Gamma-aminobutyric acid receptor subunit alpha-6

Overview
NameGamma-aminobutyric acid receptor subunit alpha-6
Smed IDSMED30013546
Length (bp)1044
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid receptor subunit alpha-6 (SMED30013546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit alpha-6 (SMED30013546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013546SMESG000018336.1 SmedASXL_011827SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013546SMESG000018336.1 dd_Smed_v6_24908_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Match: GABRG1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:HGNC Symbol;Acc:HGNC:4086])

HSP 1 Score: 166.777 bits (421), Expect = 6.714e-47
Identity = 100/270 (37.04%), Postives = 146/270 (54.07%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRS-TKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQI---------YNLVNGSEPDDPWLP-RKVDV-DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY  +++ YKW + P+  V       L QF  + +  S   T  I   G++ I+ + F L R +GYF IQ Y+PC L V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A ++++ T+HYFT    G             ++  G  P    +P   + V  +D+    CL  ++C  + C  +D +  + R     R    +++ID  SRI FP AF  FNL YWV YLY+
Sbjct:  202 CPLEFSSYGYPKNEIEYKW-KKPSVEVADPKYWRLYQFAFVGLRNSTEITHTI--SGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNQKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFEDCRTGSWR---EGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL 465          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Match: GABRA5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:HGNC Symbol;Acc:HGNC:4079])

HSP 1 Score: 164.466 bits (415), Expect = 4.782e-46
Identity = 99/264 (37.50%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRKVDVDDDER---PNHCLRECWHCMTQD-----MKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+   G +        +  +  L +  +     +   P +  +E     T +     +K    + S + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Match: GABRA5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:HGNC Symbol;Acc:HGNC:4079])

HSP 1 Score: 164.466 bits (415), Expect = 4.782e-46
Identity = 99/264 (37.50%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRKVDVDDDER---PNHCLRECWHCMTQD-----MKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+   G +        +  +  L +  +     +   P +  +E     T +     +K    + S + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Match: GABRA5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:HGNC Symbol;Acc:HGNC:4079])

HSP 1 Score: 164.466 bits (415), Expect = 4.782e-46
Identity = 99/264 (37.50%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRKVDVDDDER---PNHCLRECWHCMTQD-----MKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+   G +        +  +  L +  +     +   P +  +E     T +     +K    + S + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Match: GABRG2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:HGNC Symbol;Acc:HGNC:4087])

HSP 1 Score: 160.614 bits (405), Expect = 1.885e-45
Identity = 91/271 (33.58%), Postives = 147/271 (54.24%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPG-RGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYF-TKQGYGDQIYNLVNGSEPDDPWLPRKVDVD----------DDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
             C   F  YGY   +++Y+W +S   SVE  +  +   +    +    +T+++    G++ +++V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ + ++++ T+HYF + +              P     PR   +           D+E    CL  ++C  + C  +D +    R  H   ++  ++++D  +RI FP AF  FNL YWV YLY+
Sbjct:  108 SCPLEFSSYGYPREEIVYQWKRS---SVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWR--HGRIHIR-IAKMDSYARIFFPTAFCLFNLVYWVSYLYL 372          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Match: lgc-37 (Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL;Acc:G5ECN1])

HSP 1 Score: 145.591 bits (366), Expect = 2.612e-39
Identity = 96/312 (30.77%), Postives = 161/312 (51.60%), Query Frame = 1
Query:  202 HLEKRYT---KCK*YFKQY--------------GYNNHDLLYKWTQSPNRSVEHDNEL--TLSQFHLMNISESRS--TKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNL----------------VNGSEPDDPWLPRKVDVDDDERPNHCL----RECWH------CMTQDMKYKTIRISHTDRN---VNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            H+ +R T   +C+ + K++              GY + D++YKW     + VE D ++  TLSQ+ ++++S+S    +       N S+L V F L+R  GY+++Q Y PC L+V++SWV FWIN+EA+  R++LG+ TVL+M+      R DLPKVS++TALD+Y+  C+ F+ A ++++A ++Y        QI++L                + G+   D      + V+ +E     +    + C+        M   M  K      T RN      V++ID  S++ FP  +I FN+ YWV YL++
Sbjct:  161 HVSQRLTIRSRCQMFLKKFPMDTQACPIEVGSLGYFSKDVVYKW-----KDVELDAKMGNTLSQYQVLSLSKSERNVSDFRFSDRNISVLNVYFKLQRQQGYYILQIYTPCTLVVVMSWVSFWINKEASPARVSLGIMTVLSMSTIGFGLRTDLPKVSHSTALDVYILTCFVFLFAAMVEYAVINYAQIVYIRKQIHDLKGLEQNTAMGQMFTAGLMGARRRDTIQVDDLTVEKEEARLKAVPWWKKLCFKDEQGNTSMFYRMAVKAAIAKKTLRNGDPAEVVNKIDNFSKLAFPTLYIIFNVFYWVAYLHL 467          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502743:-1 gene:WBGene00000233.1 transcript:R11G10.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 141.739 bits (356), Expect = 6.268e-38
Identity = 83/255 (32.55%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  238 FKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT-KQGYGDQIYNLVNGSE-------PDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYY 978
               Y Y   D+ Y W +     ++     +L  F L N S +  T      G++S L     L+R   Y+++Q Y+P C+LVI+SWV FWI+R A   R+TLGVTT+LTM   S      LP V+Y  A+D+++  C TFI   +++FA V Y   KQ    +       +E        +D W+PR  +V + ER    +R          K+   +    D++     R D ISR++FP+ F+ FN++YW +Y
Sbjct:  222 LASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQLTNTSTTYCTSKT-NTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANKQDANKRARTEREKAELPFLQNSHNDVWVPR--EVAEQEREVMTVRMNRRQTNSVWKWIKTKTEWNDKS----KRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13502582:-1 gene:WBGene00000233.1 transcript:R11G10.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 141.739 bits (356), Expect = 6.268e-38
Identity = 83/255 (32.55%), Postives = 127/255 (49.80%), Query Frame = 1
Query:  238 FKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT-KQGYGDQIYNLVNGSE-------PDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYY 978
               Y Y   D+ Y W +     ++     +L  F L N S +  T      G++S L     L+R   Y+++Q Y+P C+LVI+SWV FWI+R A   R+TLGVTT+LTM   S      LP V+Y  A+D+++  C TFI   +++FA V Y   KQ    +       +E        +D W+PR  +V + ER    +R          K+   +    D++     R D ISR++FP+ F+ FN++YW +Y
Sbjct:  222 LASYAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQLTNTSTTYCTSKT-NTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANKQDANKRARTEREKAELPFLQNSHNDVWVPR--EVAEQEREVMTVRMNRRQTNSVWKWIKTKTEWNDKS----KRADLISRVMFPVLFLTFNISYWTHY 469          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Match: avr-15 (pep chromosome:WBcel235:V:13498786:13511718:-1 gene:WBGene00000233.1 transcript:R11G10.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:avr-15)

HSP 1 Score: 140.584 bits (353), Expect = 8.014e-37
Identity = 83/252 (32.94%), Postives = 127/252 (50.40%), Query Frame = 1
Query:  247 YGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT-KQGYGDQIYNLVNGSE-------PDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYY 978
            Y Y   D+ Y W +     ++     +L  F L N S +  T      G++S L     L+R   Y+++Q Y+P C+LVI+SWV FWI+R A   R+TLGVTT+LTM   S      LP V+Y  A+D+++  C TFI   +++FA V Y   KQ    +       +E        +D W+PR  +V + ER    +R          K+   +    D++     R D ISR++FP+ F+ FN++YW +Y
Sbjct:  404 YAYTTKDIEYVWKEETPVQLKAGLSSSLPSFQLTNTSTTYCTSKT-NTGSYSCLRTIIQLRRQFSYYLLQLYIPSCMLVIVSWVSFWIDRTAVPARVTLGVTTLLTMTTQSSGINAKLPPVAYIKAIDVWIGACMTFIFCALLEFAWVTYIANKQDANKRARTEREKAELPFLQNSHNDVWVPR--EVAEQEREVMTVRMNRRQTNSVWKWIKTKTEWNDKS----KRADLISRVMFPVLFLTFNISYWTHY 648          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 131.339 bits (329), Expect = 1.055e-35
Identity = 82/257 (31.91%), Postives = 125/257 (48.64%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKW--TQSPNRS--VEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLY 984
            CK   + Y Y+  ++ YKW  ++ PN S  V+ D  + LS +    I + R T      G +S L V FI  R+ G++ +Q + P  L+V++SW+ FWINR++   R  +G  TVLT         + LP V+Y  A+D+++  CY  +   +I++A V Y  K+    +        +P  P      D+  D R    L EC  C         + I  ++R   S S ID +SR  FPL FI FN  +W+  LY
Sbjct:   13 CKLEIESYAYSTAEIEYKWCTSKEPNCSTAVKADANIELSSYKFTKICQKR-TLASTSSGTYSRLRVSFIFDRDSGFYFLQIFFPASLVVVLSWISFWINRDSAPSRTLIGTMTVLTETHLMTGTNRRLPPVAYVKAVDVFLGFCYLLVILALIEYACVAYSKKKNEDRRRREKKTEHKPAPP----TPDILHDVR----LAEC-TCNAAPTSIIAV-IKQSNRFCVSHSHIDIVSRAAFPLVFILFNTLFWLILLY 258          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301233)

HSP 1 Score: 158.688 bits (400), Expect = 6.184e-44
Identity = 79/165 (47.88%), Postives = 116/165 (70.30%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGD 720
            C      YGY N  L+Y+W ++ + +V     +TL+QF L+++   R+   +   G+FS+L V F LKR+ GYF+IQ Y+PC L+V++SWV FWI+REATSDR++L VT+VLT++  S+D+R DLPKV YATALD ++   + +  AT+++FA VHYFTK G G+
Sbjct:  145 CPLVIGSYGYINQQLIYEW-KNQDDAVSFVPGMTLNQFDLISMMH-RNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSGE 307          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Match: CG8916 (gene:FBgn0030707 transcript:FBtr0301232)

HSP 1 Score: 159.073 bits (401), Expect = 1.615e-43
Identity = 79/165 (47.88%), Postives = 116/165 (70.30%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGD 720
            C      YGY N  L+Y+W ++ + +V     +TL+QF L+++   R+   +   G+FS+L V F LKR+ GYF+IQ Y+PC L+V++SWV FWI+REATSDR++L VT+VLT++  S+D+R DLPKV YATALD ++   + +  AT+++FA VHYFTK G G+
Sbjct:  247 CPLVIGSYGYINQQLIYEW-KNQDDAVSFVPGMTLNQFDLISMMH-RNFTTVRREGDFSVLHVAFNLKRHTGYFLIQVYVPCILIVVLSWVSFWIHREATSDRVSLCVTSVLTLSTISLDSRTDLPKVKYATALDWFLLMSFLYCIATLLEFAGVHYFTKLGSGE 409          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335418)

HSP 1 Score: 143.665 bits (361), Expect = 1.140e-38
Identity = 93/294 (31.63%), Postives = 136/294 (46.26%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQS-PNRSVE--HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG---------------------DQIYNLVNGSE------------PDDPWLPRK-----VDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLY 984
            C      YG+  +DL++ W +  P + V+  H    TL +F L +   S++       G +S L V+ + KR   Y++IQ Y+PCC+LVI+SWV FW+++ A   R++LGVTT+LTMA  +      LP VSY  A+D++   C TF+   +++FA V+Y ++ G                       D   +L++               P DP    K     V +   +RPN C              KT       R  +   RID ISRI FPL F  FNL YW  YL+
Sbjct:  178 CSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKF-LTDYCNSKTNT-----GEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCC--------------KTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYWSTYLF 451          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Match: GluClalpha (gene:FBgn0024963 transcript:FBtr0335421)

HSP 1 Score: 143.665 bits (361), Expect = 1.145e-38
Identity = 93/294 (31.63%), Postives = 136/294 (46.26%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQS-PNRSVE--HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG---------------------DQIYNLVNGSE------------PDDPWLPRK-----VDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLY 984
            C      YG+  +DL++ W +  P + V+  H    TL +F L +   S++       G +S L V+ + KR   Y++IQ Y+PCC+LVI+SWV FW+++ A   R++LGVTT+LTMA  +      LP VSY  A+D++   C TF+   +++FA V+Y ++ G                       D   +L++               P DP    K     V +   +RPN C              KT       R  +   RID ISRI FPL F  FNL YW  YL+
Sbjct:  177 CSLRMASYGWTTNDLVFLWKEGDPVQVVKNLHLPRFTLEKF-LTDYCNSKTNT-----GEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVSWVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGALLEFALVNYASRSGSNKANMHKENMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHPGDPLALEKRLQCEVHMQAPKRPNCC--------------KTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNLVYWSTYLF 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Match: Grd (gene:FBgn0001134 transcript:FBtr0075139)

HSP 1 Score: 146.362 bits (368), Expect = 1.216e-38
Identity = 66/109 (60.55%), Postives = 86/109 (78.90%), Query Frame = 1
Query:  394 NFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGD 720
             +S+L V F L+R++G F+IQ Y PCCLLV++SWV FW+NREAT+DR++LG+TTVLTM F  ++ R DLPKVSY TALD +V   + FI ATI+QFA VHY+TK G G+
Sbjct:  377 EYSMLMVNFHLQRHMGNFLIQVYGPCCLLVVLSWVSFWLNREATADRVSLGITTVLTMTFLGLEARTDLPKVSYPTALDFFVFLSFGFIFATILQFAVVHYYTKYGSGE 485          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: gabra5 (gamma-aminobutyric acid (GABA) A receptor, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-081104-30])

HSP 1 Score: 168.703 bits (426), Expect = 6.078e-48
Identity = 101/267 (37.83%), Postives = 149/267 (55.81%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHT--------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++YKWT+ P +SV    E + L+Q+HL+    + +  I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P      +K  +   ++PN+        + +D    TI  S T               +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPISEVVYKWTKGPGKSVVVAEEGSRLNQYHLIG-HTAGTEDISTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKALEAQQPK-----KKDPLALSKKPNNFTAN----INKDAAISTISNSTTVQLKSAEAKPAPDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 443          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: gabra5 (gamma-aminobutyric acid (GABA) A receptor, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-081104-30])

HSP 1 Score: 168.703 bits (426), Expect = 6.078e-48
Identity = 101/267 (37.83%), Postives = 149/267 (55.81%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHT--------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++YKWT+ P +SV    E + L+Q+HL+    + +  I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P      +K  +   ++PN+        + +D    TI  S T               +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPISEVVYKWTKGPGKSVVVAEEGSRLNQYHLIG-HTAGTEDISTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKALEAQQPK-----KKDPLALSKKPNNFTAN----INKDAAISTISNSTTVQLKSAEAKPAPDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 443          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: BX664715.1 (gamma-aminobutyric acid (GABA) A receptor, alpha 5 [Source:NCBI gene;Acc:799124])

HSP 1 Score: 168.703 bits (426), Expect = 7.149e-48
Identity = 101/267 (37.83%), Postives = 150/267 (56.18%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHT--------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++YKWT+ P +SV    E + L+Q+HL+  + + +  I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P      +K  +   ++PN+        + +D    TI  S T               +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  189 CPLKFGSYAYPISEVVYKWTKGPGKSVVVAEEGSRLNQYHLIGHT-AGTEDISTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKALEAQQPK-----KKDPLALSKKPNNFTAN----INKDAAISTISNSTTVQLKSAEAKPAPDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 445          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: gabra2a (gamma-aminobutyric acid type A receptor alpha2 subunit a [Source:ZFIN;Acc:ZDB-GENE-141216-16])

HSP 1 Score: 161.384 bits (407), Expect = 2.827e-45
Identity = 101/277 (36.46%), Postives = 147/277 (53.07%), Query Frame = 1
Query:  184 QTNLVRHLEK---RYTKCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDE-------RPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            Q     HLE     +  C   F  Y Y   ++ Y WT++   SVE   + + L+Q+ LM  +  + T I    G ++++   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+     ++VN  + +   + +                 +  L       T +          T +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  163 QAECPMHLEDFPMDFHSCPLKFGSYAYTLTEVTYVWTRNATLSVEVAPDGSRLNQYDLMGQTVGKET-IKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSIVNDKKKETSVMKKNNAYAVAVANYAPHIAKDSALPTVSKSATPEPSKAQPVAKETKKTFNSVSKIDRMSRIIFPVLFGSFNLVYWATYL 438          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: gabrg2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:ZFIN;Acc:ZDB-GENE-091118-65])

HSP 1 Score: 160.229 bits (404), Expect = 1.319e-44
Identity = 99/273 (36.26%), Postives = 145/273 (53.11%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDN--ELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT--KQGYGDQIYNLVNGSEPDDPWLPRKVDV-----------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++YKW +S   SVE  +     L QF  + +  + S  +    G++ +L V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A +I++ T+HYF   ++          N   P     PR                D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  +RI FP AF  FN+ YW  YLY+
Sbjct:  204 CPLEFSSYGYPKEEIVYKWKRS---SVEVGDIRSWRLYQFSFVGLRNT-SEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKPSKKSDKKKKNPQAPTVDIRPRSATAIQMNNATQMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWR--HGRLHIR-VAKIDSYARIFFPTAFGLFNVVYWFSYLYL 469          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 161.77 bits (408), Expect = 4.165e-45
Identity = 97/279 (34.77%), Postives = 149/279 (53.41%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDN--ELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQ---------GYGDQIYNLVNGSEPDDPWLPRKVDVD----------DDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++Y+W +S   SVE  +     L QF  + +  + + ++    G++ ++ V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A ++++ T+HYF               + +  + +   P     PR   +           D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  SRI FP AF  FNL YWV YLY+
Sbjct:  192 CPLEFSSYGYPKEEIIYQWKRS---SVEVGDVRSWRLYQFSFVGLRNT-TEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFVSNRKPSKDKEKKKKNPLLWMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWR--HGRIHIR-VAKIDSYSRIFFPTAFCLFNLVYWVSYLYL 463          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-1009286])

HSP 1 Score: 160.999 bits (406), Expect = 4.695e-45
Identity = 99/265 (37.36%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRK--------VDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +L Y+WT   ++SV   ++   L+Q+HL  I ++  T+ I    G ++++   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +   G +        + +   L RK        +    +   +       +  +  MK    + + + +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  158 CPLKFGSYAYPNSELRYEWTNITDKSVVVAEDGSRLNQYHL--IGQTVGTENISTSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKALEAAKIKKKEQESLGRKPINSYSGRIPYTPNMSKDLTSSVIANAASIHMKTTEEKCAESKKTYNSVSKIDKMSRIVFPVMFGTFNLVYWATYL 420          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 161.384 bits (407), Expect = 4.749e-45
Identity = 97/279 (34.77%), Postives = 149/279 (53.41%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDN--ELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQ---------GYGDQIYNLVNGSEPDDPWLPRKVDVD----------DDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++Y+W +S   SVE  +     L QF  + +  + + ++    G++ ++ V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A ++++ T+HYF               + +  + +   P     PR   +           D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  SRI FP AF  FNL YWV YLY+
Sbjct:  176 CPLEFSSYGYPKEEIIYQWKRS---SVEVGDVRSWRLYQFSFVGLRNT-TEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFVSNRKPSKDKEKKKKNPLLWMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWR--HGRIHIR-VAKIDSYSRIFFPTAFCLFNLVYWVSYLYL 447          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Match: GABRG2 (gamma-aminobutyric acid (GABA) A receptor, gamma 2 [Source:NCBI gene;Acc:779514])

HSP 1 Score: 162.155 bits (409), Expect = 5.110e-45
Identity = 97/271 (35.79%), Postives = 148/271 (54.61%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT--LSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYF-TKQGYGDQIYNLVNGSEPDDPWLPRKVDVD----------DDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++Y+W +S   SVE  +  +  L QF  + +  + + ++    G++ ++ V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A ++++ T+HYF + +              P     PR   +           D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  SRI FP AF  FNL YWV YLY+
Sbjct:  234 CPLEFSSYGYPKEEIIYQWKRS---SVEVGDVRSWRLYQFSFVGLRNT-TEEVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFVSNRKPSKDKEKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCFEDCRTGAWR--HGRIHIR-VAKIDSYSRIFFPTAFCLFNLVYWVSYLYL 497          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Match: rhbg (Rh family B glycoprotein (gene/pseudogene) [Source:Xenbase;Acc:XB-GENE-1009286])

HSP 1 Score: 161.384 bits (407), Expect = 5.182e-45
Identity = 99/265 (37.36%), Postives = 148/265 (55.85%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRK--------VDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +L Y+WT   ++SV   ++   L+Q+HL  I ++  T+ I    G ++++   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +   G +        + +   L RK        +    +   +       +  +  MK    + + + +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  166 CPLKFGSYAYPNSELRYEWTNITDKSVVVAEDGSRLNQYHL--IGQTVGTENISTSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKALEAAKIKKKEQESLGRKPINSYSGRIPYTPNMSKDLTSSVIANAASIHMKTTEEKCAESKKTYNSVSKIDKMSRIVFPVMFGTFNLVYWATYL 428          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Match: Gabra5 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 [Source:MGI Symbol;Acc:MGI:95617])

HSP 1 Score: 164.081 bits (414), Expect = 4.664e-46
Identity = 101/275 (36.73%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG-----------------DQIYN-----LVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+                  + I N        G     P +P+       E+P        +  T  +K    + + + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKERELILNKSTNAFTTGKLTHPPNIPK-------EQPPAGTA---NAPTVSIKASEEKTAESKKTYNSISKIDKMSRIVFPILFGTFNLVYWATYL 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Match: Gabra5 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 [Source:MGI Symbol;Acc:MGI:95617])

HSP 1 Score: 164.081 bits (414), Expect = 4.664e-46
Identity = 101/275 (36.73%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG-----------------DQIYN-----LVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+                  + I N        G     P +P+       E+P        +  T  +K    + + + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKERELILNKSTNAFTTGKLTHPPNIPK-------EQPPAGTA---NAPTVSIKASEEKTAESKKTYNSISKIDKMSRIVFPILFGTFNLVYWATYL 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Match: Gabra5 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 5 [Source:MGI Symbol;Acc:MGI:95617])

HSP 1 Score: 164.081 bits (414), Expect = 4.664e-46
Identity = 101/275 (36.73%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG-----------------DQIYN-----LVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+                  + I N        G     P +P+       E+P        +  T  +K    + + + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKERELILNKSTNAFTTGKLTHPPNIPK-------EQPPAGTA---NAPTVSIKASEEKTAESKKTYNSISKIDKMSRIVFPILFGTFNLVYWATYL 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Match: Gabra1 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1 [Source:MGI Symbol;Acc:MGI:95613])

HSP 1 Score: 161.384 bits (407), Expect = 3.286e-45
Identity = 106/273 (38.83%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQ-----DMKYKTIRISHT---------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++Y+WT+ P RSV   ++   L+Q+ L+  +   S  +    G + ++   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+GY     ++V       P  P+KV  D   + N+         T      D    TI  S T                +  NSVS+ID++SRI FPL F  FNL YW  YL
Sbjct:  179 CPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVD-SGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVV-------PEKPKKVK-DPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYL 442          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Match: Gabra1 (gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1 [Source:MGI Symbol;Acc:MGI:95613])

HSP 1 Score: 161.384 bits (407), Expect = 3.286e-45
Identity = 106/273 (38.83%), Postives = 146/273 (53.48%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQ-----DMKYKTIRISHT---------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++Y+WT+ P RSV   ++   L+Q+ L+  +   S  +    G + ++   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+GY     ++V       P  P+KV  D   + N+         T      D    TI  S T                +  NSVS+ID++SRI FPL F  FNL YW  YL
Sbjct:  179 CPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVD-SGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVV-------PEKPKKVK-DPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDRLSRIAFPLLFGIFNLVYWATYL 442          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|Q8N1C3|GBRG1_HUMAN (Gamma-aminobutyric acid receptor subunit gamma-1 OS=Homo sapiens OX=9606 GN=GABRG1 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 3.224e-46
Identity = 100/270 (37.04%), Postives = 146/270 (54.07%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRS-TKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQI---------YNLVNGSEPDDPWLP-RKVDV-DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY  +++ YKW + P+  V       L QF  + +  S   T  I   G++ I+ + F L R +GYF IQ Y+PC L V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A ++++ T+HYFT    G             ++  G  P    +P   + V  +D+    CL  ++C  + C  +D +  + R     R    +++ID  SRI FP AF  FNL YWV YLY+
Sbjct:  202 CPLEFSSYGYPKNEIEYKW-KKPSVEVADPKYWRLYQFAFVGLRNSTEITHTI--SGDYVIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNQKGKTATKDRKLKNKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDCASFFCCFEDCRTGSWR---EGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL 465          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P31644|GBRA5_HUMAN (Gamma-aminobutyric acid receptor subunit alpha-5 OS=Homo sapiens OX=9606 GN=GABRA5 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.296e-45
Identity = 99/264 (37.50%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRKVDVDDDER---PNHCLRECWHCMTQD-----MKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+   G +        +  +  L +  +     +   P +  +E     T +     +K    + S + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTPAGTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|Q08E50|GBRA5_BOVIN (Gamma-aminobutyric acid receptor subunit alpha-5 OS=Bos taurus OX=9913 GN=GABRA5 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.009e-45
Identity = 98/266 (36.84%), Postives = 147/266 (55.26%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDER---------PNHCLRECWHCMTQDMKYKTI----RISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+       +  ++       R++ ++             P +  +E     T +    ++    + S   +  NS+S+ID++SRI+FPL F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVIYVWTNGTAKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKK--ERELTINKSTNAYTTGKMTHPPNIPKEQTPAGTTNASSASVKPEDKASENKKTYNSISKIDKMSRIIFPLLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|Q8BHJ7|GBRA5_MOUSE (Gamma-aminobutyric acid receptor subunit alpha-5 OS=Mus musculus OX=10090 GN=Gabra5 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.263e-45
Identity = 101/275 (36.73%), Postives = 147/275 (53.45%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG-----------------DQIYN-----LVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+                  + I N        G     P +P+       E+P        +  T  +K    + + + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKERELILNKSTNAFTTGKLTHPPNIPK-------EQPPAGTA---NAPTVSIKASEEKTAESKKTYNSISKIDKMSRIVFPILFGTFNLVYWATYL 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P19969|GBRA5_RAT (Gamma-aminobutyric acid receptor subunit alpha-5 OS=Rattus norvegicus OX=10116 GN=Gabra5 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 6.462e-45
Identity = 101/275 (36.73%), Postives = 146/275 (53.09%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYG-----------------DQIYN-----LVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +++Y WT    +SV   ++   L+Q+HLM  +   +  I    G ++I+   F LKR IGYF+IQ YLPC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+G+                  + I N        G     P +P+      ++ P            +  + KT   S + +  NS+S+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPNSEVVYVWTNGSTKSVVVAEDGSRLNQYHLMGQTVG-TENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAAKIKKKERELILNKSTNAFTTGKLTHPPNIPK------EQLPGGTGNAVGTASIRASEEKT---SESKKTYNSISKIDKMSRIVFPILFGTFNLVYWATYL 451          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Match: R7VD48 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_100858 PE=3 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 5.040e-75
Identity = 125/277 (45.13%), Postives = 172/277 (62.09%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSE--------PDDPWLPRKVDVDDD---------ERPNH----CLRECWHCMTQDMKYKTIRISHTDRN----VNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  +GY   D++Y+W    N+S++   ++TLSQF L+ I   +  K +P +G+FS L   F L+R++GYF+I  Y+PC LLV+ISWVGFWINREATSDRI LG+T VLTMAF  +DNR+D+PKVSY+TALD +V  C+ FI ATIIQFA VHYFTK G G+ +    +G +         D   LP      +          E  +H    C  + +HC+  + KY+ ++I    ++    +NSVS +D  SR+LFPLAF  FN+ YWV+YL
Sbjct:  180 CPLVFGSHGYGTTDVIYRWKYGVNKSIKMAPDMTLSQFDLIGIPSGKENKTLPMKGSFSALWANFELRRHMGYFLINVYIPCSLLVVISWVGFWINREATSDRIGLGITNVLTMAFLGIDNRRDIPKVSYSTALDYFVGTCFAFILATIIQFAAVHYFTKHGSGEIMPLDSDGEDDVVDHNVCEDGQVLPSMGGPANGNVVHQYNSLEEGSHFKEACCHKFYHCLIGNQKYRDLKIRRGPKSKGGRINSVSEVDMASRVLFPLAFAIFNVVYWVFYL 456          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Match: R7UF03 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_3932 PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.538e-70
Identity = 118/264 (44.70%), Postives = 162/264 (61.36%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGY---GDQIYNLVNGSEPDDPWLPRKVDVDDDERPNH--------CLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
             C   F  +GY + D+ Y WT  P+ S++   ++ +SQF L+       T I  G    ++L   F+L+R++GYF+I  Y+PC LLVIISWVGFWINREAT+DRI LG+TTVLTMAF  +DNR DLPKVSY+TALD +V  C+ F+ A IIQFA VH+FTK G    GD     V+  +P     P +      + P+H        CL + WHC+     Y+T+++  + + VNSVS ID+ +R LFP  F+ F++ YW  YL
Sbjct:  162 SCPLKFGSHGYTSSDVQYVWTYGPDASIKLAADMQMSQFDLIESPAHNETDIKFGDEGSTVLVANFVLRRHMGYFLINLYVPCSLLVIISWVGFWINREATADRIALGITTVLTMAFVGIDNRGDLPKVSYSTALDYFVGVCFAFVLAAIIQFAGVHFFTKHGTPRNGDP-QRPVHTQQPVRRRNPHQRISTTAQLPSHVTPITKESCLSKFWHCLIGSSHYRTMKLLQSTQRVNSVSSIDRTARALFPFLFVSFHVFYWTSYL 424          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Match: A0A1I8H8D3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.875e-66
Identity = 122/310 (39.35%), Postives = 167/310 (53.87%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPD-----------------------------------------------DPWLPRKVDVDDDERPN-------HCLRECWHCMTQDMKYKTIRIS--HTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C  +   +GY   DL Y W  +  RS+E    L +SQF L+ +S S S + +   GNFS+L+V F+LKR++GYF+IQ YLPC LLV++SWV FW+NREAT+DR+ LG+TTVLTMAF  +D+R DLP+VSY+TA+D YV  C+TF+ +T++QFA VHYFTK G G ++Y +++G  P                                                 P  P      DD  P         CLR+   C+   + YK    +    +   NSVS ID++SR+ FP AF   N  YW +YLY 
Sbjct:  188 CPLHIGSHGYAGGDLTYSWRYA-RRSIETAANLMMSQFDLVKVSTSGSVRPVARLGNFSVLSVSFVLKRHVGYFLIQLYLPCALLVVLSWVSFWLNREATADRVALGITTVLTMAFLFMDSRADLPRVSYSTAIDWYVAICFTFVLSTLLQFAAVHYFTKAGTG-ELYLVLDGDGPQARLRTVESRDLICATQNGSRLRLEQMPRQSDLQQPASFAVGPIRHEPPPSTPESRQATDDAEPTVAQRRRRRCLRDLAGCLQGSVAYKAAFSASRQAEGGHNSVSAIDRVSRVGFPAAFALVNGWYWAFYLYF 495          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Match: A0A433T9S8 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_013892 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.703e-60
Identity = 124/329 (37.69%), Postives = 180/329 (54.71%), Query Frame = 1
Query:   88 GYSRFWTCTLTRQYSSIFQHSSRSRIQQKEMTQTNLVRHLEKRYTK---CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDE-----------------------RPNH---CLRECWHCMTQDMKYKTIRISHTDRN---VNSVSRIDQISRILFPLAFICFNLTYWVYY 978
            G S   T T   ++  +F   S     Q+   + N   HLEK       C  +   +GY   D++Y+W      +     ++ LSQF L  +  S +TK   G  + SIL+V F  +R+ G+F+IQ YLPCCLLVI+SWV FWINREATSDRI+LG TT+LTM F  +D+R DLP+V+Y+TALD+YV  C+ F+ A+I+QFA VH++TK G  D  +      + D      + D +D E                       +P+    C+R+ W C+   +  +T   +   RN   +NSVS+ID +SR+LFP+AF+  N+ YW+ Y
Sbjct:  203 GPSYVHTITTPNKFVRLFYDGS-VLFSQRLTIKANCPMHLEKFPMDSQLCPLHIASFGYPASDVIYEWHYGNALAAVAATDMRLSQFDLKAMPASNTTKRFKGSPH-SILSVFFDFRRHTGFFLIQVYLPCCLLVILSWVSFWINREATSDRISLGATTMLTMTFLVLDSRNDLPRVAYSTALDVYVALCFFFVFASIVQFAAVHFYTKYGTADTDFRASIMPDTDS-----ETDTEDAEVQGCFRTSNQARFRQPTKSHSNLKPDSITACIRKMWSCL---LSTRTRSFNKNVRNALGLNSVSKIDTMSRVLFPVAFLGLNIVYWILY 521          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Match: A0A0L8FG85 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22022552mg PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 4.990e-60
Identity = 112/271 (41.33%), Postives = 162/271 (59.78%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDD--ERP---------------NHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLY 984
            +C  +   +GY  +++LYKW     R+V+ +  +TLSQF L ++     T +       S+L+V F LKR++G+F++Q Y+PC LLV++SWV FWI+REATSDRI LG TTVL+M F  +DNR  LPKVSY+TALD+YV  CY F+ AT+IQFA VHYFTK   G++  N+       +     K+ + +   +R                N  LR  W+C++    +      +    +NSVS+ID +SR LFPL F+  +++YWV YLY
Sbjct:   91 QCPLHLISFGYTENEVLYKWRFGAERAVDVNAGMTLSQFDLTDMPAWNGTTVFR-EALHSMLSVNFHLKRHMGFFLLQVYVPCTLLVVVSWVSFWIHREATSDRIALGTTTVLSMTFLGLDNRTYLPKVSYSTALDVYVAMCYVFVLATLIQFAAVHYFTKYDSGEE--NIQQDPTDTEESEEEKMVISEVLIQRTQLKKKKKSKLSFCSWNWYLRMFWYCLSGTRNFHIKTFGNKYHALNSVSQIDIVSRRLFPLVFLILSVSYWVCYLY 358          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:103042270])

HSP 1 Score: 169.088 bits (427), Expect = 4.093e-48
Identity = 106/271 (39.11%), Postives = 152/271 (56.09%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEP--DDPW-LPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHT--------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++YKWTQ P++SV    E + L+Q+HL  I ++  T+ I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P   DP  L +K +       N         +T+D    TI  S +               +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPISEVVYKWTQGPSKSVVVAEEGSRLNQYHL--IGQTAGTQDISTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKAMEAQQPKKKDPLALSKKANNACSTGVNFTAN-----ITKDAAIATISNSTSVQMKCAEAKPALDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 450          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:103042270])

HSP 1 Score: 168.318 bits (425), Expect = 6.198e-48
Identity = 106/271 (39.11%), Postives = 152/271 (56.09%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEP--DDPW-LPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHT--------------DRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++YKWTQ P++SV    E + L+Q+HL  I ++  T+ I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P   DP  L +K +       N         +T+D    TI  S +               +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  182 CPLKFGSYAYPISEVVYKWTQGPSKSVVVAEEGSRLNQYHL--IGQTAGTQDISTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKAMEAQQPKKKDPLALSKKANNACSTGVNFTAN-----ITKDAAIATISNSTSVQMKCAEAKPALDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 445          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 161.384 bits (407), Expect = 3.496e-45
Identity = 99/276 (35.87%), Postives = 147/276 (53.26%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPG-RGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQ-----GYGDQIYNLVNGSEPDDPWLPRKVDV-----------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
             C   F  YGY   +++Y+W +S   SVE  +  +   +    +    ST+++    G++ +L V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A +I++ T+HYF            +  N V+   P     PR                D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  +RI FP AF  FNL YWV YLY+
Sbjct:  197 SCPLEFSSYGYPKEEIVYRWKRS---SVEVGDIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKPSKNKDKKKKNPVSIQAPTVDIRPRSATAIQMNNATHMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWR--HGRLHIR-VAKIDSYARIFFPTAFGLFNLVYWVSYLYL 466          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:103027255])

HSP 1 Score: 161.384 bits (407), Expect = 3.572e-45
Identity = 98/273 (35.90%), Postives = 148/273 (54.21%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPG-RGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT--KQGYGDQIYNLVNGSEPDDPWLPRKVDV-----------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
             C   F  YGY   +++Y+W +S   SVE  +  +   +    +    ST+++    G++ +L V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A +I++ T+HYF   ++   ++     N   P     PR                D+E    CL  ++C  + C  +D +    R  H   ++  V++ID  +RI FP AF  FNL YWV YLY+
Sbjct:  196 SCPLEFSSYGYPKEEIVYRWKRS---SVEVGDIRSWRLYQFSFVGLRNSTEVVRTVSGDYVVLTVFFELSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKPSKNKDKKKKNPQAPTVDIRPRSATAIQMNNATHMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWR--HGRLHIR-VAKIDSYARIFFPTAFGLFNLVYWVSYLYL 462          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Match: gabrg1 (gamma-aminobutyric acid type A receptor gamma1 subunit [Source:NCBI gene;Acc:103030074])

HSP 1 Score: 160.999 bits (406), Expect = 4.225e-45
Identity = 95/271 (35.06%), Postives = 145/271 (53.51%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGR-GNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDV------------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY  +++ YKW    +R+V+  ++     +    +    +T I   + G++ ++++ F L R +GYF IQ Y+PC ++V++SWV FWIN++A   R +LG+TTVLTM   S  +RK LPKVSY TA+D++V+ C+ F  A ++++ T+HYFT      Q       S P    +  +               DDD+    CL  ++C  + C   D +    R    +R    VS+ID  SRI FP AF  FNL YW+ YLY+
Sbjct:  192 CPLEFSSYGYPKNEIEYKWH---SRAVQVADQRYWRLYQFAFVGLQNTTGIAHTQSGDYVVMSILFTLSRRMGYFTIQTYIPCSMIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTISRKSLPKVSYVTAMDLFVSVCFIFTFAALMEYGTLHYFTSN---RQNKKTKTNSAPKSSMVNIRPGTSLLQMNNIAPYHDDDDYAYECLDGKDCTSFFCCFDDCRSGAWR---ENRMHVHVSKIDSYSRIFFPTAFGLFNLVYWIGYLYL 453          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 2.601e-39
Identity = 92/278 (33.09%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMN-ISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY-------FTKQGYGDQ--IYNLVNG--------SEPDDPWLPRKV---------DVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYY 978
            C  Y + +GY   D+++ W      S+     LTL QF L N IS    TK     G+F+ +  +F L R +G+++IQ Y+P  L+VI+SWV FWIN EA   R+ LG+TTVLT+   S   R  LPKVSY  A+DI++  C  F+ A ++++A V+        F K+G G+Q  I  LV+         +E D+  L   +          V D ++P         C+   +  +  +     + V     ID ISR+ FP++F+ FN+ YW  +
Sbjct:  184 CSMYLESFGYTTADIVFHWNGPTPVSLFEG--LTLPQFVLSNKISTGSCTKTY-STGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVTSRQSQGFMKKGRGNQKPIDLLVHKKMFWKFLVAENDNDLLYFTITIFTLNGLLPVSDSKKPVIV------CIKPLLSLQETKEKMRKKYVACAQTIDNISRLFFPISFLIFNVVYWFAF 452          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: glra4a (glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GENE-010410-3])

HSP 1 Score: 143.28 bits (360), Expect = 3.780e-39
Identity = 86/270 (31.85%), Postives = 142/270 (52.59%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQ-GYGDQIYNLVNGSEPDDP--W-LPRKVDVDDDERP--NHCLREC--------WHCMTQDMKYKTIRISHTD-----RNVNSVSRIDQISRILFPLAFICFNLTYWVYY 978
            C  Y + YGY  +DL+++W  +    V     ++  +F L N +           G FS +   F L R++GY++IQ Y+P CLLVIISW+ FW+N EA   R+ LG+TT+LT+          LPKVSY  A+D+++  C  F+ + +++FA V+  T++ G     ++  +G++ + P  W   R  +V    RP  +   R+C        +H  ++  +    R+  +D     +++    RID ISR++FP  F+ FN+ YWV Y
Sbjct:  191 CSIYLESYGYTTNDLIFQWNDT--EPVSFGAGVSTPKFTLSNETFLGECTKEYTYGTFSCVKATFFLDRDMGYYLIQVYIPSCLLVIISWLSFWLNVEAAPARVGLGITTILTVTTQMTSANAALPKVSYIKAIDVWMGACQVFVFSALLEFAAVNMATRRHGISPSHHDGDHGTKGELPIEWKRHRHANVSSVRRPQRHRPERDCRSQGKPGVFHTNSRRDENNATRVHVSDEEWRYQSLLHARRIDYISRVIFPTVFMIFNIFYWVIY 458          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 139.813 bits (351), Expect = 2.007e-37
Identity = 70/165 (42.42%), Postives = 100/165 (60.61%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMN---ISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQ 708
            C   F  Y Y   +++Y WT+  N SVE   E + L Q+ L      SE   +KI    G++ ++ V F LKR +GYF++Q Y+PC + VI+S V FWIN+E+   R   G+TTVLTM   S+  R  LPKVSYATA+D ++   + F+ + +I+FA V+YFT Q
Sbjct:  183 CPLKFGSYAYPKSEIIYSWTKGANNSVEVPQESSSLLQYDLTGHNVSSEELKSKI----GDYVVMTVSFYLKRKMGYFIVQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTQSISARGSLPKVSYATAMDWFIAVSFAFVFSALIEFAAVNYFTNQ 343          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 134.806 bits (338), Expect = 4.682e-37
Identity = 92/324 (28.40%), Postives = 150/324 (46.30%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISE-SRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY-FTKQG-----------------------------YGD------QIYNLVNG---SEPDDPWLPRKVDVDDD---ERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSR-----------------------------IDQISRILFPLAFICFNLTYWVYYL 981
            C    + YGY   D+ + W +  + ++    E+ L QF ++  ++ SR+ +     G++  L++ F LKRNIGYF++Q Y+P  L+ I+SWV FWIN +A++ R+ LGVTTVLTM   S   R+ LPK+ Y  A+DIY+ GC+ F+   ++++A V+Y F  +G                             +G+      +I N + G     P  P  PR   +  D     P   LR+      + ++    R +  +R   ++ R                             ID+ SR++FP+ F  FN  YW+YY+
Sbjct:   14 CTLEIESYGYTTEDIKFYW-RGGDTAITGVGEIKLPQFTIVKHNQVSRNVQF--ATGSYPRLSLSFRLKRNIGYFILQTYMPTILITILSWVSFWINYDASAARVALGVTTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLALLEYAAVNYLFFGRGPQRAKKAAERIARANNEKPRAADTSKVDAHGNILLTSLEIRNEMGGPGYGHPGLPGDPRATGLGLDHHHHHPGVQLRQPVQGGGETLE----RAARGERGRGTLQRGQGGAKKTRLQRRTSQLKIKIPDLSNVNAIDKWSRVIFPVTFGFFNAVYWLYYV 330          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 131.339 bits (329), Expect = 5.682e-36
Identity = 92/304 (30.26%), Postives = 146/304 (48.03%), Query Frame = 1
Query:  250 GYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY-FTKQG----------------------------YGDQIYNLVN-----------GSEPDDPWLPRKVDVDDD------------ERPNHCLRECW--HCMT-QDMKYKTI--RISHTDRNVNSVSRIDQISR---ILFPLAFICFNLTYWVYYL 981
            GY   D+ + W +  + +V   +E+ L QF +M      ST ++   G++  L++ F LKRNIGYF++Q Y+P  L+ I+SWV FWIN +A++ R+ LG+TTVLTM   S   R+ LPK+ Y  A+DIY+ GC+ F+   ++++A V+Y F  +G                             G+ + N +            G+ PD P       V  D             +P    +E    H  + Q  K K +  R S     +  ++ ++ I R   ++FP+AFI FN+ YW YY+
Sbjct:    1 GYTMDDIGFYW-RGGDAAVTGVSEIELPQFSIMEF-RLVSTLVVFATGSYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLALLEYALVNYIFFGRGPQLQKKAERAAAKEHNERIRAEATAVDAQGNILLNTLEMKNEMNAVEAAGALPDQPRGVGGGGVPFDGSTSSAAAGAGYRKPMGGGQEAQGRHAASYQAAKRKRLQRRSSQLRIKIPDLTDVNSIDRWSRMIFPIAFIFFNVVYWTYYI 302          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO45319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT31])

HSP 1 Score: 132.494 bits (332), Expect = 5.126e-35
Identity = 91/315 (28.89%), Postives = 139/315 (44.13%), Query Frame = 1
Query:  130 SSIFQHSSRSRIQQKEMTQTNLVRHLEKRYTKCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNL-------------------------------VNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
              IF     S +   EM   +     +  Y K    F  Y + + D+ ++W  +PN+ +    +  L+QFHL        T I    GN++ + V F + R +GY++IQ Y P  L+V++SW+ FW++ +   DR+ LG+TT+LT+ F        +PKVSY  ALD Y+   + F+  T+I+   V   T QG  ++                                   +N   P D  L    D    E PN   + CW   T           H   +  +  R+DQISR+LFPLAF+ +N+ YW  YL
Sbjct:  135 GKIFYSRGVSIVASCEMDLHDFPLDTQNCYLK----FGSYAFTDTDIFFRW-NNPNK-LSRVQKSDLAQFHLAGYDLITETGIYE-EGNYTTVKVIFKMNRRVGYYIIQAYCPDVLIVVLSWIIFWMDVKDMGDRMALGITTILTIMFLLGAVNASMPKVSYPKALDWYLMVSFAFVFLTLIESMIVFLLTPQGESEKPKKTSCLTKRVVTMLTPVLRRRPNSHVVTTPNNHELNNISPTDAALLNPEDGGGREGPNGT-KACWDDHT----------GHVKESKCAGYRVDQISRVLFPLAFVFYNVAYWYTYL 431          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO38571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCG3])

HSP 1 Score: 121.324 bits (303), Expect = 5.190e-33
Identity = 67/198 (33.84%), Postives = 105/198 (53.03%), Query Frame = 1
Query:  391 GNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTK-QGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNS---VSRIDQISRILFPLAFICFNLTYWV 972
            GNFS L V F  +R + Y++ + Y+P  L V++SWV FWI+  AT  RI+L + TVL MA   + +  D PK SYA + D+Y+  C+ F+   ++++A VHY  +   Y  +++  +N     +P L +              +    C  +D   K   +S   R + +     ++D+ISRILFP+ FI FN  YWV
Sbjct:    5 GNFSALTVGFRFRREVYYYLFRFYIPASLTVVMSWVSFWISPLATPARISLTIITVLAMAGFLIGDHPDFPKSSYARSFDVYMMMCFVFVFGCLVEYAAVHYLLRDDKYNKKVFKHLNDIN-RNPNLNKIAPATQSAETALSTQSTDQCTNRDPP-KASCLSPLRRRLKAKQISGKLDEISRILFPVMFILFNTVYWV 200          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 123.635 bits (309), Expect = 6.787e-32
Identity = 87/300 (29.00%), Postives = 141/300 (47.00%), Query Frame = 1
Query:  157 SRIQQKEMTQTNLVRHLEKRYTKCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNEL-TLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPD----DPWLPRKVDVDDDERP-------NHCLRECWHC----MTQDMKYKT-------IRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            SR+  K     NL R   K    C    + YGY+  ++ Y+W    +  +  + ++  + Q++L +I+ SR   +    GN+S L   F  +R  GYF+I  Y PC L+VI+SW+ F I  E+T+ RI LG+T+VLT+          +PKVSY  A+D Y+ GC+ F+ A ++++  V Y   +   +   +LVN S        P       + +   P         C   C H     + +  K+K+        R       V     ID+ +R+LFP  FI FN+ Y++ + +I
Sbjct:  121 SRVTVKASCAMNL-RMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLSDINVSRHFTMYVA-GNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLYIDNEEVTEYKKDLVNYSSESVKHRSPAHAMNGSIPNGYSPAVFSEHGKKCGHNCHHAHHDVVLKREKHKSSYEQLGGCRPRLKFPAVIDTECIDEFARVLFPFIFIAFNVIYFIVFFFI 418          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO33939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQS5])

HSP 1 Score: 116.316 bits (290), Expect = 2.910e-31
Identity = 65/197 (32.99%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  460 YLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT-------KQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECW----HCMTQDMKYKTIRISHTDRN-------VNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF 996
            YLP  L+VI+SWV FW++RE T+ RI +G+TTVLTMA      R  LPKVSY  +L++++  C+ F+ + I++++ V Y         ++ Y  Q+    +G  P DP        D   RP       W    H +   +  K +  +    +       +N +++++ I RI FPL F+  N+ YWVYYL I + 
Sbjct:    2 YLPSYLIVILSWVSFWVDREQTAARIAMGITTVLTMATLIGSARVSLPKVSYVKSLELFLIMCFLFVFSAILEYSFVSYLVFRQRVKNREDYAQQLIEPDDGLNPIDP-----DGTDGRPRPEPGQEAIWIPGKHQVEAVLTKKGVAPTKKPLDKKNDNHYINLLTKVEYIFRIAFPLTFVILNVFYWVYYLTIAEL 193          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 118.627 bits (296), Expect = 7.912e-31
Identity = 65/161 (40.37%), Postives = 93/161 (57.76%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE---HDNELTLSQFHLMNISESRSTKIIP-GRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY 696
            C    + YGY + D+LY W +  + +     HD +L L QF ++ +S  RS K+     GN S L   F +KR IGYF+I  Y+P  ++VIISW+ FWI+ E    R+ LG+TTVLTM       R +LPKVSY  A+D Y+  C  F+  +I+++  V Y
Sbjct:  162 CSLSLESYGYQSTDVLYVWNERLDNTSAIYIHD-DLELPQFEVLGVS--RSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFVFGSILEYTCVTY 319          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:105354003])

HSP 1 Score: 166.007 bits (419), Expect = 5.190e-47
Identity = 99/265 (37.36%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEP--DDPWL---------PRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++Y WT+   +SV    E + L+Q+HL  I ++  T+ I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P   DP           P  V+   +   +  +    +  T  +K    +     +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  187 CPLKFGSYAYPVSEVVYTWTKGAAKSVVVAEEGSRLNQYHL--IGQTAGTEDIYTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKAMEAQQPKKKDPLALSKKSNNSCPTGVNYTANITKDASISTISNSTTVQLKPPETKAPDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 449          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Match: gabra5 (gamma-aminobutyric acid type A receptor alpha5 subunit [Source:NCBI gene;Acc:105354003])

HSP 1 Score: 165.622 bits (418), Expect = 2.862e-46
Identity = 99/265 (37.36%), Postives = 147/265 (55.47%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELT-LSQFHLMNISESRSTK-IIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEP--DDPWL---------PRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++Y WT+   +SV    E + L+Q+HL  I ++  T+ I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +       +   +P   DP           P  V+   +   +  +    +  T  +K    +     +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  267 CPLKFGSYAYPVSEVVYTWTKGAAKSVVVAEEGSRLNQYHL--IGQTAGTEDIYTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWAWDGKKAMEAQQPKKKDPLALSKKSNNSCPTGVNYTANITKDASISTISNSTTVQLKPPETKAPDPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 529          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Match: ENSORLT00000005674.2 (gamma-aminobutyric acid receptor subunit alpha-5 [Source:NCBI gene;Acc:101158177])

HSP 1 Score: 163.696 bits (413), Expect = 4.345e-46
Identity = 102/271 (37.64%), Postives = 155/271 (57.20%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVE-HDNELTLSQFHLMNISESRSTKII-PGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVD-VDDDERPNHCLRECWH---CMTQDMKYKTI-------------RISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y   +++Y WTQ   +SV   ++   L+Q+HL  I ++  T+ I   RG ++++   F LKR IGYF+IQ Y+PC + VI+S V FW+NRE+   R   GVTTVLTM   S+  R  LPKV+YATA+D ++  CY F+ + +I+FATV+YFTK+ +        +G +  +   P+K D +   ++PN+      +    +T+D+   TI             + +   +  NSVS+ID++SRI+FP+ F  FNL YW  YL
Sbjct:  192 CPLKFGSYAYPVEEVVYTWTQDAAKSVVVAEDGSRLNQYHL--IGQTAGTEDIHTSRGQYTVMMAHFYLKRKIGYFVIQTYMPCFMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWA------WDGKKAMEAQHPKKRDPMVLSKKPNNVCSAGVNYTPNLTKDVAISTISNTTSVQLRGTESKAADPKKTYNSVSKIDKMSRIVFPVLFGTFNLVYWATYL 454          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 162.54 bits (410), Expect = 1.358e-45
Identity = 101/280 (36.07%), Postives = 149/280 (53.21%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDN--ELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFT---KQG------YGDQIYNLVNGSEPDDPWLPRKVDV-----------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++Y+W +S   SVE  +     L QF  + +  + S  +    G++ +L V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A +I++ T+HYF    KQ         + +  L +   P     PR                D+E    CL  ++C  + C  +D +    R  H   ++  +++ID  +RI FP AF  FNL YWV YLY+
Sbjct:  203 CPLEFSSYGYPREEIVYRWKRS---SVEVGDIRSWRLYQFSFVGLRNT-SEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKQSAKKDKKKKNPLLRLFSSKTPTVDIRPRSATAIQMNNATHMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWR--HGRLHIR-IAKIDSYARIFFPTAFALFNLVYWVSYLYL 475          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Match: gabrg2 (gamma-aminobutyric acid type A receptor gamma2 subunit [Source:NCBI gene;Acc:101168976])

HSP 1 Score: 161.384 bits (407), Expect = 3.803e-45
Identity = 98/272 (36.03%), Postives = 146/272 (53.68%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDN--ELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYF-TKQGYGDQIYNLVNGSEPDDPWLPRKVDV-----------DDDERPNHCL--REC--WHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYI 987
            C   F  YGY   +++Y+W +S   SVE  +     L QF  + +  + S  +    G++ +L V F L R +GYF IQ Y+PC L+V++SWV FWIN++A   R +LG+TTVLTM   S   RK LPKVSY TA+D++V+ C+ F+ A +I++ T+HYF + +    +         P     PR                D+E    CL  ++C  + C  +D +    R  H   ++  +++ID  +RI FP AF  FNL YWV YLY+
Sbjct:  203 CPLEFSSYGYPREEIVYRWKRS---SVEVGDIRSWRLYQFSFVGLRNT-SEVVRTVSGDYVVLTVFFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALIEYGTLHYFVSNRKQSAKKDKKKKNPTPTVDIRPRSATAIQMNNATHMQERDEEYGYECLDGKDCTSFFCCFEDCRSGAWR--HGRLHIR-IAKIDSYARIFFPTAFALFNLVYWVSYLYL 467          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 521.161 bits (1341), Expect = 0.000e+0
Identity = 248/258 (96.12%), Postives = 250/258 (96.90%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF 996
            KC      YGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSE +DPWLPRKVDVDDDERPNHCL ECWHCMTQDMKYKTIRISHTDR+VNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF
Sbjct:  165 KCPLLIASYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSESNDPWLPRKVDVDDDERPNHCLSECWHCMTQDMKYKTIRISHTDRDVNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF 422          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 248/258 (96.12%), Postives = 250/258 (96.90%), Query Frame = 1
Query:  223 KCK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF 996
            KC      YGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSE +DPWLPRKVDVDDDERPNHCL ECWHCMTQDMKYKTIRISHTDR+VNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF
Sbjct:  105 KCPLLIASYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSESNDPWLPRKVDVDDDERPNHCLSECWHCMTQDMKYKTIRISHTDRDVNSVSRIDQISRILFPLAFICFNLTYWVYYLYITDF 362          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000069788.1 (SMESG000069788.1)

HSP 1 Score: 132.494 bits (332), Expect = 2.686e-36
Identity = 91/266 (34.21%), Postives = 141/266 (53.01%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNIS-ESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMT-------------QDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +L+Y+W +  N +       +L+QF   N++  S   K+     +F  L ++  + R IGY++IQ Y+P  L+V  SW+ FWINREA   R+TLG+TT+LT    S+  R+ LPKVSY T+LDI++  C+ F+  +II+ A VHY+TK    +          P    +  + D    +  N   R   + +T               ++  +   S T + +NS+S +D++SRILFPL F+ FNL YW+ Y+
Sbjct:    6 CSLLFGSYAYTNAELIYRWDKKENINYV---AFSLAQFQFNNLTLSSYRQKLASEYRDF--LELKIHISRRIGYYIIQIYVPAYLMVTTSWISFWINREAIPARVTLGITTLLTSTTISMSARQGLPKVSYYTSLDIFLLVCFCFVFISIIENAIVHYYTKTDVAEI------PVTPTSDEINSQFDTQLQQSANFFKRMSSYIITPSNIGSCLYSANLMKLQSDSDNGSITWKTINSLSDMDKLSRILFPLVFLIFNLIYWLSYM 260          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000069788.1 (SMESG000069788.1)

HSP 1 Score: 132.494 bits (332), Expect = 3.221e-36
Identity = 91/266 (34.21%), Postives = 141/266 (53.01%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNIS-ESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDDERPNHCLRECWHCMT-------------QDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAFICFNLTYWVYYL 981
            C   F  Y Y N +L+Y+W +  N +       +L+QF   N++  S   K+     +F  L ++  + R IGY++IQ Y+P  L+V  SW+ FWINREA   R+TLG+TT+LT    S+  R+ LPKVSY T+LDI++  C+ F+  +II+ A VHY+TK    +          P    +  + D    +  N   R   + +T               ++  +   S T + +NS+S +D++SRILFPL F+ FNL YW+ Y+
Sbjct:   13 CSLLFGSYAYTNAELIYRWDKKENINYV---AFSLAQFQFNNLTLSSYRQKLASEYRDF--LELKIHISRRIGYYIIQIYVPAYLMVTTSWISFWINREAIPARVTLGITTLLTSTTISMSARQGLPKVSYYTSLDIFLLVCFCFVFISIIENAIVHYYTKTDVAEI------PVTPTSDEINSQFDTQLQQSANFFKRMSSYIITPSNIGSCLYSANLMKLQSDSDNGSITWKTINSLSDMDKLSRILFPLVFLIFNLIYWLSYM 267          
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000026005.1 (SMESG000026005.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.403e-27
Identity = 58/157 (36.94%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  226 CK*YFKQYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY 696
            C    + YGY   D+   W    N +V +   + + QF ++N         +   G +  L++ F L RN+G+F+ Q YLP  L+V++SWV FWI+ EATS R+ LG+TTVLTM   S   R  LP++SY  A+D+Y+  C+ F+ + ++++A V+Y
Sbjct:  180 CTVEIESYGYPLDDVKMSWKNGRN-AVHNIENIHMIQFTIVNYDVHTLVSNL-STGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 334          
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG16.714e-4737.04gamma-aminobutyric acid type A receptor gamma1 sub... [more]
GABRA54.782e-4637.50gamma-aminobutyric acid type A receptor alpha5 sub... [more]
GABRA54.782e-4637.50gamma-aminobutyric acid type A receptor alpha5 sub... [more]
GABRA54.782e-4637.50gamma-aminobutyric acid type A receptor alpha5 sub... [more]
GABRG21.885e-4533.58gamma-aminobutyric acid type A receptor gamma2 sub... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgc-372.612e-3930.77Ligand-Gated ion Channel [Source:UniProtKB/TrEMBL... [more]
avr-156.268e-3832.55pep chromosome:WBcel235:V:13498786:13502743:-1 gen... [more]
avr-156.268e-3832.55pep chromosome:WBcel235:V:13498786:13502582:-1 gen... [more]
avr-158.014e-3732.94pep chromosome:WBcel235:V:13498786:13511718:-1 gen... [more]
unc-491.055e-3531.91Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG89166.184e-4447.88gene:FBgn0030707 transcript:FBtr0301233[more]
CG89161.615e-4347.88gene:FBgn0030707 transcript:FBtr0301232[more]
GluClalpha1.140e-3831.63gene:FBgn0024963 transcript:FBtr0335418[more]
GluClalpha1.145e-3831.63gene:FBgn0024963 transcript:FBtr0335421[more]
Grd1.216e-3860.55gene:FBgn0001134 transcript:FBtr0075139[more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabra56.078e-4837.83gamma-aminobutyric acid (GABA) A receptor, alpha 5... [more]
gabra56.078e-4837.83gamma-aminobutyric acid (GABA) A receptor, alpha 5... [more]
BX664715.17.149e-4837.83gamma-aminobutyric acid (GABA) A receptor, alpha 5... [more]
gabra2a2.827e-4536.46gamma-aminobutyric acid type A receptor alpha2 sub... [more]
gabrg21.319e-4436.26gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRG24.165e-4534.77gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
rhbg4.695e-4537.36Rh family B glycoprotein (gene/pseudogene) [Source... [more]
GABRG24.749e-4534.77gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
GABRG25.110e-4535.79gamma-aminobutyric acid (GABA) A receptor, gamma 2... [more]
rhbg5.182e-4537.36Rh family B glycoprotein (gene/pseudogene) [Source... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabra54.664e-4636.73gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra54.664e-4636.73gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra54.664e-4636.73gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra13.286e-4538.83gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabra13.286e-4538.83gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N1C3|GBRG1_HUMAN3.224e-4637.04Gamma-aminobutyric acid receptor subunit gamma-1 O... [more]
sp|P31644|GBRA5_HUMAN2.296e-4537.50Gamma-aminobutyric acid receptor subunit alpha-5 O... [more]
sp|Q08E50|GBRA5_BOVIN3.009e-4536.84Gamma-aminobutyric acid receptor subunit alpha-5 O... [more]
sp|Q8BHJ7|GBRA5_MOUSE3.263e-4536.73Gamma-aminobutyric acid receptor subunit alpha-5 O... [more]
sp|P19969|GBRA5_RAT6.462e-4536.73Gamma-aminobutyric acid receptor subunit alpha-5 O... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VD485.040e-7545.13Uncharacterized protein OS=Capitella teleta OX=283... [more]
R7UF034.538e-7044.70Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8H8D31.875e-6639.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A433T9S81.703e-6037.69Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A0L8FG854.990e-6041.33Uncharacterized protein OS=Octopus bimaculoides OX... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabra54.093e-4839.11gamma-aminobutyric acid type A receptor alpha5 sub... [more]
gabra56.198e-4839.11gamma-aminobutyric acid type A receptor alpha5 sub... [more]
gabrg23.496e-4535.87gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg23.572e-4535.90gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg14.225e-4535.06gamma-aminobutyric acid type A receptor gamma1 sub... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008467.12.601e-3933.09pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra4a3.780e-3931.85glycine receptor, alpha 4a [Source:ZFIN;Acc:ZDB-GE... [more]
gabra6a2.007e-3742.42gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
gabrb34.682e-3728.40gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb35.682e-3630.26gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453195.126e-3528.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385715.190e-3333.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375556.787e-3229.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339392.910e-3132.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354107.912e-3140.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabra55.190e-4737.36gamma-aminobutyric acid type A receptor alpha5 sub... [more]
gabra52.862e-4637.36gamma-aminobutyric acid type A receptor alpha5 sub... [more]
ENSORLT00000005674.24.345e-4637.64gamma-aminobutyric acid receptor subunit alpha-5 [... [more]
gabrg21.358e-4536.07gamma-aminobutyric acid type A receptor gamma2 sub... [more]
gabrg23.803e-4536.03gamma-aminobutyric acid type A receptor gamma2 sub... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit alpha-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018336.10.000e+096.12SMESG000018336.1[more]
SMESG000018336.10.000e+096.12SMESG000018336.1[more]
SMESG000069788.12.686e-3634.21SMESG000069788.1[more]
SMESG000069788.13.221e-3634.21SMESG000069788.1[more]
SMESG000026005.11.403e-2736.94SMESG000026005.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013546 ID=SMED30013546|Name=Gamma-aminobutyric acid receptor subunit alpha-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1044bp
AAAATTGATCACTAAAACACACAATTTTTGAATAAGTCATCGATGAACCT
GTAGTCGTATATTATCATCCTCGAACTCCAAGCTTATGGATACTCGCGGT
TTTGGACGTGTACGTTAACTCGGCAATATTCTTCTATATTCCAACACAGC
TCACGGAGTAGAATACAACAGAAGGAAATGACCCAAACGAATTTAGTCAG
ACATTTGGAGAAGCGATATACTAAATGCAAATAATATTTTAAGCAATATG
GCTACAATAATCATGATCTCTTGTACAAGTGGACCCAAAGTCCAAATCGG
TCAGTTGAACACGACAACGAGTTAACTCTTTCACAATTTCACTTGATGAA
TATATCAGAGTCGAGGTCCACAAAAATAATCCCCGGAAGAGGGAACTTTT
CGATATTAGCCGTGGAATTTATTTTAAAAAGAAATATTGGATATTTCATG
ATACAACAATATTTACCATGCTGTCTATTGGTAATAATCTCTTGGGTCGG
ATTTTGGATTAACAGGGAAGCAACATCGGACAGAATAACCCTTGGGGTGA
CCACCGTATTGACAATGGCATTCTCAAGTGTAGATAACAGAAAAGATCTT
CCAAAAGTTTCATATGCAACTGCTTTGGATATTTATGTTAATGGATGCTA
CACGTTTATTGCAGCCACCATCATACAATTTGCTACAGTCCATTATTTCA
CCAAACAAGGATATGGGGATCAAATATACAATTTAGTGAATGGTTCAGAA
CCGGACGATCCATGGTTACCGAGAAAAGTGGATGTAGATGACGATGAAAG
ACCAAATCATTGTCTGAGAGAATGCTGGCACTGCATGACGCAAGACATGA
AATACAAAACAATACGGATATCACATACGGACCGAAACGTAAACTCCGTT
AGCAGAATTGATCAAATTAGTAGAATTCTCTTTCCGCTGGCTTTTATATG
TTTTAATTTAACTTATTGGGTGTATTATTTATACATTACTGATTTTTAAT
CGCATTCTGGAACAAACTTTGGCTGAACTAGATTTAATTTAATA
back to top

protein sequence of SMED30013546-orf-1

>SMED30013546-orf-1 ID=SMED30013546-orf-1|Name=SMED30013546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISW
VGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNG
CYTFIAATIIQFATVHYFTKQGYGDQIYNLVNGSEPDDPWLPRKVDVDDD
ERPNHCLRECWHCMTQDMKYKTIRISHTDRNVNSVSRIDQISRILFPLAF
ICFNLTYWVYYLYITDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0004890GABA-A receptor activity
GO:0005216ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006201Neur_channel
IPR036719Neuro-gated_channel_TM_sf
IPR006028GABAA/Glycine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0007165signal transduction
GO:0034220ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 191..211
score: 54.99
coord: 60..81
score: 42.4
coord: 34..54
score: 54.61
coord: 94..115
score: 31.7
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 39..120
e-value: 9.9E-25
score: 88.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 10..214
NoneNo IPR availablePANTHERPTHR18945:SF23GAMMA-AMINOBUTYRIC ACID RECEPTOR SUBUNIT ALPHA-5coord: 10..214
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 33..208
e-value: 1.29135E-46
score: 147.984
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 32..214