-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:927])

HSP 1 Score: 155.606 bits (392), Expect = 1.778e-43
Identity = 80/189 (42.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAAD 956
            S G + P  C    +VA+L+P+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q + + FNR KLLN+GYL +     ++C I HDVD +PEND   Y C+  P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L+ ++  R   +   + ++ H  D
Sbjct:  109 SRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLV--VGRNSTGYRLR---YSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRD 292          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT4 (beta-1,4-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:927])

HSP 1 Score: 155.606 bits (392), Expect = 1.778e-43
Identity = 80/189 (42.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAAD 956
            S G + P  C    +VA+L+P+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q + + FNR KLLN+GYL +     ++C I HDVD +PEND   Y C+  P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L+ ++  R   +   + ++ H  D
Sbjct:  109 SRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLV--VGRNSTGYRLR---YSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRD 292          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT4 (beta-1,4-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:927])

HSP 1 Score: 155.606 bits (392), Expect = 1.778e-43
Identity = 80/189 (42.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAAD 956
            S G + P  C    +VA+L+P+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q + + FNR KLLN+GYL +     ++C I HDVD +PEND   Y C+  P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L+ ++  R   +   + ++ H  D
Sbjct:  109 SRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLV--VGRNSTGYRLR---YSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRD 292          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 152.91 bits (385), Expect = 5.129e-42
Identity = 91/234 (38.89%), Postives = 129/234 (55.13%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAK--YSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            GG ++P  C + HKVA++IP+RNR  +LK +L  +HP LQ Q LDYGIYVI Q     FNR KLLN+G+  +   Y + C +  DVD +P ND   Y C + P  +  S+ M+  G  L    Y  YFGGV A+   ++   NG  N++WGWGGEDDD  NRLV + +   R         ++ H+ D K   + + F     +   M  +GLNSL +++ D+     +T I V
Sbjct:  164 GGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHI--SVAMDKFGFSLP---YVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITV 392          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 156.377 bits (394), Expect = 7.218e-44
Identity = 80/226 (35.40%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  387 TFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA-----KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T +GG   P  C   H+VA+++PYR+R ++L+  L  +H  L  Q LDY I+++EQ  +++FNRGKL+N+GY  ++ +YP+ C I HDVD LPE+D   Y C   P  +  ++      K   K  Y + FGG+ A+     +K NG  N FWGWGGEDDD   R  +  L+  R   +   + ++ H+ +A     K  +++    +    +   +GL++LK+KL
Sbjct:  133 THAGGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAI-----DKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKR---RWTRDGLSNLKYKL 350          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 156.377 bits (394), Expect = 7.218e-44
Identity = 80/226 (35.40%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  387 TFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA-----KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T +GG   P  C   H+VA+++PYR+R ++L+  L  +H  L  Q LDY I+++EQ  +++FNRGKL+N+GY  ++ +YP+ C I HDVD LPE+D   Y C   P  +  ++      K   K  Y + FGG+ A+     +K NG  N FWGWGGEDDD   R  +  L+  R   +   + ++ H+ +A     K  +++    +    +   +GL++LK+KL
Sbjct:  133 THAGGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAI-----DKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKR---RWTRDGLSNLKYKL 350          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 128.257 bits (321), Expect = 5.253e-35
Identity = 67/193 (34.72%), Postives = 105/193 (54.40%), Query Frame = 3
Query:  483 FLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA-----KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
             L  +H  L  Q LDY I+++EQ  +++FNRGKL+N+GY  ++ +YP+ C I HDVD LPE+D   Y C   P  +  ++      K   K  Y + FGG+ A+     +K NG  N FWGWGGEDDD   R  +  L+  R   +   + ++ H+ +A     K  +++    +    +   +GL++LK+KL
Sbjct:    1 MLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAI-----DKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKR---RWTRDGLSNLKYKL 185          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: bre-4 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 [Source:UniProtKB/Swiss-Prot;Acc:Q9GUM2])

HSP 1 Score: 128.257 bits (321), Expect = 5.253e-35
Identity = 67/193 (34.72%), Postives = 105/193 (54.40%), Query Frame = 3
Query:  483 FLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA-----KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
             L  +H  L  Q LDY I+++EQ  +++FNRGKL+N+GY  ++ +YP+ C I HDVD LPE+D   Y C   P  +  ++      K   K  Y + FGG+ A+     +K NG  N FWGWGGEDDD   R  +  L+  R   +   + ++ H+ +A     K  +++    +    +   +GL++LK+KL
Sbjct:    1 MLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAI-----DKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKR---RWTRDGLSNLKYKL 185          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Match: W02B12.11 (N-acetyllactosamine synthase [Source:UniProtKB/TrEMBL;Acc:G5EGS9])

HSP 1 Score: 128.257 bits (321), Expect = 2.237e-33
Identity = 76/217 (35.02%), Postives = 115/217 (53.00%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNR-LVLKYL--RPKRITLKYYIFLVLNHAADA-KYSFRVFPNYRMSNFQMALNGLNS 1031
            GG W P  C    K+AV+IPYR R ++L R +  + P LQ Q LD+   V EQ  ++ FN+G+++N  ++F+ ++   +C++ HDVD  P++D   Y+C   P  L   +       +  +  YK   GGV+AV   +Y+  NG  N FW WGGEDDD   R L L Y   RP   T +Y +   +     A K  +++  N   S  ++A +GLN 
Sbjct:  147 GGSWKPDDCQARDKIAVIIPYRERQTHLTRLIDFLIPILQRQRLDFRFIVTEQYGNDLFNKGRIMNAAFIFAESLG-VDCVVFHDVDMFPQDDRNPYSCPPGPRHLGAFV-----SNLGYQLWYKEIVGGVLAVSMADYRAVNGYSNQFWAWGGEDDDMGQRILSLNYTIERPNPETGRYSMLKHVKRKRTAPKLIYKLLGN---SANRVAYDGLNE 354          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalNAcTA (gene:FBgn0027538 transcript:FBtr0087539)

HSP 1 Score: 149.828 bits (377), Expect = 3.900e-41
Identity = 82/222 (36.94%), Postives = 125/222 (56.31%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDI 1055
            GG + P  C   H VA+++P+R+R ++L  FL+ IHPFL  Q + Y I+++EQ + + FNR  ++NIGYL +  +Y ++C I HDVD LP +D   YNC   P        M  +   L  +L Y+S FGGV A+    +Q  NG  N F+GWGGEDDD  NRL    L   R  +    + +L H  + K + + + N +    ++  +G+NS+K+ +  I
Sbjct:  169 GGAFEPENCNAQHHVAIVVPFRDRYAHLLLFLRNIHPFLMKQRIAYRIFIVEQTNGKPFNRAAMMNIGYLEALKLYQWDCFIFHDVDLLPLDDRNLYNCPRQP------RHMSVAIDTLNFRLPYRSIFGGVSAMTREHFQAVNGFSNSFFGWGGEDDDMSNRLKHANLFISRYPVNIARYKMLKHQKE-KANPKRYENLQNGMSKIEQDGINSIKYSIYSI 383          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalNAcTB (gene:FBgn0039625 transcript:FBtr0085419)

HSP 1 Score: 137.117 bits (344), Expect = 4.507e-37
Identity = 100/351 (28.49%), Postives = 158/351 (45.01%), Query Frame = 3
Query:   48 IFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
            I IG I L ++L +   +   Y+ I        +  +P +T +    + +      ++  N FV        L +Y                       +A  R +  +P      GG + P  C   +  A+++PYR R   L  FL  +H +L  Q + Y I+++EQ D + FNR  L NIG   +   Y F C+ILHDVD LP N    Y C   P        M S+    + +L Y+  FGGVVA+   +YQ+ NGM N ++GWGGEDDD + RL    +   R  +++  + +L H  +   + RV    R +  +   +GLNSL +   +   ++ H+L   +L
Sbjct:   17 IAIGLITLIVYLCLPFRFASHYDYIEESKIEGAL--VPQVTRNVSQQEVFECTYSEIIAENRFVY------HLAHYH----------------------DAVQRGAEIRP------GGEFRPEGCQARYSTAIIVPYRQREEQLHAFLTYMHNYLPQQLIHYRIFLVEQFDHKPFNRAMLFNIGAQVAAE-YGFPCLILHDVDLLPLNSGQIYACSERP------RHMSSALDHWRFRLPYRGLFGGVVAINTAQYQQINGMSNLYYGWGGEDDDLYERLQALNIDICRFAMEFSKYTMLKHKQEQPNANRV-ALLRSATLRQHADGLNSLVYTEME---RRMHSLFTHIL 320          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Match: beta4GalT7 (gene:FBgn0039258 transcript:FBtr0084755)

HSP 1 Score: 98.9821 bits (245), Expect = 4.629e-23
Identity = 60/167 (35.93%), Postives = 101/167 (60.48%), Query Frame = 3
Query:  420 ATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRL---VLKYLRPKRI 911
            A+ HK+A+L+P+R+R   L +F+  +  FL+ Q + + I+V+ Q D   FNR  L+N+G+ F++ +Y +  I +HDVD LP ND + Y   +S    +  L + +  K+  K  Y ++ GG++ V+   +++ NGM N +WGWG EDD+F  R+    L+  RP+ I
Sbjct:   72 ASVHKMALLVPFRDRFEELLQFVPHMTAFLKRQGVAHHIFVLNQVDRFRFNRASLINVGFQFASDVYDY--IAMHDVDLLPLNDNLLYEYPSS----LGPLHI-AGPKLHPKYHYDNFVGGILLVRREHFKQMNGMSNQYWGWGLEDDEFFVRIRDAGLQVTRPQNI 231          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 160.999 bits (406), Expect = 3.439e-45
Identity = 89/223 (39.91%), Postives = 122/223 (54.71%), Query Frame = 3
Query:  387 TFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQ-NSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T  G    P C   H  A+++PYRNR S+L+  L  +HPFLQ Q L Y IY++ Q+ + +FNR KLLN+G         ++CI LHDVD LPEND   Y C   +P  L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  L    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  112 TLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHL--SVAMD---KFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHKGDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYEL 329          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 160.999 bits (406), Expect = 3.439e-45
Identity = 89/223 (39.91%), Postives = 122/223 (54.71%), Query Frame = 3
Query:  387 TFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQ-NSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T  G    P C   H  A+++PYRNR S+L+  L  +HPFLQ Q L Y IY++ Q+ + +FNR KLLN+G         ++CI LHDVD LPEND   Y C   +P  L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  L    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  112 TLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHL--SVAMD---KFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHKGDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYEL 329          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt3 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-110624-1])

HSP 1 Score: 160.999 bits (406), Expect = 4.279e-45
Identity = 89/223 (39.91%), Postives = 122/223 (54.71%), Query Frame = 3
Query:  387 TFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQ-NSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T  G    P C   H  A+++PYRNR S+L+  L  +HPFLQ Q L Y IY++ Q+ + +FNR KLLN+G         ++CI LHDVD LPEND   Y C   +P  L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  L    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  113 TLGGHYRPPDCEPRHHTAIVVPYRNRQSHLRTLLYHLHPFLQRQQLHYAIYIVHQSGNSTFNRAKLLNVGVREVLKEEDWSCIFLHDVDLLPENDHNTYTCHPQNPTHL--SVAMD---KFRYRLPYSQYFGGVSAVTPQQYLKMNGFPNQYWGWGGEDDDIAARVRLSGMKIMRPPLAIGHYKMIKHKGDQGNEQNPRRFDLLKRTRLNWRSDGLNSLTYEL 330          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-050417-236])

HSP 1 Score: 152.91 bits (385), Expect = 2.391e-43
Identity = 77/161 (47.83%), Postives = 102/161 (63.35%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHN 875
            GG ++P  C    KVA++IPYRNR  +LK +L  +HP L+ Q LDYGIY+IEQ+   +FNR KLLN+GY  +   Y ++C I  DVD +P +D   Y C + P  L  S+ M+  G  L    YK YFGGV A+   +Y+K NG  N++WGWGGEDDD  N
Sbjct:  131 GGRYTPTKCVALQKVAIIIPYRNREEHLKYWLYYLHPILKRQLLDYGIYIIEQDGENTFNRAKLLNVGYAEALKEYDYDCFIFSDVDIIPMDDRNTYGCSSQPRHL--SVSMDKFGFRLP---YKQYFGGVSAMSKKQYEKINGFPNNYWGWGGEDDDIFN 286          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Match: b4galt1l (DP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1, like [Source:ZFIN;Acc:ZDB-GENE-061013-84])

HSP 1 Score: 152.525 bits (384), Expect = 1.876e-42
Identity = 88/236 (37.29%), Postives = 128/236 (54.24%), Query Frame = 3
Query:  393 SGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
             G    P C    KVA++IP+RNR  +LK +L  +HP LQ Q LDYG+YVI Q+  ++FNR KLLNIGY  +   Y ++C +  DVD +P +D   Y C N P  L  ++ M+  G  L    Y  YFGGV ++   ++ K NG  N++WGWGGEDDD  NR+  + +   R         ++ H  D +     + F     +   MA +G+NSLK+  N +  +KD    K+ +
Sbjct:  117 GGRFRPPDCIARQKVAMIIPFRNRDEHLKFWLYYLHPILQRQQLDYGVYVINQDGEDTFNRAKLLNIGYAEALKEYDYDCFVFSDVDLIPMDDRNIYKCYNQPRHL--AVSMDKFGFRLP---YTQYFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIFNRISSRGMSISRPDGLLGRCRMIRHERDKQNDPNPQRFDRIAHTRETMATDGINSLKY--NVVKIEKDLLFTKITV 345          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: b4galt1.1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1, gene 1 [Source:NCBI gene;Acc:100145518])

HSP 1 Score: 157.532 bits (397), Expect = 4.647e-44
Identity = 93/227 (40.97%), Postives = 127/227 (55.95%), Query Frame = 3
Query:  384 KTFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYL---RPKRITLKYYIFLVLNHAADAKYSF--RVFPNYRMSNFQMALNGLNSLKFKL 1046
            K   GG + P  C    KVA++IP+RNR S+LK +L  +HP LQ Q LDYG+YVI Q+   +FNR KL+NIGY  S   Y +NC +  DVD +  +D   Y C N P  L  S+ M+  G  L    Y  YFGGV A+   ++++ NG  N +WGWGGEDDD +NR+V K +   RP   T K  +   + H  D K     + F     +   M  +G+NSL +K+
Sbjct:  133 KVTEGGHYKPSDCKALQKVAIIIPFRNRDSHLKYWLHYMHPILQRQQLDYGVYVINQDGDNTFNRAKLMNIGYAESLKEYDYNCFVFSDVDIVIMDDKNLYRCFNQPRHL--SVAMDKFGFGLP---YHQYFGGVSALSKEQFRRINGFPNTYWGWGGEDDDIYNRIVAKGMSISRPDATTGKCRM---IKHNRDEKNGDNPKRFDLISRTRHTMEKDGINSLSYKV 351          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: ranbp2 (RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-492821])

HSP 1 Score: 156.377 bits (394), Expect = 8.245e-44
Identity = 88/223 (39.46%), Postives = 127/223 (56.95%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS-----FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            GG + P  C + HK AV+IP+R R  +LK  L  +HPFLQ Q L+YGIY+I Q  + +FNR KLLN+G+  +     ++C+  HDVD +PE+D   Y C   P     S+ M+  G  L    YKSYFGGV A+ P +Y K NG  N++WGWGGEDDD   R+ L  +   R ++++  + ++ H  D         F +    R +  Q   +G+NSL++ L
Sbjct:  115 GGRYKPPDCESTHKTAVIIPHRGREQHLKYLLYYLHPFLQRQQLNYGIYIIHQAGNFTFNRAKLLNVGFKEAMKDEDWDCLFYHDVDLIPEDDRNIYTCDKFP--KHASIAMDKFGYKLP---YKSYFGGVSALSPEQYMKMNGFPNNYWGWGGEDDDIGIRVALSGMIISRPSIQHGRYKMIKHGHDKGNEQNPKRFNMLTKTRRTWRQ---DGMNSLQYLL 329          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: B4GALT4 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [Source:NCBI gene;Acc:100488464])

HSP 1 Score: 155.606 bits (392), Expect = 1.598e-43
Identity = 90/220 (40.91%), Postives = 127/220 (57.73%), Query Frame = 3
Query:  417 CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYL---RPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKK 1067
            C +  KVA+LIP+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q  ++ FNR KLLNIGYL +     ++C I HDVD +PEND   Y C   P  L+    +  +G  L+   YK YFGGV A+   ++QK NG  N +WGWGGEDDD   R+V++ +   RP     +Y +      + +   S R+    ++S      +GLNS  +KL  + +++
Sbjct:  123 CKSQQKVAILIPHRNRERHLLYLLKHLHPFLQRQQLDYGIYVIHQTGNQKFNRAKLLNIGYLEALKEEDWDCFIFHDVDLIPENDFNLYLCDTEPKHLVVGRNV--TGYKLR---YKGYFGGVTAMTREQFQKVNGYSNKYWGWGGEDDDLRQRVVVQKMTVVRPPAEVARYTMIFHTRDSGNEVNSQRMKLLDKVSRVWRK-DGLNSCSYKLLSVEHEQ 336          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: fbln2 (fibulin 2 [Source:Xenbase;Acc:XB-GENE-959371])

HSP 1 Score: 150.984 bits (380), Expect = 5.891e-42
Identity = 87/233 (37.34%), Postives = 127/233 (54.51%), Query Frame = 3
Query:  360 KSSNQPIRKTFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNS-PILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMAL--NGLNSLKFKL 1046
            K   Q  R    GG +SP  C   ++ AV+IPYRNR  +L+  L  +HPFLQ Q L Y ++++ Q  + +FNR KLLNIG   +  +  ++C++LHDVD +PEND   Y C    P  L  ++      K      Y +YFGGV A+ P  Y + NG+ N++WGWGGEDDD   R+ L  +   R  L    + +++H  D+          ++SN +     +G+NSL FKL
Sbjct:   72 KKVQQKNRYVKPGGYFSPRHCFGRYRTAVIIPYRNREPHLRTLLYYLHPFLQRQQLHYAVFIVHQAGNGTFNRAKLLNIGVREALKLDDWDCLVLHDVDLVPENDYNLYICDEEYPKHLASAM-----DKFDYSLPYWTYFGGVSALTPDHYMRINGLPNNYWGWGGEDDDIAMRIRLAGMSIARTPLSVGRYKMISHDRDSGNEVNSQRYDQLSNTRQTWREDGMNSLDFKL 299          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Match: nkx6-3 (NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609])

HSP 1 Score: 150.599 bits (379), Expect = 1.652e-41
Identity = 89/235 (37.87%), Postives = 130/235 (55.32%), Query Frame = 3
Query:  372 QPIRKT----FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS-----FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            + IRK+      GG + P  C    KVA++IP+RNR  +LK +L  +HP L+ Q LDYG+YVI Q+  ++FNR KLLNIGY+ S   Y ++C +  DVD +P +D   Y C N P  L  S  M+  G  L    Y  +FGGV A+   ++ K NG  N++WGWGGEDDD +NR+  + +   R         ++ H  D K       F +  + R +   M  +G+N+L +K+
Sbjct:  116 EDIRKSNPDVIEGGHYRPKDCNALQKVAIIIPFRNRDEHLKYWLYYMHPILKRQQLDYGVYVINQDGDKTFNRAKLLNIGYVESLKDYAYDCFVFSDVDLIPMDDRNTYRCFNQPRHL--SAAMDKFGFGLP---YNQFFGGVSALSKEQFLKINGFPNNYWGWGGEDDDIYNRIASRGMYISRPDTLIGRCRMIRHNRDDKNDPNPKRFDLLAHTRQT---MDSDGINTLSYKV 342          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:95705])

HSP 1 Score: 158.688 bits (400), Expect = 2.258e-44
Identity = 95/235 (40.43%), Postives = 130/235 (55.32%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            +GG +SP  C + HKVA++IP+RNR  +LK +L  +HP LQ Q LDYGIYVI Q     FNR KLLNIG+  +   Y +NC +  DVD +P +D   Y C + P  +  S+ M+  G  L    Y  YFGGV A+   ++   NG  N++WGWGGEDDD  NRLV K +   R         ++ H+ D K     + F     +   M  +GLNSL +K+ D+     +T I V
Sbjct:  164 TGGRYSPKDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCFSQPRHI--SVAMDKFGFSLP---YVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRFDGLNSLTYKVLDVQRYPLYTQITV 393          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt4 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1928387])

HSP 1 Score: 154.836 bits (390), Expect = 1.998e-43
Identity = 87/213 (40.85%), Postives = 120/213 (56.34%), Query Frame = 3
Query:  417 CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVL---KYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            C    +VA+LIP+RNR  +L   L+ +HPFLQ Q LDYGIY+I Q  S+ FNR KLLN+GYL +     ++C + HDVD +PEND   Y C + P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L   K  RPK    KY +        +     R+    +MS      +GL+S  ++L
Sbjct:  118 CKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLV--VGRNSTGYRLR---YSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRV-WKTDGLSSCSYRL 324          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt4 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Source:MGI Symbol;Acc:MGI:1928387])

HSP 1 Score: 154.836 bits (390), Expect = 1.998e-43
Identity = 87/213 (40.85%), Postives = 120/213 (56.34%), Query Frame = 3
Query:  417 CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVL---KYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            C    +VA+LIP+RNR  +L   L+ +HPFLQ Q LDYGIY+I Q  S+ FNR KLLN+GYL +     ++C + HDVD +PEND   Y C + P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L   K  RPK    KY +        +     R+    +MS      +GL+S  ++L
Sbjct:  118 CKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLV--VGRNSTGYRLR---YSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRV-WKTDGLSSCSYRL 324          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt1 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:95705])

HSP 1 Score: 145.206 bits (365), Expect = 7.737e-40
Identity = 76/163 (46.63%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNR 878
            +GG +SP  C + HKVA++IP+RNR  +LK +L  +HP LQ Q LDYGIYVI Q     FNR KLLNIG+  +   Y +NC +  DVD +P +D   Y C + P  +  S+ M+  G  L    Y  YFGGV A+   ++   NG  N++WGWGGEDDD  NR
Sbjct:  164 TGGRYSPKDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCFSQPRHI--SVAMDKFGFSLP---YVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNR 321          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Match: B4galt6 (UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 [Source:MGI Symbol;Acc:MGI:1928380])

HSP 1 Score: 142.895 bits (359), Expect = 1.438e-38
Identity = 84/217 (38.71%), Postives = 115/217 (53.00%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRL---VLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSL 1034
            GG W P  C    KVAVLIP+RNR  +L  F   + P LQ Q L++  YVIEQ  ++ FNR  L N+G+  +     ++C+I HDVD LPEND   Y C   P      L      K +    YK +FGGV  +   +++K NG  N FWGWGGEDDD  NR+        RP+   L  YI +  +H  + ++  R +   R S  +  ++GLN+L
Sbjct:  144 GGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKL-----DKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEG-DLGKYISIPHHHRGEVQFLGR-YKLLRYSKERQYIDGLNNL 353          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q80WN7|B4GT4_CRIGR (Beta-1,4-galactosyltransferase 4 OS=Cricetulus griseus OX=10029 GN=B4GALT4 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.977e-44
Identity = 95/236 (40.25%), Postives = 131/236 (55.51%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVL---KYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            SGG + P  C    +VAVLIP+RNR  +L   L+ +HPFLQ Q LDYGIY+I Q  S+ FNR KLLN+GYL +     ++C I HDVD +PEND   Y C + P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L   K  RP     KY +        +     R+   ++MS      +GL+S  ++L  + +   +T I V
Sbjct:  109 SGGRYHPEECKAVQRVAVLIPHRNREKHLTYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEQNWDCFIFHDVDLVPENDFNLYTCGDQPKHLV--VGRNSTGYRLR---YSKYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPNPDVGKYTMIFHTRDKGNEVNVDRMKLLHQMSRV-WKTDGLSSCSYRLLSVEHNPLYTNITV 338          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|P15535|B4GT1_MOUSE (Beta-1,4-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B4galt1 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.580e-43
Identity = 95/235 (40.43%), Postives = 130/235 (55.32%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            +GG +SP  C + HKVA++IP+RNR  +LK +L  +HP LQ Q LDYGIYVI Q     FNR KLLNIG+  +   Y +NC +  DVD +P +D   Y C + P  +  S+ M+  G  L    Y  YFGGV A+   ++   NG  N++WGWGGEDDD  NRLV K +   R         ++ H+ D K     + F     +   M  +GLNSL +K+ D+     +T I V
Sbjct:  164 TGGRYSPKDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDYDYNCFVFSDVDLIPMDDRNAYRCFSQPRHI--SVAMDKFGFSLP---YVQYFGGVSALSKQQFLAINGFPNNYWGWGGEDDDIFNRLVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMRFDGLNSLTYKVLDVQRYPLYTQITV 393          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q66HH1|B4GT4_RAT (Beta-1,4-galactosyltransferase 4 OS=Rattus norvegicus OX=10116 GN=B4galt4 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 3.251e-43
Identity = 90/213 (42.25%), Postives = 120/213 (56.34%), Query Frame = 3
Query:  417 CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVL---KYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            C    +VAVLIP+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q  S+ FNR KLLN+GYL +     ++C I HDVD +PEND   Y C + P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L   K  RPK    KY +        +     R+    +MS      +GL+S  ++L
Sbjct:  118 CKALQRVAVLIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYVIHQTGSKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYTCGDQPKHLV--VGRNSTGYRLR---YSKYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNGSRMKLLQQMSRV-WKTDGLSSCSYRL 324          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|O60513|B4GT4_HUMAN (Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.538e-43
Identity = 80/189 (42.33%), Postives = 113/189 (59.79%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAAD 956
            S G + P  C    +VA+L+P+RNR  +L   L+ +HPFLQ Q LDYGIYVI Q + + FNR KLLN+GYL +     ++C I HDVD +PEND   Y C+  P  L+  +   S+G  L+   Y  YFGGV A+   ++ K NG  N++WGWGGEDDD   R+ L+ ++  R   +   + ++ H  D
Sbjct:  109 SRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLV--VGRNSTGYRLR---YSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRD 292          
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Match: sp|Q9GUM2|BRE4_CAEEL (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Caenorhabditis elegans OX=6239 GN=bre-4 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 9.181e-43
Identity = 80/226 (35.40%), Postives = 127/226 (56.19%), Query Frame = 3
Query:  387 TFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA-----KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            T +GG   P  C   H+VA+++PYR+R ++L+  L  +H  L  Q LDY I+++EQ  +++FNRGKL+N+GY  ++ +YP+ C I HDVD LPE+D   Y C   P  +  ++      K   K  Y + FGG+ A+     +K NG  N FWGWGGEDDD   R  +  L+  R   +   + ++ H+ +A     K  +++    +    +   +GL++LK+KL
Sbjct:  133 THAGGHGMPKDCVARHRVAIIVPYRDREAHLRIMLHNLHSLLAKQQLDYAIFIVEQVANQTFNRGKLMNVGYDVASRLYPWQCFIFHDVDLLPEDDRNLYTCPIQPRHMSVAI-----DKFNYKLPYSAIFGGISALTKDHLKKINGFSNDFWGWGGEDDDLATRTSMAGLKVSRYPTQIARYKMIKHSTEATNPVNKCRYKIMGQTKR---RWTRDGLSNLKYKL 350          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A210QAT5 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07238 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.086e-48
Identity = 97/236 (41.10%), Postives = 137/236 (58.05%), Query Frame = 3
Query:  390 FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKR--ITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
             SGG +SP+ C + H+VAV+IPYRNR   L+RFL  +HPFLQ Q + YGIYVIEQ+ + +FNR  L+NIGY  S  I  +NC + HDVD +PE+D I Y C   P  L  ++      K   +  Y   FGGV  +    + K NG  N ++GWGGEDDD  +R+  +    +R  I +  Y  +  +H +    + + F   R +  +   +GLNSLK+ + +I YKK +TLI V
Sbjct:  121 LSGGCYSPVECESRHRVAVIIPYRNREKQLRRFLYNMHPFLQRQQIHYGIYVIEQSGNNTFNRALLMNIGYAESLKIQNYNCFVFHDVDLIPEDDRIHYGCGEQPRHLSAAI-----DKFQYRLPYTGLFGGVSQIPKEAFVKINGFSNKYFGWGGEDDDLCSRVRAEGYTIQRYPINIARYKMINHHHESGNAENPKRFGLLRDAAKRYKADGLNSLKYNVLNISYKKLYTLISV 351          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: R7UWK7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_120554 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.247e-47
Identity = 94/238 (39.50%), Postives = 144/238 (60.50%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTI-YPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRV-FPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
            +GG W P+ C++ H+VA+++PYR+RV +L+  L+ +HPFLQ Q LDY I+V+EQ+ S  FNRG L+NIG+  + ++ +P++C I HDVD LPE+D   Y+C   P        M ++   L  KL Y + FGGV A+   +++  NG  N F+GWGGEDDD  NRL    L+  R  +    + +L H  +     R+ + N  +S +    +G+NSL +KL  +  +K  TL+ VV+
Sbjct:   13 AGGSWYPVNCSSRHRVAIVVPYRDRVDHLRILLEHLHPFLQKQLLDYKIFVVEQDSSAPFNRGMLMNIGFKEANSVDHPYDCFIFHDVDLLPEDDRNIYDCAEKP------RHMSAAVDTLGYKLPYANLFGGVSAISRQQFELVNGYSNKFFGWGGEDDDIFNRLKYNDLKISRRPMNIARYKMLQHRKNPPARNRMKYLNGGISRYDR--DGVNSLIYKLTALDRRKLFTLVSVVI 242          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A067R2D3 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Zootermopsis nevadensis OX=136037 GN=L798_08284 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.389e-47
Identity = 91/236 (38.56%), Postives = 135/236 (57.20%), Query Frame = 3
Query:  393 SGGVWSP-LCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
             GG W P  C + H+VA++IPYRNR   L+ FL  IHPFLQ Q L+Y I++IEQ    +FNR KLLN+GY  +  I+P++C I HDVD +P+     Y C + P        M SS    +  L Y+  FGG VA+   +++  NG  N F+GWGGEDDDF +R++ + +   R       + +L+HA +     R F N R+   +   +G+N+LK+ +  ++Y   +T + V L
Sbjct:  107 EGGAWEPPQCISQHQVAIVIPYRNRTLQLQIFLSYIHPFLQKQMLNYRIFIIEQGTKGAFNRAKLLNVGYAEALKIFPYHCFIFHDVDLIPQKLSNMYACTHQP------RHMSSSLNTFRYNLPYEQLFGGAVAILQKQFELVNGFSNFFYGWGGEDDDFQSRIINRGMTLCRFPPDVARYTMLSHAKELPSDNR-FLNLRLGRERFETDGVNTLKYTVIKLVYYPLYTWVLVDL 335          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: K1QXQ5 (Beta-1,4-N-acetylgalactosaminyltransferase bre-4 OS=Crassostrea gigas OX=29159 GN=CGI_10028074 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.234e-46
Identity = 94/237 (39.66%), Postives = 133/237 (56.12%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
            GG+++P  C    +VA++IP+R+R  +L+  L  +HP LQ Q LDYGIYV+EQ +   FNR  L+NIGY  S  +Y + C I HDVD +PEND I Y+C++SP        + S+    K KL Y   FGGV A+K   ++K NG  N F+GWGGEDDD   RLV    +  R       + ++ H  DA  K + R     +    +   +G+N+L +K   I Y+  HT I V +
Sbjct:   44 GGLYTPPDCIARERVAIIIPFRDREEHLRILLHNLHPMLQRQQLDYGIYVVEQENGTQFNRAMLMNIGYAESIKLYNYTCFIFHDVDLIPENDRIMYDCRDSP------RHLSSAVDKFKYKLPYPQLFGGVTAIKRAHFEKVNGHSNKFFGWGGEDDDMFRRLVNNGFKISRYQASLSKYKMIKHLHDAGNKANKRRHHLIKTGKGRYRRDGINNLHYKKLGIEYQYLHTRILVSI 274          
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Match: A0A402ESN1 (Uncharacterized protein OS=Paroedura picta OX=143630 GN=parPi_0007084 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 6.765e-46
Identity = 93/220 (42.27%), Postives = 131/220 (59.55%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            GG ++P  CA   KVA++IP+RNR  +LK +L  +HP LQ Q LDYGIYVI Q   E+FNR KLLN+G+  +   Y +NC +  DVD +P +D   Y C + P  L  S+ M+  G  L    Y  YFGGV A+   +++K NG  N++WGWGGEDDD +NRL+LK +R  R         +++H+ D K     + F     +   M+L+GLNSL + +
Sbjct:  103 GGRYTPKDCAALQKVAIIIPFRNRDEHLKYWLYYLHPILQRQQLDYGIYVINQGGEETFNRAKLLNVGFKEALKEYDYNCFVFSDVDLIPMDDRNTYKCYDQPRHL--SVSMDKFGFRLP---YNQYFGGVSALSKEQFEKINGFPNNYWGWGGEDDDIYNRLILKSMRISRPDATIGKCRMIHHSRDNKNEPNPQRFNQIAHTRETMSLDGLNSLSYTV 317          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt1 (beta-1,4-galactosyltransferase 1-like [Source:NCBI gene;Acc:103028729])

HSP 1 Score: 156.762 bits (395), Expect = 6.192e-44
Identity = 87/237 (36.71%), Postives = 136/237 (57.38%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
             GG ++P  C + HKVA++IPYRNR ++LK +L  +HP LQ Q LDYG+YVI+Q+  ++FNR KLLN+GY  +   Y +NC +  DVD +P +D   Y C + P  L  ++ M+  G  L    Y  YFGGV A+   ++ K NG  N++WGWGGEDDD +NRL  + +   R         ++ H  D   + + + F     +   +  +G+N+L + +  +  +KD    K+++
Sbjct:  138 EGGRYTPRECVSPHKVALIIPYRNRENHLKYWLYYLHPILQRQQLDYGVYVIQQDGEDTFNRAKLLNVGYAEALKEYDYNCFVFSDVDLVPVDDRNIYRCFDQPRHL--AVSMDKFGFRLP---YNQYFGGVSAMSKEQFLKINGFPNNYWGWGGEDDDIYNRLTYRGMSVSRPDGVIGRCKMIQHNRDKMNEPNPQRFDRIARTRQTINTDGINTLTYTV--VKTEKDKLFTKIIV 367          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:103022975])

HSP 1 Score: 155.221 bits (391), Expect = 5.898e-43
Identity = 86/223 (38.57%), Postives = 123/223 (55.16%), Query Frame = 3
Query:  390 FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNS-PILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
              GG + P  C   H  A+++PYRNR S+L+  L  +HPFLQ Q + Y IY++ Q+ + +FNR KLLN+G   +     ++CI LHDVD LPEND   Y C    P  L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  +    + ++ H  D   + + R F   + +      +GL+SL ++L
Sbjct:  115 MPGGHYRPPDCEPRHHTAIVVPYRNRQSHLRALLYHLHPFLQRQQIHYSIYIVHQSGNATFNRAKLLNVGVREALKEDSWSCIFLHDVDLLPENDHNTYTCHPQYPTHL--SVAMD---KFRYRLPYPQYFGGVSAVTPDQYLKMNGFPNQYWGWGGEDDDIATRVRLSGMKIVRPPVAIGHYKMIKHKGDQGNEQNPRRFDLLKRTRLNWRSDGLSSLTYEL 332          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3-like [Source:NCBI gene;Acc:103031892])

HSP 1 Score: 151.754 bits (382), Expect = 7.593e-42
Identity = 84/223 (37.67%), Postives = 125/223 (56.05%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS-----FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            GG + P  C   H+ A++IP+RNR ++LK  L  +HPFLQ Q L+Y IYVI Q  + +FNR KL+N+G+  +     +NC+  HDVD +PE+D   Y C  +P     ++ M+  G  L    YK YFGGV A+ P  Y K NG  N++WGWGGEDDD   R+ L  +   R ++K   + ++ H  D         F +    R +     L+G+NS ++++
Sbjct:  116 GGRYRPPDCEARHRTAIIIPHRNRENHLKFLLYYLHPFLQRQQLNYAIYVIHQAGNYTFNRAKLMNVGFREAMREEDWNCLFFHDVDLIPEDDRNTYTCDQNP--KHAAIAMDKFGYKLP---YKMYFGGVSALSPLHYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMVITRPSVKVGRYKMIKHKLDQGNEVNPKRFNMLAKTRQT---WKLDGMNSAEYEV 330          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt1l (beta-1,4-galactosyltransferase 1-like [Source:NCBI gene;Acc:103039461])

HSP 1 Score: 150.214 bits (378), Expect = 1.295e-41
Identity = 87/237 (36.71%), Postives = 128/237 (54.01%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
             GG + P  C    KVA++IP+R R  +LK +L  +HP LQ Q LDYG+Y+I Q+  E+FNR KLLN+GY  +   Y + C +  DVD +P +D   Y C + P  L  S+ M+  G  L    Y  YFGGV ++   ++ K NG  N++WGWGGEDDD  NRL  K +   R +       ++ H  D +     + F     +   M  +G+NSL +K+  +  +KD    K+ +
Sbjct:  120 EGGRFKPKDCIALQKVAIIIPFRKRDEHLKFWLYYLHPILQRQQLDYGVYIINQDGDETFNRAKLLNVGYAEALKEYGYECFVFSDVDLIPMDDRNTYKCFSQPRHL--SVSMDKFGFRLP---YNQYFGGVSSMSKEQFLKINGFPNNYWGWGGEDDDIFNRLSSKGMSISRPSGAIGKCRMIRHDRDKQNDPNPQRFDRIAHTRETMHKDGINSLSYKV--VKVEKDQLFTKITV 349          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Match: b4galt2 (beta-1,4-galactosyltransferase 2 [Source:NCBI gene;Acc:103033307])

HSP 1 Score: 146.747 bits (369), Expect = 3.346e-40
Identity = 78/224 (34.82%), Postives = 127/224 (56.70%), Query Frame = 3
Query:  393 SGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKLNDI 1055
             GG ++P  C    KVA++IP+R+R  +LK +L  +HP L+ Q +DYGIY+I Q   ++FNR KLLN+GY  +     ++C I  DVD +P +D   Y+C + P     ++ M+  G  L    Y  YFGGV  +   ++ K NG  N +WGWGGEDDD +NR+ L  ++  R  ++   + ++ H  D   + + + F   + +   M  +G++SL ++L  +
Sbjct:  140 EGGKYTPTDCRPKQKVAIIIPFRHRDHHLKYWLHYLHPILRRQKIDYGIYIINQLGEDTFNRAKLLNVGYTEALKDAEYDCFIFSDVDLIPMDDRNLYHCYDQPRHF--AIAMDKFGFRLP---YAGYFGGVSGLSKKQFLKINGFPNEYWGWGGEDDDIYNRITLNGMKVSRPDVRIGRYRMIKHERDKHNEPNPQRFNKIQNTKNTMRKDGISSLTYRLASV 358          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: b4galt2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-070912-258])

HSP 1 Score: 157.147 bits (396), Expect = 7.419e-45
Identity = 86/234 (36.75%), Postives = 136/234 (58.12%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            GG + P  C ++ KVA++IP+R+R  +LK +L  +HP LQ Q ++YG+YV+ Q     FNR KL+NIGY+ +    P++C I  DVD +P +D   Y C ++P     S+ M+   K   +  Y SYFGGV  +   +Y K NG  N +WGWGGEDDD +NR+V++ +R  R       + ++ HA DAK     + F   + +   M  +G+N+LK++  + + +  +T + V
Sbjct:  130 GGRFRPKDCLSSQKVAIIIPFRHRDEHLKHWLYYLHPVLQRQRVEYGVYVLNQFGEGMFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHF--SVAMD---KFSFRLPYNSYFGGVSGLSKAQYLKINGFPNEYWGWGGEDDDIYNRVVVQGMRLSRPDGSLGRYRMVKHARDAKNEPNPKRFTQIKNTRHNMGRDGINTLKYRHVETVRQPLYTNVTV 358          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 144.05 bits (362), Expect = 1.229e-40
Identity = 76/220 (34.55%), Postives = 125/220 (56.82%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSN--FQMALNGLNSLKFKL 1046
            GG + P  C  + KVA+++P+R+R  +LK +L  +HP LQ Q ++YG+Y++ Q     FNR KL+NIGY+ +    P++C I  DVD +P +D   Y C ++P     ++      K      YK  FGGV  +   +++K NG  N++WGWGGEDDD +NR+    +   R  +    + ++ H  DA      F +++++   F M  +G+N+L++KL
Sbjct:   56 GGQFHPSDCIPSQKVAIIVPFRHRDEHLKHWLYYLHPILQRQRVEYGVYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHFSVAV-----DKFNFSLPYKECFGGVSGLTKKQFEKINGFPNNYWGWGGEDDDIYNRIRKVGMNISRPDMTIGRYRMIRHNRDAHNENNPFRSWQITKTAFTMWRDGINTLEYKL 270          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 144.05 bits (362), Expect = 1.266e-40
Identity = 83/228 (36.40%), Postives = 125/228 (54.82%), Query Frame = 3
Query:  384 KTFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNF------QMALNGLNSLKFKL 1046
            K   GG + P  C +  KVA++IP+R+R  +LK +L  +HP LQ Q ++YGIY++ Q     FNR KL+NIGY+ +    P++C I  DVD +P +D   Y C ++P     S+ M+  G  L    Y SYFGGV  +   +++K NG  N++WGWGGEDDD + R+ L  +   R + +     ++ H  D        PN +  N        M  +G+NSL++ L
Sbjct:   65 KVQEGGRFRPANCISKQKVAIIIPFRHRDEHLKYWLYYLHPILQRQTIEYGIYIVNQFGEGVFNRAKLMNIGYVEALKDAPYDCFIFSDVDLVPMDDRNLYRCYDNPRHF--SVAMDKFGFHLP---YNSYFGGVSGLSKAQFEKINGFPNNYWGWGGEDDDIYTRVSLAGMHISRPSGEIGRCRMIRHTNDKNNE----PNPQRFNLIQSTRSTMWKDGINSLQYSL 283          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004173.1 (pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 gene:ENSPMAG00000003809.1 transcript:ENSPMAT00000004173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 8.158e-27
Identity = 66/172 (38.37%), Postives = 94/172 (54.65%), Query Frame = 3
Query:  366 SNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNR-VSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNR 878
            + QP      G    P C   H+ AV++P  +R    L+  L+R+H  LQ Q L+Y +YV++Q     F R  LLN+G   + +   F C+++HDVD LPEND   Y C+  P L  K L + +  K   K  Y+SYFGGV A+ P +Y + NG  ++ WG G  DD+  NR
Sbjct:   35 AAQPGGLRRGGHYRPPNCEARHRTAVVVPSGSRDRVRLRVLLRRLHGVLQRQQLEYTVYVVQQVTDGPFYRAWLLNVGVREALSDAEFECLVMHDVDLLPENDRNLYTCE--PQLGPKHLAV-AIDKFRYKLPYESYFGGVAALTPGQYMRINGFPSNHWGRGA-DDEIANR 202          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Match: B4GALT1 (beta-1,4-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:924])

HSP 1 Score: 95.1301 bits (235), Expect = 1.497e-23
Identity = 58/162 (35.80%), Postives = 83/162 (51.23%), Query Frame = 3
Query:  567 FNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
            FNR KL+N+GY+ +    PF+C I  DVD +P +D   Y C   P  L  ++      K   +  Y   FGGV A+   +++  NG  N +WGWGGEDDDF  R V   L   R       + ++ H ADA  + + + F   R +  +M  +GLNSL + L
Sbjct:    5 FNRAKLMNVGYVEALRDAPFDCFIFSDVDLIPLDDRNLYRCGEQPQHLSVAV-----DKFDFRLPYLQSFGGVSALSRAQFKTINGFSNLYWGWGGEDDDFFRRTVASGLHVSRPRAGIGRYTMVKHKADAHNEPNPQRFHLIRRAVSRMKWDGLNSLHYLL 161          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO48920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV5])

HSP 1 Score: 150.984 bits (380), Expect = 1.780e-43
Identity = 82/234 (35.04%), Postives = 125/234 (53.42%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLK--YYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKV 1088
            GG W P  C    KVA+++P+R R   L  F++ +HP L+ QN++Y I ++EQ+    FNR  L NIGY  S     F+C I HDVD +PE+D   Y+C  SP  +  ++      K      Y S FGG  + K  ++++ NG  N FWGWGGEDDD + R+  K     R +L+   Y  +  +H   +K     F   +    +M  +GLN+L +KL ++  +  +T+I +
Sbjct:   19 GGAWKPTECKARTKVALIVPFRKRYEQLGIFVRHMHPMLKRQNVEYRIIIVEQSGDTPFNRAILFNIGYKESLKFNNFDCFIFHDVDLIPEDDRNEYSCPTSPRHMSAAV-----DKFNYHLPYASIFGGAGSFKRKDFEEINGFSNKFWGWGGEDDDLYQRITAKGFHLTRPSLQIGRYKMVRTHHHQSSKADPNRFALLQNPVERMPRDGLNTLAYKLLEVKEESLYTIITI 247          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO37163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGJ5])

HSP 1 Score: 104.375 bits (259), Expect = 1.051e-26
Identity = 64/179 (35.75%), Postives = 92/179 (51.40%), Query Frame = 3
Query:  567 FNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKL-YKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLV---LKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVV 1091
            FNRG L+N+G+  +     ++C I HD+D +PE+D   Y+C +SP        M ++   +K KL YK  FGGV A  P  Y+K NG  N +WGWGGEDDD + R+V   L   RP    +  Y  L   H    K   R     + S   +  +GL+ LK+   D+I   +H L  ++
Sbjct:    3 FNRGMLMNVGFQEAMKADIYDCAIFHDIDLIPEDDRNDYSCPSSP------RHMSTAVDTMKYKLGYKKLFGGVEAFWPEHYRKVNGFPNRYWGWGGEDDDLYVRIVEHSLTLTRPAH-QIGRYTMLKHGHKKSDKNPDR-HAQLQQSQTHLKTDGLSVLKY---DVISSMEHPLYTMI 170          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Match: EDO48803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF8])

HSP 1 Score: 102.834 bits (255), Expect = 2.200e-25
Identity = 54/161 (33.54%), Postives = 89/161 (55.28%), Query Frame = 3
Query:  405 WSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYN-CQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLV 884
            W P     H + V++PYRNR   L  F+  ++ FL  + + + I+++ Q D   FNR  LLN+GYL +     +  I++HDVD LP N  + Y   +  P  +       SS  +  K  Y+++ GG++ +   +++K NG+ N FWGWG EDD+ + R++
Sbjct:   10 WGP-----HVLGVVVPYRNRFEELLEFVPHMNKFLSEKKIRHRIFIMNQVDKHRFNRASLLNVGYLVARNECDY--IVMHDVDLLPLNSKLFYGYPEKGPFHI-------SSPHLHPKYHYRTFVGGILMMTLEQFEKVNGLSNKFWGWGREDDELYQRMM 156          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: si:dkey-199f5.8 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101162708])

HSP 1 Score: 154.836 bits (390), Expect = 3.618e-43
Identity = 87/223 (39.01%), Postives = 126/223 (56.50%), Query Frame = 3
Query:  396 GGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS-----FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            GG + P  C   HK A++IP+RNR  +LK  L  +HPFLQ Q L+YGIY+I Q  + +FNR KL+NIG+  +     ++C+  HDVD +PE+D   Y C  +P     ++ M+  G  L    Y  YFGGV A+ P +Y K NG  N++WGWGGEDDD   R+ L  +   R  LK+  + ++ H  D         F +    R +     L+G+NSL+++L
Sbjct:  116 GGRYRPPDCEARHKTAIIIPHRNREHHLKYLLYFLHPFLQRQQLNYGIYIIHQAGNYTFNRAKLMNIGFREAMREEDWDCLFFHDVDLIPEDDRNTYICDANP--KHAAIAMDKFGYKLP---YNMYFGGVSALSPLQYLKMNGFPNNYWGWGGEDDDIGIRVSLAGMHISRPPLKHGRYKMIKHNLDQGNDVNPKRFNMLAKTRQT---WKLDGMNSLEYEL 330          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 157.147 bits (396), Expect = 3.848e-43
Identity = 86/223 (38.57%), Postives = 124/223 (55.61%), Query Frame = 3
Query:  390 FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNS-PILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
              GG + P  C   H  A+++PYRNR ++L+  L  +HPFLQ Q + Y IY+++Q  + +FNR KLLN+G   +     ++CI LHDVD LPEND   Y C    P+ L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  +    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  180 LPGGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHL--SVAMD---KFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHKGDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYEL 397          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 157.147 bits (396), Expect = 3.848e-43
Identity = 86/223 (38.57%), Postives = 124/223 (55.61%), Query Frame = 3
Query:  390 FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNS-PILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
              GG + P  C   H  A+++PYRNR ++L+  L  +HPFLQ Q + Y IY+++Q  + +FNR KLLN+G   +     ++CI LHDVD LPEND   Y C    P+ L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  +    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  180 LPGGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHL--SVAMD---KFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHKGDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYEL 397          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt3 (beta-1,4-galactosyltransferase 3 [Source:NCBI gene;Acc:101159351])

HSP 1 Score: 157.147 bits (396), Expect = 3.848e-43
Identity = 86/223 (38.57%), Postives = 124/223 (55.61%), Query Frame = 3
Query:  390 FSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNS-PILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA--KYSFRVFPNYRMSNFQMALNGLNSLKFKL 1046
              GG + P  C   H  A+++PYRNR ++L+  L  +HPFLQ Q + Y IY+++Q  + +FNR KLLN+G   +     ++CI LHDVD LPEND   Y C    P+ L  S+ M+   K   +  Y  YFGGV AV P +Y K NG  N +WGWGGEDDD   R+ L  ++  R  +    + ++ H  D   + + R F   + +      +GLNSL ++L
Sbjct:  180 LPGGRYRPPDCEPRHHTAIVVPYRNRQTHLRALLYHLHPFLQRQQIHYSIYIVQQWGNSTFNRAKLLNVGVREALRDEDWSCIFLHDVDLLPENDHNTYTCHKQFPMHL--SVAMD---KFRYRLPYPQYFGGVSAVTPDQYMKMNGFPNQYWGWGGEDDDIAARVRLSGMKIVRPPVAIGHYKMIKHKGDKGNEQNPRRFDLLKRTRLSWRSDGLNSLTYEL 397          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Match: b4galt1l (beta-1,4-galactosyltransferase 1 [Source:NCBI gene;Acc:101171148])

HSP 1 Score: 149.058 bits (375), Expect = 3.128e-41
Identity = 86/232 (37.07%), Postives = 131/232 (56.47%), Query Frame = 3
Query:  360 KSSNQPIRKTFSGGVWSPL-CATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYS--FRVFPNYRMSNFQMALNGLNSLKFKL 1046
            KS N  +++   GG + P  C    KVA++IP+RNR  +LK +L  +HP LQ Q LDYG+YVI Q+   +FNR KLLN+GY  +   Y ++C +  DVD +P +D   Y C + P  L  S+ M+  G  L    Y  +FGGV ++   ++ K NG  N++WGWGGEDDD +NR+V + +   R + +     ++ H  D K     + F     +   M  +G+NSL +++
Sbjct:  115 KSENPNVQQ---GGRFKPKDCLALQKVAIIIPFRNRDEHLKYWLYYLHPILQRQQLDYGVYVINQDGDVTFNRAKLLNVGYTEALKEYDYDCFVFSDVDLIPMDDRNTYKCFSQPRHL--SVSMDKFGFRLP---YNQFFGGVSSLSKEQFLKINGFPNNYWGWGGEDDDIYNRVVSRGMSVSRPSGEVGKCRMIRHNRDKKNEPNPQRFDRINHTKETMNKDGINSLSYQV 338          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000028269.1 (SMESG000028269.1)

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 356/356 (100.00%), Postives = 356/356 (100.00%), Query Frame = 3
Query:   27 MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 1094
            MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL
Sbjct:    1 MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLNDIIYKKDHTLIKVVL 356          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000004802.1 (SMESG000004802.1)

HSP 1 Score: 461.07 bits (1185), Expect = 4.744e-165
Identity = 224/227 (98.68%), Postives = 224/227 (98.68%), Query Frame = 3
Query:   27 MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPIL 707
            MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNC   PIL
Sbjct:    1 MYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVTKIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIPKHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCHTRPIL 227          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000072173.1 (SMESG000072173.1)

HSP 1 Score: 157.532 bits (397), Expect = 6.432e-44
Identity = 86/225 (38.22%), Postives = 125/225 (55.56%), Query Frame = 3
Query:  387 TFSGGVWSPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA---KYSFRVFPNYRMSNFQMALNGLNSLKFKLND 1052
            T S G WSP C    +VA++IPYRNRV+++K  +  +H  LQ Q  DYGI+V+EQ    SFNR  L NIG+  S   Y FNC + HDVD +PEND   Y C + PI L   +      K   K  Y+  FGGV A+    ++  NG  N ++GWGGEDDD   RL  +  +  R       + ++ H +D+     ++R F   + +  +M  +GLNSL++++ +
Sbjct:  131 TVSKGHWSPDCKAKQRVAIIIPYRNRVNHIKVLINNLHYLLQRQERDYGIFVVEQMPGTSFNRAMLFNIGFRESLKWYDFNCFVFHDVDLIPENDHNLYQCGHDPIHLSAYI-----DKFSYKLPYEDLFGGVSAINIKLFRSVNGFSNFYFGWGGEDDDMSKRLRYQGCKIFRYPNMVGAYKMIKHRSDSGNPANTWR-FALVKTATIRMQKDGLNSLEYEVEE 349          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000071011.1 (SMESG000071011.1)

HSP 1 Score: 136.346 bits (342), Expect = 1.314e-37
Identity = 78/226 (34.51%), Postives = 124/226 (54.87%), Query Frame = 3
Query:  396 GGVW-SPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYLFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRL--VLKYLRPKRITLKYYIFLVLNHAADAKYSFRVFPNYR------MSNFQMALNGLNSLKFKL 1046
            GG W    C T++ +A++IP+R R       L  +H  LQ QN+ Y I++IEQ  SE+FN+G++ N G+L   +++ FNC+I HD D +PE+  I Y C ++  L + S  ++ +  +L    Y +  GGV+A +P +Y   NG  N++WGWG EDDD   RL   + Y   KRI      +  + H    ++  +   N R       +  +M  +GLNSLK+++
Sbjct:   18 GGYWVQSKCITDNMIAIIIPFRGRWLQTMELLPVLHQILQQQNVCYRIFIIEQLGSEAFNKGRVNNAGFLEIISMFSFNCVIFHDTDLIPESSKIPYKCHDTGALHIASA-VDVNNYVLP---YSTLIGGVIAFRPFQYLSVNGYSNYYWGWGLEDDDMEIRLKNTIGY---KRIPENVGRYKTMKHEPTTRFKIQ---NLRRNVLLTTAEKRMFTDGLNSLKYEI 233          
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Match: SMESG000064462.1 (SMESG000064462.1)

HSP 1 Score: 138.272 bits (347), Expect = 2.134e-37
Identity = 74/190 (38.95%), Postives = 103/190 (54.21%), Query Frame = 3
Query:  399 GVW-SPLCATNHKVAVLIPYRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGY--LFSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILKKKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRPKRITLKYYIFLVLNHAADA 959
            G W  P C    KVA++IPYRNR  +L  FL+ +HPFLQ Q + YGI+VIEQ     FNR  L N+GY       +  F+C I HDVD LP N+   Y C  +P+ +  ++      K   K  Y + FGG VA+   ++ K NG  N F+GWGGEDDD  +R+        R       ++++ H +D+
Sbjct:  108 GKWLPPNCLPTEKVAIIIPYRNREKHLNIFLKHMHPFLQKQLISYGIFVIEQAPGTRFNRAALFNVGYQEALKDQLIQFDCFIFHDVDLLPTNENNLYKCGKNPMHMSVAI-----DKFNYKLPYNAIFGGAVALNKEQFVKVNGFSNIFYGWGGEDDDMSSRISAVKYSIARYPDSVARYVMIRHTSDS 292          
The following BLAST results are available for this feature:
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4GALT46.074e-4442.33beta-1,4-galactosyltransferase 4 [Source:HGNC Symb... [more]
B4GALT41.778e-4342.33beta-1,4-galactosyltransferase 4 [Source:HGNC Symb... [more]
B4GALT41.778e-4342.33beta-1,4-galactosyltransferase 4 [Source:HGNC Symb... [more]
B4GALT41.778e-4342.33beta-1,4-galactosyltransferase 4 [Source:HGNC Symb... [more]
B4GALT15.129e-4238.89beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bre-47.218e-4435.40Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
bre-47.218e-4435.40Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
bre-45.253e-3534.72Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
bre-45.253e-3534.72Beta-1,4-N-acetylgalactosaminyltransferase bre-4 ... [more]
W02B12.112.237e-3335.02N-acetyllactosamine synthase [Source:UniProtKB/Tr... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
beta4GalNAcTA3.900e-4136.94gene:FBgn0027538 transcript:FBtr0087539[more]
beta4GalNAcTB4.507e-3728.49gene:FBgn0039625 transcript:FBtr0085419[more]
beta4GalT74.629e-2335.93gene:FBgn0039258 transcript:FBtr0084755[more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt33.439e-4539.91UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt33.439e-4539.91UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt34.279e-4539.91UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt12.391e-4347.83UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
b4galt1l1.876e-4237.29DP-Gal:betaGlcNAc beta 1,4- galactosyltransferase,... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt1.14.647e-4440.97UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
ranbp28.245e-4439.46RAN binding protein 2 [Source:Xenbase;Acc:XB-GENE-... [more]
B4GALT41.598e-4340.91UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
fbln25.891e-4237.34fibulin 2 [Source:Xenbase;Acc:XB-GENE-959371][more]
nkx6-31.652e-4137.87NK6 homeobox 3 [Source:Xenbase;Acc:XB-GENE-478609][more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B4galt12.258e-4440.43UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt41.998e-4340.85UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
B4galt41.998e-4340.85UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
B4galt17.737e-4046.63UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4galt61.438e-3838.71UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80WN7|B4GT4_CRIGR3.977e-4440.25Beta-1,4-galactosyltransferase 4 OS=Cricetulus gri... [more]
sp|P15535|B4GT1_MOUSE1.580e-4340.43Beta-1,4-galactosyltransferase 1 OS=Mus musculus O... [more]
sp|Q66HH1|B4GT4_RAT3.251e-4342.25Beta-1,4-galactosyltransferase 4 OS=Rattus norvegi... [more]
sp|O60513|B4GT4_HUMAN8.538e-4342.33Beta-1,4-galactosyltransferase 4 OS=Homo sapiens O... [more]
sp|Q9GUM2|BRE4_CAEEL9.181e-4335.40Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QAT53.086e-4841.10Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
R7UWK75.247e-4739.50Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A067R2D37.389e-4738.56Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
K1QXQ56.234e-4639.66Beta-1,4-N-acetylgalactosaminyltransferase bre-4 O... [more]
A0A402ESN16.765e-4642.27Uncharacterized protein OS=Paroedura picta OX=1436... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt16.192e-4436.71beta-1,4-galactosyltransferase 1-like [Source:NCBI... [more]
b4galt35.898e-4338.57beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
si:dkey-199f5.87.593e-4237.67beta-1,4-galactosyltransferase 3-like [Source:NCBI... [more]
b4galt1l1.295e-4136.71beta-1,4-galactosyltransferase 1-like [Source:NCBI... [more]
b4galt23.346e-4034.82beta-1,4-galactosyltransferase 2 [Source:NCBI gene... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b4galt27.419e-4536.75UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase... [more]
B4GALT11.229e-4034.55beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
B4GALT11.266e-4036.40beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
ENSPMAT00000004173.18.158e-2738.37pep scaffold:Pmarinus_7.0:GL478483:39914:44753:1 g... [more]
B4GALT11.497e-2335.80beta-1,4-galactosyltransferase 1 [Source:HGNC Symb... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO489201.780e-4335.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371631.051e-2635.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488032.200e-2533.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-199f5.83.618e-4339.01beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt33.848e-4338.57beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt33.848e-4338.57beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt33.848e-4338.57beta-1,4-galactosyltransferase 3 [Source:NCBI gene... [more]
b4galt1l3.128e-4137.07beta-1,4-galactosyltransferase 1 [Source:NCBI gene... [more]
back to top
BLAST of Beta-1,4-galactosyltransferase 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028269.10.000e+0100.00SMESG000028269.1[more]
SMESG000004802.14.744e-16598.68SMESG000004802.1[more]
SMESG000072173.16.432e-4438.22SMESG000072173.1[more]
SMESG000071011.11.314e-3734.51SMESG000071011.1[more]
SMESG000064462.12.134e-3738.95SMESG000064462.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013547 ID=SMED30013547|Name=Beta-1,4-galactosyltransferase 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1123bp
TTTCAGTATTGAGCTCTGTATTTATCATGTATTTATCAAACTATGCAATA
TTTATCGGTTTTATAAATTTATACATATTTTTGATTATAGCATCAATATA
TAATTTAAAATATGAAAACATCAATTCCAAAAGCAAACCAAAACCGGTTA
CGAAAATTCCATGGATAACTGAAAGTCATGAAAATAATCAAACGTATTCT
CTTAAAATGCAAACACTTTTAGTCAATAATCCATTTGTCGTTTTTAAAAA
AGTTCCATTGTCCTTGACTAATTACAGTCGCTTAAATTTCTTCGACATTC
CGAAACACTTTCAAATAAGAAAGCATAAATTTTTAACAAACGATGAAGCA
TGCTTTCGGAAATCTTCCAATCAACCAATCAGAAAAACATTTTCTGGAGG
AGTTTGGAGTCCATTGTGCGCAACCAATCACAAAGTAGCAGTATTAATTC
CTTATCGAAATAGAGTTTCCAATTTGAAAAGGTTTTTACAAAGAATCCAT
CCATTTTTGCAGAGTCAAAACCTCGATTATGGGATATATGTCATTGAACA
AAATGATTCAGAATCATTCAACCGAGGAAAATTGTTAAATATCGGTTACT
TATTTTCCACAACTATTTATCCATTTAATTGCATTATTTTGCACGATGTT
GATAAATTACCGGAAAATGATATGATTAGATATAACTGTCAAAACTCGCC
TATTCTGCTAATGAAATCATTACGCATGGAGAGTTCTGGAAAAATTTTGA
AGAAAAAACTATATAAATCGTATTTCGGCGGTGTGGTGGCTGTCAAACCG
ACTGAATATCAAAAGGCAAATGGAATGGTAAATCATTTTTGGGGATGGGG
AGGAGAAGATGATGATTTTCATAATCGTCTAGTATTAAAATATTTGCGTC
CAAAAAGAATAACATTAAAATATTATATATTTTTAGTATTAAATCACGCG
GCAGATGCTAAATATAGTTTCCGTGTTTTCCCTAACTATCGTATGTCTAA
TTTTCAGATGGCTCTAAACGGACTAAATAGCTTAAAGTTCAAATTGAACG
ATATTATATATAAAAAGGACCACACATTAATTAAAGTTGTTTTGTAAATT
TATTACTTAATGTTAATTATGCT
back to top

protein sequence of SMED30013547-orf-1

>SMED30013547-orf-1 ID=SMED30013547-orf-1|Name=SMED30013547-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
SVLSSVFIMYLSNYAIFIGFINLYIFLIIASIYNLKYENINSKSKPKPVT
KIPWITESHENNQTYSLKMQTLLVNNPFVVFKKVPLSLTNYSRLNFFDIP
KHFQIRKHKFLTNDEACFRKSSNQPIRKTFSGGVWSPLCATNHKVAVLIP
YRNRVSNLKRFLQRIHPFLQSQNLDYGIYVIEQNDSESFNRGKLLNIGYL
FSTTIYPFNCIILHDVDKLPENDMIRYNCQNSPILLMKSLRMESSGKILK
KKLYKSYFGGVVAVKPTEYQKANGMVNHFWGWGGEDDDFHNRLVLKYLRP
KRITLKYYIFLVLNHAADAKYSFRVFPNYRMSNFQMALNGLNSLKFKLND
IIYKKDHTLIKVVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR003859Galactosyl_T
IPR029044Nucleotide-diphossugar_trans
IPR027995Galactosyl_T_N
IPR027791Galactosyl_T_C
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0002064epithelial cell development
GO:0002526acute inflammatory response
GO:0005989lactose biosynthetic process
GO:0006012galactose metabolic process
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
GO:0007155cell adhesion
GO:0007339binding of sperm to zona pellucida
GO:0007341penetration of zona pellucida
GO:0008285negative regulation of cell proliferation
GO:0009101glycoprotein biosynthetic process
GO:0009312oligosaccharide biosynthetic process
GO:0030198extracellular matrix organization
GO:0030879mammary gland development
GO:0042060wound healing
GO:0042127regulation of cell proliferation
GO:0043065positive regulation of apoptotic process
GO:0045136development of secondary sexual characteristics
GO:0048754branching morphogenesis of an epithelial tube
GO:0050900leukocyte migration
GO:0051270regulation of cellular component movement
GO:0060046regulation of acrosome reaction
GO:0060054positive regulation of epithelial cell proliferation involved in wound healing
GO:0060055angiogenesis involved in wound healing
GO:0060058positive regulation of apoptotic process involved in mammary gland involution
Vocabulary: molecular function
TermDefinition
GO:0016757transferase activity, transferring glycosyl groups
GO:0003831beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase activity
GO:0003945N-acetyllactosamine synthase activity
GO:0004461lactose synthase activity
GO:0005515protein binding
GO:0008092cytoskeletal protein binding
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0030145manganese ion binding
GO:0035250UDP-galactosyltransferase activity
GO:0042803protein homodimerization activity
GO:0043014alpha-tubulin binding
GO:0046872metal ion binding
GO:0048487beta-tubulin binding
Vocabulary: cellular component
TermDefinition
GO:0000138Golgi trans cisterna
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0009897external side of plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0016323basolateral plasma membrane
GO:0030057desmosome
GO:0030112glycocalyx
GO:0030175filopodium
GO:0031526brush border membrane
GO:0032580Golgi cisterna membrane
GO:0042995cell projection
GO:0070062extracellular exosome