Synaptotagmin-like protein 5

Overview
NameSynaptotagmin-like protein 5
Smed IDSMED30013540
Length (bp)2242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin-like protein 5 (SMED30013540) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin-like protein 5 (SMED30013540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin-like protein 5 (SMED30013540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin-like protein 5 (SMED30013540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013540

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013540SMESG000014370.1 SmedASXL_007605SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013540SMESG000014370.1 dd_Smed_v4_10375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013540SMESG000014370.1 dd_Smed_v6_10375_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Match: SYTL3 (synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:15587])

HSP 1 Score: 81.2629 bits (199), Expect = 3.119e-15
Identity = 137/642 (21.34%), Postives = 242/642 (37.69%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRISP--------NPVKEITQSHSPKR-KLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPEY----SQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSC------SNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIV---RWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            +IDLS + + E     +V+ R  A+   E  R R+LKT +           H   K  KN         C   +  +G    R ++ CR C   VC  C   +       C  C +   +  KTG WF+++  K+       E         Y ++S          PV E   S SP R +   + R +N   E L       ++ +    +  ++ K  ++  P      +++R++   +  + +   S  ++   L+ +    + N      ++ S P  S        +GS I ++   T++  +  +AN          GE+   + + F+     I ++ CKNL   +       PY+   LLPDRS + +R T V++N   P F +  KY +  A+L +R + V + H   L+ R + LG+VIIPL+  DF        RW+  +                + A+    ++P   GE+++  K V                       ++     Q  L+  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F+ V   +LR  SLE+T+W  +  G  +R++
Sbjct:    4 EIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHL----------QHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAV-CRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQLLQSYQKLSKISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSEKHLLATGPRQCVGQTERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFSGGFRHGSLISIDSTCTEM-GNFDNANVT--------GEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARR-VFLGEVIIPLATWDFEDSTTQSFRWHPLR----------------AKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQ--------------EAQEGTDQPSLHGQLCL----------------------VVLGAKNL--PVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQ---WKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLL 567          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Match: SYTL3 (synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:15587])

HSP 1 Score: 81.2629 bits (199), Expect = 3.119e-15
Identity = 137/642 (21.34%), Postives = 242/642 (37.69%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRISP--------NPVKEITQSHSPKR-KLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPEY----SQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSC------SNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIV---RWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            +IDLS + + E     +V+ R  A+   E  R R+LKT +           H   K  KN         C   +  +G    R ++ CR C   VC  C   +       C  C +   +  KTG WF+++  K+       E         Y ++S          PV E   S SP R +   + R +N   E L       ++ +    +  ++ K  ++  P      +++R++   +  + +   S  ++   L+ +    + N      ++ S P  S        +GS I ++   T++  +  +AN          GE+   + + F+     I ++ CKNL   +       PY+   LLPDRS + +R T V++N   P F +  KY +  A+L +R + V + H   L+ R + LG+VIIPL+  DF        RW+  +                + A+    ++P   GE+++  K V                       ++     Q  L+  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F+ V   +LR  SLE+T+W  +  G  +R++
Sbjct:    4 EIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHL----------QHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAV-CRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQLLQSYQKLSKISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSEKHLLATGPRQCVGQTERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFSGGFRHGSLISIDSTCTEM-GNFDNANVT--------GEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARR-VFLGEVIIPLATWDFEDSTTQSFRWHPLR----------------AKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQ--------------EAQEGTDQPSLHGQLCL----------------------VVLGAKNL--PVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQ---WKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLL 567          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Match: SYTL3 (synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:15587])

HSP 1 Score: 81.2629 bits (199), Expect = 3.119e-15
Identity = 137/642 (21.34%), Postives = 242/642 (37.69%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRISP--------NPVKEITQSHSPKR-KLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPEY----SQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSC------SNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIV---RWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            +IDLS + + E     +V+ R  A+   E  R R+LKT +           H   K  KN         C   +  +G    R ++ CR C   VC  C   +       C  C +   +  KTG WF+++  K+       E         Y ++S          PV E   S SP R +   + R +N   E L       ++ +    +  ++ K  ++  P      +++R++   +  + +   S  ++   L+ +    + N      ++ S P  S        +GS I ++   T++  +  +AN          GE+   + + F+     I ++ CKNL   +       PY+   LLPDRS + +R T V++N   P F +  KY +  A+L +R + V + H   L+ R + LG+VIIPL+  DF        RW+  +                + A+    ++P   GE+++  K V                       ++     Q  L+  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F+ V   +LR  SLE+T+W  +  G  +R++
Sbjct:    4 EIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHL----------QHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAV-CRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQLLQSYQKLSKISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSEKHLLATGPRQCVGQTERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFSGGFRHGSLISIDSTCTEM-GNFDNANVT--------GEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARR-VFLGEVIIPLATWDFEDSTTQSFRWHPLR----------------AKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQ--------------EAQEGTDQPSLHGQLCL----------------------VVLGAKNL--PVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQ---WKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLL 567          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 68.9366 bits (167), Expect = 1.194e-11
Identity = 60/240 (25.00%), Postives = 97/240 (40.42%), Query Frame = 1
Query:  925 PIPVEDHTTDVCKSVHDANSIQNPSFSPG---------GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            P PV   T  V   V +   ++     PG         G +   LD++F+  Q ++ + Q   L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S VD  RP+  W   Q       +  R E                 G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:   72 PTPVASATAQVQPEVEE---LEPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSD-PYVRVYLLPDKRRRYETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQ-------AAPREEEK--------------LGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 283          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 67.3958 bits (163), Expect = 3.370e-11
Identity = 52/202 (25.74%), Postives = 87/202 (43.07%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            G +   LD++F+  Q ++ + Q   L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S VD  RP+  W   Q    P   Q ++                  G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:  110 GRLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSS-DPYVRVYLLPDKRRRYETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQ--AAPREEQEKL------------------GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 287          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 60.077 bits (144), Expect = 3.333e-9
Identity = 46/186 (24.73%), Postives = 87/186 (46.77%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHV 1569
            G +  +LD++F+  Q  + + Q ++LP +D ++    PY+ + LLP   KK +  T V +    P+F++ F + + F E+ +++++  +   D  S  D  +GQV+IPL  +D    I  W      I P       E+S               G+I  ++++VP    +T     A +  ++ V
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMD-MSGTSDPYVKLYLLP--EKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHD-QIGQVLIPLGKIDLGAVIEEWKD----IAPPPDDKEAEKS--------------LGDICFSLRYVPTAGKLTVVILEAKNLKKMDV 324          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 60.077 bits (144), Expect = 3.747e-9
Identity = 46/186 (24.73%), Postives = 87/186 (46.77%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHV 1569
            G +  +LD++F+  Q  + + Q ++LP +D ++    PY+ + LLP   KK +  T V +    P+F++ F + + F E+ +++++  +   D  S  D  +GQV+IPL  +D    I  W      I P       E+S               G+I  ++++VP    +T     A +  ++ V
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMD-MSGTSDPYVKLYLLP--EKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHD-QIGQVLIPLGKIDLGAVIEEWKD----IAPPPDDKEAEKS--------------LGDICFSLRYVPTAGKLTVVILEAKNLKKMDV 324          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 58.9214 bits (141), Expect = 5.785e-9
Identity = 33/115 (28.70%), Postives = 65/115 (56.52%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFS 1356
            G +   ++++F  S+  + +    +LP +D  N +  PY+ V +LP+R +K         N   P +++ F++SI F EL S+++++++   D LS +D  +GQ+ +PL  +DF 
Sbjct:   85 GNIHFRVEYDFEQSKLSVTIVSASDLPAMDR-NGMSDPYVKVYVLPERKQKFETRIIR--NTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLS-KDDKMGQLSVPLESIDFG 195          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334289)

HSP 1 Score: 105.916 bits (263), Expect = 2.348e-23
Identity = 99/394 (25.13%), Postives = 167/394 (42.39%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP----------KGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVP 2160
            G+V   + +N+++S   + + +CK+L  +D   +   PY+ V LLPD+SK  +R T VKK+   PIFD+  ++    + LESR++ + + H D     D  LG+V + L    F  P  +WY  Q   EP                    +  Y G+I + +K++P          +G S+T ++++   FG       S+++VA                S    KG     ++       +K LS +   G      +  LLP RT S +  +P   ++ + S   W+    + +V +EEL  R+LE+T+W            H R      +            +G Q         E  +W  MLDR N WV+G++ L+     +  N+P
Sbjct:  264 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDF-LGEVSVNLQGRLFDNPQSQWYLLQERSEPF-----------------DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFG------GSIKSVASK--------------SERTSKGGQLHVLVKE-----AKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPS---WNYTFVYEDVSLEELSERALELTVW-----------DHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLDGIRANLP 600          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334288)

HSP 1 Score: 105.916 bits (263), Expect = 3.502e-23
Identity = 99/394 (25.13%), Postives = 167/394 (42.39%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP----------KGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVP 2160
            G+V   + +N+++S   + + +CK+L  +D   +   PY+ V LLPD+SK  +R T VKK+   PIFD+  ++    + LESR++ + + H D     D  LG+V + L    F  P  +WY  Q   EP                    +  Y G+I + +K++P          +G S+T ++++   FG       S+++VA                S    KG     ++       +K LS +   G      +  LLP RT S +  +P   ++ + S   W+    + +V +EEL  R+LE+T+W            H R      +            +G Q         E  +W  MLDR N WV+G++ L+     +  N+P
Sbjct:  372 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDF-LGEVSVNLQGRLFDNPQSQWYLLQERSEPF-----------------DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFG------GSIKSVASK--------------SERTSKGGQLHVLVKE-----AKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPS---WNYTFVYEDVSLEELSERALELTVW-----------DHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLDGIRANLP 708          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334290)

HSP 1 Score: 103.99 bits (258), Expect = 2.277e-22
Identity = 101/396 (25.51%), Postives = 165/396 (41.67%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP----------KGYSMTANANHADSFGE--LHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVP 2160
            G+V   + +N+++S   + + +CK+L  +D   +   PY+ V LLPD+SK  +R T VKK+   PIFD+  ++    + LESR++ + + H D     D  LG+V + L    F  P  +WY  Q   EP          F    T       Y G+I + +K++P          +G S+T ++++   FG     V  KS R     QL+                           +    +K LS +   G      +  LLP RT S +  +P   ++ + S   W+    + +V +EEL  R+LE+T+W            H R      +            +G Q         E  +W  MLDR N WV+G++ L+     +  N+P
Sbjct: 1231 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDF-LGEVSVNLQGRLFDNPQSQWYLLQERSEP----------FDEVAT-------YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLH---------------------------VLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPS---WNYTFVYEDVSLEELSERALELTVW-----------DHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLDGIRANLP 1567          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334293)

HSP 1 Score: 103.99 bits (258), Expect = 2.277e-22
Identity = 101/396 (25.51%), Postives = 165/396 (41.67%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP----------KGYSMTANANHADSFGE--LHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVP 2160
            G+V   + +N+++S   + + +CK+L  +D   +   PY+ V LLPD+SK  +R T VKK+   PIFD+  ++    + LESR++ + + H D     D  LG+V + L    F  P  +WY  Q   EP          F    T       Y G+I + +K++P          +G S+T ++++   FG     V  KS R     QL+                           +    +K LS +   G      +  LLP RT S +  +P   ++ + S   W+    + +V +EEL  R+LE+T+W            H R      +            +G Q         E  +W  MLDR N WV+G++ L+     +  N+P
Sbjct: 1231 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDF-LGEVSVNLQGRLFDNPQSQWYLLQERSEP----------FDEVAT-------YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLH---------------------------VLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPS---WNYTFVYEDVSLEELSERALELTVW-----------DHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLDGIRANLP 1567          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334287)

HSP 1 Score: 103.99 bits (258), Expect = 2.602e-22
Identity = 101/396 (25.51%), Postives = 165/396 (41.67%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP----------KGYSMTANANHADSFGE--LHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVP 2160
            G+V   + +N+++S   + + +CK+L  +D   +   PY+ V LLPD+SK  +R T VKK+   PIFD+  ++    + LESR++ + + H D     D  LG+V + L    F  P  +WY  Q   EP          F    T       Y G+I + +K++P          +G S+T ++++   FG     V  KS R     QL+                           +    +K LS +   G      +  LLP RT S +  +P   ++ + S   W+    + +V +EEL  R+LE+T+W            H R      +            +G Q         E  +W  MLDR N WV+G++ L+     +  N+P
Sbjct: 1181 GQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDF-LGEVSVNLQGRLFDNPQSQWYLLQERSEP----------FDEVAT-------YRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLH---------------------------VLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPS---WNYTFVYEDVSLEELSERALELTVW-----------DHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLDGIRANLP 1517          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Match: si:ch211-266g18.6 (si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121-599])

HSP 1 Score: 71.2478 bits (173), Expect = 3.508e-12
Identity = 51/182 (28.02%), Postives = 95/182 (52.20%), Query Frame = 1
Query: 1048 MSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            + + II++ QC++L   +       PY+   L PD+S++S+R T++KK    P+F +  +Y +N  EL  +S+ + + H +D   R++ LGQV +     D+    + WY+ Q    P  S+        +A+T+ SN     G +S+++K+VP      +      S GE+HVW++  + +
Sbjct:  537 VGELIIMIEQCQDLAIANPRKQRTDPYVKTYLYPDKSRRSKRKTTIKKRTVNPVFVESLRYKVNREELPEKSLNLSVWH-NDSRGRNVFLGQVELSFRTWDWGHEALTWYNLQ----PKTSE--------NAETKESN-----GLLSVSLKYVPSA----STGGSKSSTGEIHVWLREAKEL 696          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Match: sytl2b (synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-121214-363])

HSP 1 Score: 69.3218 bits (168), Expect = 1.427e-11
Identity = 53/198 (26.77%), Postives = 98/198 (49.49%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLS---FVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYF-GEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   L++  ++ +F I + QC+NL  +D   +   PY+   L+PD +   +R T+VKK    P +++I +Y +    L S+ + +   H +D+  R+  LG++ + LS   F D  R ++      L I                QT NS  P+   G++ LAI+ +P+     +++ +    GE+H+WVK  +N+
Sbjct: 1430 GSIQFSLNYVHKLREFHIFVVQCQNLAAVDAKRNRSDPYVKSYLIPDPANLGKRKTAVKKKTLNPTYNEILRYRVRMEYLTSQVLNLSAWH-NDMFGRNSFLGEIELDLSTWDFNDTERKLLPLKPRNLFI----------------QTTNSLQPSDLKGQMRLAIRFLPQ----ISHSKNVPGSGEVHIWVKDCKNL 1606          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 67.781 bits (164), Expect = 1.728e-11
Identity = 39/121 (32.23%), Postives = 69/121 (57.02%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRW 1374
            G++   LD+NF  +Q I+ + Q ++L  +D I     PY+ V LLPD+ KK       K    CP+F++ F + I +AEL  +++++ +   D     D+ +GQ+ IP++ VD ++P+  W
Sbjct:  135 GKLEFSLDYNFTDAQLIVGILQAQDLAAMD-IGGTSDPYVKVYLLPDKKKKFETKVQRKN--LCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDV-IGQIKIPMNCVDLAQPLHEW 251          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 67.781 bits (164), Expect = 2.071e-11
Identity = 39/121 (32.23%), Postives = 69/121 (57.02%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRW 1374
            G++   LD+NF  +Q I+ + Q ++L  +D I     PY+ V LLPD+ KK       K    CP+F++ F + I +AEL  +++++ +   D     D+ +GQ+ IP++ VD ++P+  W
Sbjct:  168 GKLEFSLDYNFTDAQLIVGILQAQDLAAMD-IGGTSDPYVKVYLLPDKKKKFETKVQRKN--LCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDV-IGQIKIPMNCVDLAQPLHEW 284          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 66.6254 bits (161), Expect = 3.267e-11
Identity = 42/166 (25.30%), Postives = 85/166 (51.20%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP 1509
            GE+L+ + ++++     +++R+C+ L   D        Y+   LLPD+S++S+R TS+K N   P+F++  +Y ++ ++LE+R++ V + H D     +  LG+  +     +F   I  W++ Q  IE     S               +  Y GE+++ +K++P
Sbjct:   45 GEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYVVSHSQLETRTLQVSVWHHDRFGHNNF-LGETELTFDSWEFDTQIEEWFALQPRIESDYVDS---------------VMHYKGELTVVLKYIP 194          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Match: slc41a1 (solute carrier family 41 member 1 [Source:Xenbase;Acc:XB-GENE-488920])

HSP 1 Score: 80.4925 bits (197), Expect = 5.622e-15
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   LD+   + +F + + QCK+L   D       PY+   LLP+++K  +R T VKK    P+++ + +Y IN   L S+++ + + H D L  R+  LG+V + L+  D+S   + WY           Q R   +    + R        GE+ LA+K+VP+ ++   NA      GE+H+W+K   N+
Sbjct:  616 GNIQFALDYADNLQEFQVFVSQCKDLAAADVKKQRSDPYVKAYLLPEKAKMGKRKTGVKKKTLNPVYNDVLRYKINKNALLSQTLNLSVWHHDVL-GRNSFLGEVDVNLASWDWSNKQMNWYPL---------QPRTPAAGIGLENR--------GEMKLALKYVPEAFTGAKNA----GTGEVHIWLKECTNL 787          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Match: slc41a1 (solute carrier family 41 member 1 [Source:Xenbase;Acc:XB-GENE-488920])

HSP 1 Score: 78.9518 bits (193), Expect = 5.690e-15
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   LD+   + +F + + QCK+L   D       PY+   LLP+++K  +R T VKK    P+++ + +Y IN   L S+++ + + H D L  R+  LG+V + L+  D+S   + WY           Q R   +    + R        GE+ LA+K+VP+ ++   NA      GE+H+W+K   N+
Sbjct:   72 GNIQFALDYADNLQEFQVFVSQCKDLAAADVKKQRSDPYVKAYLLPEKAKMGKRKTGVKKKTLNPVYNDVLRYKINKNALLSQTLNLSVWHHDVL-GRNSFLGEVDVNLASWDWSNKQMNWYPL---------QPRTPAAGIGLENR--------GEMKLALKYVPEAFTGAKNAGT----GEVHIWLKECTNL 243          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Match: slc41a1 (solute carrier family 41 member 1 [Source:Xenbase;Acc:XB-GENE-488920])

HSP 1 Score: 80.4925 bits (197), Expect = 5.861e-15
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   LD+   + +F + + QCK+L   D       PY+   LLP+++K  +R T VKK    P+++ + +Y IN   L S+++ + + H D L  R+  LG+V + L+  D+S   + WY           Q R   +    + R        GE+ LA+K+VP+ ++   NA      GE+H+W+K   N+
Sbjct:  562 GNIQFALDYADNLQEFQVFVSQCKDLAAADVKKQRSDPYVKAYLLPEKAKMGKRKTGVKKKTLNPVYNDVLRYKINKNALLSQTLNLSVWHHDVL-GRNSFLGEVDVNLASWDWSNKQMNWYPL---------QPRTPAAGIGLENR--------GEMKLALKYVPEAFTGAKNA----GTGEVHIWLKECTNL 733          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Match: slc41a1 (solute carrier family 41 member 1 [Source:Xenbase;Acc:XB-GENE-488920])

HSP 1 Score: 80.8777 bits (198), Expect = 5.931e-15
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   LD+   + +F + + QCK+L   D       PY+   LLP+++K  +R T VKK    P+++ + +Y IN   L S+++ + + H D L  R+  LG+V + L+  D+S   + WY           Q R   +    + R        GE+ LA+K+VP+ ++   NA      GE+H+W+K   N+
Sbjct: 1486 GNIQFALDYADNLQEFQVFVSQCKDLAAADVKKQRSDPYVKAYLLPEKAKMGKRKTGVKKKTLNPVYNDVLRYKINKNALLSQTLNLSVWHHDVL-GRNSFLGEVDVNLASWDWSNKQMNWYPL---------QPRTPAAGIGLENR--------GEMKLALKYVPEAFTGAKNA----GTGEVHIWLKECTNL 1657          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Match: SYTL4 (synaptotagmin like 4 [Source:NCBI gene;Acc:100495134])

HSP 1 Score: 80.1073 bits (196), Expect = 6.439e-15
Identity = 59/197 (29.95%), Postives = 102/197 (51.78%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVP--KGYSMTANANHADSFGELHVWVKSMRNVA 1596
            GE++  ++++ ++    I++++C+NL   D +     PY+   LLPD+S++ +R T++K+N   P+++++ KY +  + L  RS+ + + H D    R+  LGQV IPL            ++F  LIE  L         S A   NS      GE+ +++K+VP  K          AD  GELHVW+K  +N+ 
Sbjct:  383 GEIIFSINYDAKVQLLNILVKECRNLAYGDELKMRSNPYIKSYLLPDKSRQGKRKTTIKRNTTNPMYNEVLKYIVPESMLHLRSLELSVWHYDRF-GRNTFLGQVDIPLDS----------WNFDSLIEECLPLHGKGNMDSGAGFYNSK-----GELVVSLKYVPPTKPSGSERRKKKADEGGELHVWIKEAKNLT 563          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 85.5001 bits (210), Expect = 8.907e-17
Identity = 137/645 (21.24%), Postives = 244/645 (37.83%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRIS--------PNPVKEITQSHSPKRKLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPE----YSQKRTEHSPSFYINSELESEEEVKLDL--------SDDVVNSNKNYYRPL-SHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPI---VRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHV-PKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            ++DL    + E     +V+ R   +   E  R+R+LK+ +   ++ +      +++  K   C  C       + A+G    R ++ C+ C   VC  C   +   +   C  C +   +  KTG WF ++  ++       E         Y R+S        P P  E   S S + + L   R +N   E L      +M  +    +  ++ K  ++  P     ++++R++   +  + S   S  ++             D V+  +     P  S + S  L+   +GS I +    T++  +  +AN          GE+   + +  +     I ++ CKNL   +       PY+   LLPDRS + +R T V+KN   P F++  KY ++  +L +R + V + H   L+ R + LG+VI+PL+  DF        RWY  +                + A+    NIP   GE+++  K V P G      A                    Q  LN  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F  V   +LR  +LE+T+W  +  G  +R++
Sbjct:    4 EVDLESFKELERDIILRVLYRDQTVQSTEEERVRKLKSHL---QHLRWKGAKSSSQEYKEKCCARC-------QRALGLLLNRGAV-CQGCSHRVCSECRVFLRRTRAWKCTVCFEDRNVKIKTGEWFFEERARKFPTAGRRETAGAKLLQSYQRLSKISVVPPTPPPFSESQCSSSSRLQELGHFRGFNKSVENLFLSVTTQMRKLSKSQNDMTSEKHLLAMDPRQCVGHTERRSQSDTAVNVTSRKASTPDILKAFHQEDPKHPPDPVLKQDTPPSSPTHSAVFSGGLR---HGSLISINSTCTEM-GNFDNANVT--------GEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARR-VFLGEVILPLAMWDFKDSTAQNARWYPLR----------------AKAEKYEENIPQNNGELAVRAKLVLPAGPRKPQEAQE-----------------GQLALNGQLCL----------------------VVLGAKNL--PVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQ---WKHSFVFNGVSSSQLRQSTLELTVWDQAIFGMNDRLL 564          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 71.2478 bits (173), Expect = 1.487e-12
Identity = 77/319 (24.14%), Postives = 124/319 (38.87%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPI---VRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHV-PKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            GE+   + +  +     I ++ CKNL   +       PY+   LLPDRS + +R T V+KN   P F++  KY ++  +L +R + V + H   L+ R + LG+VI+PL+  DF        RWY  +                + A+    NIP   GE+++  K V P G      A                    Q  LN  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F  V   +LR  +LE+T+W  +  G  +R++
Sbjct:  112 GEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARR-VFLGEVILPLAMWDFKDSTAQNARWYPLR----------------AKAEKYEENIPQNNGELAVRAKLVLPAGPRKPQEAQE-----------------GQLALNGQLCL----------------------VVLGAKNL--PVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQ---WKHSFVFNGVSSSQLRQSTLELTVWDQAIFGMNDRLL 369          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Match: Sytl3 (synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:1933367])

HSP 1 Score: 71.2478 bits (173), Expect = 1.556e-12
Identity = 77/319 (24.14%), Postives = 124/319 (38.87%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPI---VRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHV-PKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            GE+   + +  +     I ++ CKNL   +       PY+   LLPDRS + +R T V+KN   P F++  KY ++  +L +R + V + H   L+ R + LG+VI+PL+  DF        RWY  +                + A+    NIP   GE+++  K V P G      A                    Q  LN  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F  V   +LR  +LE+T+W  +  G  +R++
Sbjct:  102 GEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARR-VFLGEVILPLAMWDFKDSTAQNARWYPLR----------------AKAEKYEENIPQNNGELAVRAKLVLPAGPRKPQEAQE-----------------GQLALNGQLCL----------------------VVLGAKNL--PVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQ---WKHSFVFNGVSSSQLRQSTLELTVWDQAIFGMNDRLL 359          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Match: Syt5 (synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368])

HSP 1 Score: 69.707 bits (169), Expect = 4.451e-12
Identity = 51/202 (25.25%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            G +   LD++F+  Q ++ + Q + L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S V+  RP+  W   Q  + P   Q ++                  G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:  110 GRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSS-DPYVSVYLLPDKRRRHETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQ--VAPKEEQEKL------------------GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 287          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 65.0846 bits (157), Expect = 1.445e-10
Identity = 35/125 (28.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQ 1386
            G++   LD++F+ +Q  + + Q   LP +D +     PY+ V LLPD+ KK             P F++ F + + + EL  +++++ +   D  S  D+ +G+V +P++ VD  +PI  W   Q
Sbjct:  144 GKLQFSLDYDFQANQLTVGVLQAAELPALD-MGGTSDPYVKVFLLPDKKKKYETKVHR--KTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDI-IGEVKVPMNTVDLGQPIEEWRDLQ 264          
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Match: sp|Q99N48|SYTL3_MOUSE (Synaptotagmin-like protein 3 OS=Mus musculus OX=10090 GN=Sytl3 PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 6.230e-16
Identity = 137/645 (21.24%), Postives = 244/645 (37.83%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRIS--------PNPVKEITQSHSPKRKLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPE----YSQKRTEHSPSFYINSELESEEEVKLDL--------SDDVVNSNKNYYRPL-SHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPI---VRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHV-PKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            ++DL    + E     +V+ R   +   E  R+R+LK+ +   ++ +      +++  K   C  C       + A+G    R ++ C+ C   VC  C   +   +   C  C +   +  KTG WF ++  ++       E         Y R+S        P P  E   S S + + L   R +N   E L      +M  +    +  ++ K  ++  P     ++++R++   +  + S   S  ++             D V+  +     P  S + S  L+   +GS I +    T++  +  +AN          GE+   + +  +     I ++ CKNL   +       PY+   LLPDRS + +R T V+KN   P F++  KY ++  +L +R + V + H   L+ R + LG+VI+PL+  DF        RWY  +                + A+    NIP   GE+++  K V P G      A                    Q  LN  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F  V   +LR  +LE+T+W  +  G  +R++
Sbjct:    4 EVDLESFKELERDIILRVLYRDQTVQSTEEERVRKLKSHL---QHLRWKGAKSSSQEYKEKCCARC-------QRALGLLLNRGAV-CQGCSHRVCSECRVFLRRTRAWKCTVCFEDRNVKIKTGEWFFEERARKFPTAGRRETAGAKLLQSYQRLSKISVVPPTPPPFSESQCSSSSRLQELGHFRGFNKSVENLFLSVTTQMRKLSKSQNDMTSEKHLLAMDPRQCVGHTERRSQSDTAVNVTSRKASTPDILKAFHQEDPKHPPDPVLKQDTPPSSPTHSAVFSGGLR---HGSLISINSTCTEM-GNFDNANVT--------GEIEFAIHYCVKSCSLEICIKTCKNLAYGEEKKRKCNPYVKTYLLPDRSSQGKRKTRVQKNTLDPTFEETLKYQVDPGQLMTRRLQVSVWHLGTLARR-VFLGEVILPLAMWDFKDSTAQNARWYPLR----------------AKAEKYEENIPQNNGELAVRAKLVLPAGPRKPQEAQE-----------------GQLALNGQLCL----------------------VVLGAKNL--PVRSDGTLNSFVKGCLTLPNQQKLRVKSPVLKKQACPQ---WKHSFVFNGVSSSQLRQSTLELTVWDQAIFGMNDRLL 564          
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Match: sp|Q4VX76|SYTL3_HUMAN (Synaptotagmin-like protein 3 OS=Homo sapiens OX=9606 GN=SYTL3 PE=1 SV=3)

HSP 1 Score: 81.2629 bits (199), Expect = 1.498e-14
Identity = 137/642 (21.34%), Postives = 242/642 (37.69%), Query Frame = 1
Query:  139 QIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSE---------YSRISP--------NPVKEITQSHSPKR-KLLHRLRSYNSVHEEL-----DEMENILTIHSPASNWKFQISDQPEY----SQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSC------SNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIV---RWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCL-LPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRII 1953
            +IDLS + + E     +V+ R  A+   E  R R+LKT +           H   K  KN         C   +  +G    R ++ CR C   VC  C   +       C  C +   +  KTG WF+++  K+       E         Y ++S          PV E   S SP R +   + R +N   E L       ++ +    +  ++ K  ++  P      +++R++   +  + +   S  ++   L+ +    + N      ++ S P  S        +GS I ++   T++  +  +AN          GE+   + + F+     I ++ CKNL   +       PY+   LLPDRS + +R T V++N   P F +  KY +  A+L +R + V + H   L+ R + LG+VIIPL+  DF        RW+  +                + A+    ++P   GE+++  K V                       ++     Q  L+  +C+                      +  G+  L   V   G      + CL LP +  ++  SP   +        W     F+ V   +LR  SLE+T+W  +  G  +R++
Sbjct:    4 EIDLSALKELEREAILQVLYRDQAVQNTEEERTRKLKTHL----------QHLRWKGAKNTDWEHKEKCCARCQQVLGFLLHRGAV-CRGCSHRVCAQCRVFLRGTHAWKCTVCFEDRNVKIKTGEWFYEERAKKFPTGGKHETVGGQLLQSYQKLSKISVVPPTPPPVSESQCSRSPGRLQEFGQFRGFNKSVENLFLSLATHVKKLSKSQNDMTSEKHLLATGPRQCVGQTERRSQSDTAVNVTTRKVSAPDILKPLNQEDPKCSTNPILKQQNLPSSPAPSTIFSGGFRHGSLISIDSTCTEM-GNFDNANVT--------GEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARR-VFLGEVIIPLATWDFEDSTTQSFRWHPLR----------------AKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQ--------------EAQEGTDQPSLHGQLCL----------------------VVLGAKNL--PVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQ---WKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLL 567          
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Match: sp|Q9R0N5|SYT5_MOUSE (Synaptotagmin-5 OS=Mus musculus OX=10090 GN=Syt5 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.114e-11
Identity = 51/202 (25.25%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            G +   LD++F+  Q ++ + Q + L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S V+  RP+  W   Q  + P   Q ++                  G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:  110 GRLQYSLDYDFQTGQLLVGILQAQGLAALDLGGSS-DPYVSVYLLPDKRRRHETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQ--VAPKEEQEKL------------------GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 287          
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Match: sp|P47861|SYT5_RAT (Synaptotagmin-5 OS=Rattus norvegicus OX=10116 GN=Syt5 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.170e-11
Identity = 51/202 (25.25%), Postives = 89/202 (44.06%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            G +   LD++F+  Q ++ + Q + L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S V+  RP+  W   Q  + P   Q ++                  G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:  110 GRLQYSLDYDFQTGQLLVGILQAEGLAALDLGGSS-DPYVSVYLLPDKRRRHETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVNLGRPVQAWRELQ--VAPKEEQEKL------------------GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 287          
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Match: sp|O00445|SYT5_HUMAN (Synaptotagmin-5 OS=Homo sapiens OX=9606 GN=SYT5 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 1.618e-10
Identity = 52/202 (25.74%), Postives = 87/202 (43.07%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSN 1617
            G +   LD++F+  Q ++ + Q   L  +D   S   PY+ V LLPD+ ++             P F + F + + + EL  R +LVM  +  D  SR+ A+G+V +P+S VD  RP+  W   Q    P   Q ++                  G+I  ++++VP    +T     A +  ++ V   S   V  H L   
Sbjct:  110 GRLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSS-DPYVRVYLLPDKRRRYETKVHR--QTLNPHFGETFAFKVPYVELGGR-VLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQ--AAPREEQEKL------------------GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGG 287          
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Match: A0A267EUU3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000604g1 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.423e-29
Identity = 109/382 (28.53%), Postives = 160/382 (41.88%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPY------RTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGM----IEEKMWAAMLDRSNTWVDGTIKLK 2127
            G V + LDFNF+ S F + + +C++LP  D        Y+   LLPD+++ ++R T VKKN  CPIFD+  KY I+  +LE+R + V   H   L   D  LG++ I L+         RW+ F+   EP+ S+ ++                Y GE++L++K+V  G     +     S GEL VW+K  RN+A                                     S  L AVA      P  ++CLLP         S   T P +     S   VW+ +LKF NV V EL +R LE+T+W   +       + P     +       D D +          S        E +MW  +L R N W+DG   L+
Sbjct:  286 GAVKLALDFNFKTSAFAVHIIECRDLPAADARRGRTDCYVKTCLLPDQTRGAKRRTKVKKNSLCPIFDEKLKYRISAPDLETRKLRVSAWHSSALLQPDRPLGELEISLTSAQLDCREARWFRFRAPAEPAASELQLAHR------------KYIGEVTLSLKYVTAGSVSITDIRQVASRGELRVWIKEARNLA-------------------------------------SGRLGAVAA----DPYVKLCLLPVPGQSGGLASKLRTPPVR----RSCSPVWNLVLKFENVSVAELHSRRLELTVWDKYR-------LVPGTKTCLGCVLLQCDHDGALASSAVSSSLSPSPARQSAESRMWRTVLQRHNVWIDGNFLLR 603          
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Match: A0A267FAN9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000924g1 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 5.338e-27
Identity = 109/378 (28.84%), Postives = 167/378 (44.18%), Query Frame = 1
Query: 1015 EVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT--SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVN-----SKHGWLNRII-HPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKL 2124
            EV + L+FNF+ + F + + +C+ LP  D        Y+   LLPD++ K++R T VKKN   PIFD+  KYSI  ++LE+R + V   H  DL   D+ LG++ +P+S          W+SF     P+ S   +E   + ++        Y GE++L++K+V        + N   S GEL +WVK  R+           +P SR  S   D                              P  ++CLLP R+  S + T P     + S   VW+ +LKF N+ V EL +R+LE+T+W N      K  +L  ++ H                    R     +       E +MW  +L+R N WVDG + L
Sbjct:  149 EVKLALEFNFKSAVFQVHVIECRGLPFGDAKKGRTDCYVRTCLLPDQTHKAKRRTKVKKNTQSPIFDEKLKYSITLSDLETRKLHVSAWHSTDLLQSDVLLGELELPMSLSTLQCKDALWFSFH---RPAPS---LELQLAHSK--------YVGEVTLSLKYVTSDNVNITDINQVVSCGELRIWVKEARH-----------LPSSRLGSQPAD------------------------------PYVKLCLLPDRSAKSKRKTPPV----QKSCSPVWNLVLKFENMSVRELHSRALELTVWDNYRLVPGKKVFLGGVVLHFDRDNFSVATATAAAPSQVDRRSPSPKSPMRVSDEVRMWRTVLERHNVWVDGNLLL 467          
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Match: A0A4Y2HTX5 (Synaptotagmin-like protein 5 OS=Araneus ventricosus OX=182803 GN=Sytl5 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 6.216e-23
Identity = 99/391 (25.32%), Postives = 166/391 (42.46%), Query Frame = 1
Query:  964 SVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSF---GELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLK 2127
            SV+ A      S +  G+VL  L++N +     + +++C+NL  ID  ++   PY+ V LLPD+++  +R T  KKN   P+F+++ ++ +   ELESR++ + + +  DL  R+  LG++ +PL +     P +RWY           Q R+E   S  Q+R        GE+ +A+K+VP+  S+ +    A      G LHV VK  RN++                                            AQ G      +  LLP ++          +  N  ++ ++ I  + ++ VEELR RSLE+T+W            H +      +     +      HG           E  +W +MLD  N WVDG + L+
Sbjct: 2269 SVYSAAGCHYGSVTVSGDVLFGLNYNQKSQMMEVFIKECRNLAAIDIRHNKSNPYVKVYLLPDKTRSGKRKTKTKKNSVNPVFNELLRFPVLKNELESRTLWLSVWNS-DLFGRNDFLGEISLPLGYRLLDSPTLRWYPL---------QDRVESLQSPLQSR--------GELFIALKYVPRDLSLESRFRPAPVISLRGALHVLVKEARNIS--------------------------------------------AQRGSMDAFCKSYLLPDKSKAAKQKTPVVRKSNHPKWYYTVI--YEDLSVEELRERSLELTVW-----------DHDKIARNHFVGGVRLNVGTGLYHGVPVDWMDGRRDESSLWLSMLDSPNMWVDGCLPLR 2584          
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Match: A0A2T7P712 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11807 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.243e-22
Identity = 107/409 (26.16%), Postives = 169/409 (41.32%), Query Frame = 1
Query:  937 EDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANH----------ADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKM-WAAMLDRSNTWVDGTIKLK 2127
            ED    +     +A  I        G+++  LD++ R S   I +R C+N+  +DT ++   PY+ V LLPD+++  +R T +KK+   P+F+++  Y+I+  ELE+R++ V + H D     D  LG+V+I +    F  P    YS          QSR + S   A         Y GE+SL++ +V       A+             A+  GE+HV +KS  N                                          L+AV   G + P  +  LLP R  + +  +P    + N S   WS IL F  +  EE+  RSLE+T+W + K G  N  +    +        G   D     G           EE M W A+++R N W+D  + L+
Sbjct:  106 EDSRESLASVYSNAGEINYGRIPVTGDIVFGLDYDHRHSVLKIDVRNCQNIAPVDTKHNRSDPYVKVYLLPDKTRSGKRKTKIKKHTLNPVFNEVLTYNISRGELENRTLWVTVWHSDRFGRNDF-LGEVLIAMDTYRFDDPSPCAYSL---------QSRAQESVGEAMQ-------YKGELSLSLMYVTPEKVAAASQKSKSKLKKSKSAAEPMGEIHVMIKSASN------------------------------------------LTAVRSNGTSDPFVKGYLLPDRARNGKQKTPVVKNTVNPS---WSHILVFDGITPEEIPERSLELTVWDHEKLG-TNEFLGGVRLNTGLGVAKGLQVDWMDARG-----------EEAMAWQAIMERHNVWIDARLPLR 440          
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Match: A0A131XGS8 (Putative ca2+-dependent phospholipid-binding protein synaptotagmin (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.469e-22
Identity = 106/411 (25.79%), Postives = 181/411 (44.04%), Query Frame = 1
Query:  904 KSCSNGSPIPVEDHTTDVCKSVHDA-NSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIE-PSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRT-SMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLK 2127
            +S ++ S I V    ++   SV+ A    +  + +  GEVL  + +N++     + +R+C+NL  +DT  +   PY+ V LLPD++K  +R T VKK+   P+F+++ K+ +  +EL++R++ + + H D     D  LG+V++PL++    +  VR ++ Q   E P +  S                  Y G+I LA+K++P   + + +       G LHV VK  RN                                          L+A    G + P  +  LLP RT   +  +P   +  N     W+    + +V ++EL+ R LE+TIW   K    N  +    +G       GRD D    HG           E  +W +ML+R N W+DG++ L+
Sbjct:   75 RSQTSLSSIGVSQMRSESMTSVYSAAGGGRYGTVAVTGEVLFSILYNYKSGLLEVHVRECRNLAPVDTKRNRSDPYVKVYLLPDKTKSGKRKTKVKKHTLNPVFEEVLKFRVTMSELQARTLWLSVWHSDMFGRNDF-LGEVMLPLTYETLEKTEVRCFALQERFECPEVPLS------------------YKGDILLALKYMPPDVT-SRSIKQGPVRGSLHVLVKEARN------------------------------------------LTATRSNGTSDPFCKSYLLPDRTKGSKQKTPVVKKCCNPK---WNHTFVYPDVSLDELKDRCLELTIWDYDKIT-SNDFLGGVRLGLGTGKLYGRDVDWMDSHGE----------EVTLWRSMLERPNLWIDGSLLLR 409          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:103029888])

HSP 1 Score: 76.2554 bits (186), Expect = 3.522e-14
Identity = 52/186 (27.96%), Postives = 91/186 (48.92%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHV 1569
            G++   LD+NF  +Q I+ + Q ++L  +D I     PY+ V LLPD+ KK       K    CP+F++ F + I +AEL  + ILV+L +  D   +   +GQ+ IP++ VD  +P+ +W                 R   SA+          G++ +++++VP    +T N   A +  ++ V
Sbjct:  164 GKLEFSLDYNFTEAQLIVGILQAQDLAAMD-IGGTSDPYVKVFLLPDKKKKFETKVQRKN--LCPVFNETFIFKIPYAELGGK-ILVLLVYDFDRFGKHDVIGQIKIPMNCVDLGQPLHQW-----------------RDLESAEKEEQE---KLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDV 325          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 68.5514 bits (166), Expect = 1.545e-11
Identity = 67/302 (22.19%), Postives = 134/302 (44.37%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIW 1917
            GE+L+ + ++++     +++R+C+ L   D       PY+   LLPD+S++S+R TS+K N   P+F+   +Y ++ ++LE+R++ V + H D        LG+  +     +F   I  W++ Q   E S+                 ++  Y GE+++ +K++P      A  N +    ++ V    ++         +I +P           G+ E      +    +K L+AV + G + P  +  LLP     +ST    +  + S    W+    +  +   +L +  LE+T+W
Sbjct:  372 GEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSF-LGETELTFDSWEFDTQIEEWFALQPRAEGSV----------------DSMIQYKGELTVVLKYIP------AERNLSLPLDQIQVKKGFLKG------KKSITLPKG---------GMVE------LLVKEAKNLTAV-KSGSSDPFVKGYLLP--DDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVW 626          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Match: sytl2b (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:103046737])

HSP 1 Score: 68.9366 bits (167), Expect = 1.547e-11
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   L++  ++ +F I + QCKNL  +D   +   PY+   L+ D S   +R TSVKK    P +++I +Y +    L+++ + + + H D    R+  LG++ I LS  DF    ++  S          +SR   S   A  R        GEI LA++ +P+   +T +    +S GE+H+WVK  +N+
Sbjct: 1513 GTIQFSLNYVQKLREFHIFVVQCKNLAAVDPKKNRSDPYVKSYLISDSSNLGKRKTSVKKRTLNPTYNEILRYRVRMEYLKTQVLNLSVWHNDTF-GRNSFLGEIEIDLSTWDFGNTKIKSLSL---------KSRTTSSIQPADDR--------GEIRLAVRFLPQ---LTHSKTVPNS-GEVHIWVKDCKNL 1684          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Match: sytl2b (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:103046737])

HSP 1 Score: 68.9366 bits (167), Expect = 1.752e-11
Identity = 56/194 (28.87%), Postives = 96/194 (49.48%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   L++  ++ +F I + QCKNL  +D   +   PY+   L+ D S   +R TSVKK    P +++I +Y +    L+++ + + + H D    R+  LG++ I LS  DF    ++  S          +SR   S   A  R        GEI LA++ +P+   +T +    +S GE+H+WVK  +N+
Sbjct: 1513 GTIQFSLNYVQKLREFHIFVVQCKNLAAVDPKKNRSDPYVKSYLISDSSNLGKRKTSVKKRTLNPTYNEILRYRVRMEYLKTQVLNLSVWHNDTF-GRNSFLGEIEIDLSTWDFGNTKIKSLSL---------KSRTTSSIQPADDR--------GEIRLAVRFLPQ---LTHSKTVPNS-GEVHIWVKDCKNL 1684          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 68.1662 bits (165), Expect = 1.940e-11
Identity = 67/302 (22.19%), Postives = 134/302 (44.37%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIW 1917
            GE+L+ + ++++     +++R+C+ L   D       PY+   LLPD+S++S+R TS+K N   P+F+   +Y ++ ++LE+R++ V + H D        LG+  +     +F   I  W++ Q   E S+                 ++  Y GE+++ +K++P      A  N +    ++ V    ++         +I +P           G+ E      +    +K L+AV + G + P  +  LLP     +ST    +  + S    W+    +  +   +L +  LE+T+W
Sbjct:  350 GEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSF-LGETELTFDSWEFDTQIEEWFALQPRAEGSV----------------DSMIQYKGELTVVLKYIP------AERNLSLPLDQIQVKKGFLKG------KKSITLPKG---------GMVE------LLVKEAKNLTAV-KSGSSDPFVKGYLLP--DDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVW 604          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 5.208e-15
Identity = 50/166 (30.12%), Postives = 86/166 (51.81%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERS-FSSAQTRNSNIPAYFGEISLAIKHV 1506
            G++   + +++R+    + LRQC+NL   +       PY+ V LLPD+S++ +R T +KKN   P+F++  KY+I+  +LE R + + + H D        LGQ  +PL   D  R   RW +          Q R+ R+ F++   +      Y GE+ LA+K++
Sbjct:    3 GDINFSVSYDYRVGVLSLTLRQCRNLAYGEERTKRCDPYVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYAISHTQLEVRCVHLSVWHHDSFRHNSF-LGQASLPLDCCDLERGDDRWCAL---------QPRVTRNPFAAINNK------YKGELILALKYI 152          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Match: SYT5 (synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513])

HSP 1 Score: 63.929 bits (154), Expect = 8.034e-12
Identity = 46/125 (36.80%), Postives = 69/125 (55.20%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQ 1386
            G +   LD+N + SQF + + Q  +L  +D I  +  PY+ V LLP   KK +  TSV +    PIF++ F +++ F EL  R +LVM+ +  D  SR   +G++ IPLS VD S  +  W   Q
Sbjct:   80 GRLQFSLDYNLKTSQFTVGILQATDLAAMD-IGGMSDPYVRVYLLP--HKKKKFETSVHRKTLNPIFEEKFTFTVPFEELVER-VLVMVVYDFDRFSRHDIIGELRIPLSSVDLSHSVEEWRDLQ 200          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 60.4622 bits (145), Expect = 2.456e-10
Identity = 46/158 (29.11%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 1126 YLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSM--TANANHADSFGELHVWVKSMRNV 1593
            Y+   LLPD+S++S++ T+V+KN   P++++I KY I   EL+SR + + + H D        LG+V + LS  D+      W+  Q    P+L      +  +S            G ++LA+K +P       T       + GE+H+WVK  +N+
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSF-LGEVEMELSTWDWGNTAYNWFDLQPRTSPAL------KDLTSR-----------GYLNLALKFIPANSVAPPTPEGQFTPASGEIHIWVKEAKNL 140          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 59.6918 bits (143), Expect = 4.194e-10
Identity = 48/157 (30.57%), Postives = 79/157 (50.32%), Query Frame = 1
Query: 1126 YLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKG-YSMTANANHADSFGELHVWVKSMRNV 1593
            Y+   LLPD+S++S++ T+V+KN   P++++I KY I   EL+SR + + + H D        LG+V + LS  D+      W+           Q R+  S     +R        G ++LA+K +P      T NA+     GE+H+WVK  +N+
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSF-LGEVEMELSTWDWGNTAYNWFDL---------QPRVHISQEDLTSR--------GYLNLALKFIPANSVGKTKNAS-----GEIHIWVKEAKNL 134          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 53.5286 bits (127), Expect = 3.306e-8
Identity = 31/136 (22.79%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSR 1419
            G++   +D++F+ +Q  + + Q   LP +D +     PY+ + L+PD+ KK             P+F++ F + + ++EL  +++++ +   D  S  D+ +G+V +P++ +D    I  W       +  +S++R
Sbjct:   98 GKLQFSIDYDFQNNQLTVGVIQAAELPALD-MGGTSDPYVKLFLMPDKKKKYETKVHR--KTLNPVFNESFVFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEVKVPMNTIDLGHVIEEWRDLVSAEKEEVSRAR 229          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Nematostella
Match: EDO32931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM9])

HSP 1 Score: 56.9954 bits (136), Expect = 2.487e-8
Identity = 41/128 (32.03%), Postives = 76/128 (59.38%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLS---SRDLALGQVIIPLSFVDFSRPIVRWYSFQ 1386
            G+V + + ++ + S+ I+   + ++L   D+ + +  PY+   +LPD+SK +RR T + KN   P FD+ F++ I  A+L+ R++ V +  K+D+S       ++GQV+I L  +D S+PI  WY  +
Sbjct:  632 GDVYLTIRYDSQGSKLIVTDMKARDLMPCDS-DGLADPYMRSYVLPDKSKSNRRRTDIAKNTLSPSFDEKFEWMIPEAQLKDRTLDVTV--KNDVSFFSKSKTSMGQVLIDLGKLDLSKPISAWYMLR 756          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 76.6406 bits (187), Expect = 4.904e-14
Identity = 69/302 (22.85%), Postives = 132/302 (43.71%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIW 1917
            GE+L+ + ++++     +++++C NL   D        Y+   LLPD+S++S+R TS+K N   P+F++  +Y I+ ++LE R++ V + H D        LG+V +     +F   I  WY+          Q R++ S  S          Y GE+++ +K++P   + T   +           V+  +   + +  S+  +P           G+ E      +    +K L+AV   G + P  +  LLP   S +ST    +    +    W+    +  +   +L    LE+T+W
Sbjct:  417 GEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYVISHSQLELRTLQVSVWHHDRFGYNSF-LGEVELSFDSWEFDSQIEEWYAL---------QPRVDGSTDSTM-------HYKGELTVVLKYIPAEINTTPPPDQ----------VQVKKGFLKGKKTSSFTLPKG---------GMVE------LLVKGAKNLTAVKAGGYSDPFVKGYLLP--DSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVW 674          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 75.485 bits (184), Expect = 1.103e-13
Identity = 69/302 (22.85%), Postives = 132/302 (43.71%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIW 1917
            GE+L+ + ++++     +++++C NL   D        Y+   LLPD+S++S+R TS+K N   P+F++  +Y I+ ++LE R++ V + H D        LG+V +     +F   I  WY+          Q R++ S  S          Y GE+++ +K++P   + T   +           V+  +   + +  S+  +P           G+ E      +    +K L+AV   G + P  +  LLP   S +ST    +    +    W+    +  +   +L    LE+T+W
Sbjct:  354 GEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYVISHSQLELRTLQVSVWHHDRFGYNSF-LGEVELSFDSWEFDSQIEEWYAL---------QPRVDGSTDSTM-------HYKGELTVVLKYIPAEINTTPPPDQ----------VQVKKGFLKGKKTSSFTLPKG---------GMVE------LLVKGAKNLTAVKAGGYSDPFVKGYLLP--DSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVW 611          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Match: syt5b (synaptotagmin-1-like [Source:NCBI gene;Acc:101156534])

HSP 1 Score: 71.2478 bits (173), Expect = 1.519e-12
Identity = 47/180 (26.11%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 1030 LDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHV 1569
            LD+NF  SQ I+ + Q ++L  +D +     PY+ V LLPD+ KK       K    CP+F++ F + I +AEL  +++++ +   D  S  D+ +G + IP++ VD  +P+ +W                 R   S +     +    G++ +++++VP    +T N   A +  ++ V
Sbjct:  152 LDYNFTDSQLIVGILQAQDLAAMD-MGGTSDPYVKVFLLPDKKKKYETKVQRKN--LCPVFNETFIFKIPYAELGGKTLVMQVFDFDRFSKHDM-IGDIKIPMNSVDLGQPLQQW-----------------RDLESVEKEEEKL----GDVCISLRYVPTAGKLTVNIMEAKNLKKMDV 306          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Match: syt5a (synaptotagmin-1 [Source:NCBI gene;Acc:101166053])

HSP 1 Score: 70.0922 bits (170), Expect = 2.967e-12
Identity = 46/186 (24.73%), Postives = 92/186 (49.46%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHV 1569
            G++   LD+NF  +Q I+ + Q ++LP +D +     PY+ V +LPD+ KK       K    CP+F++ F + I ++EL  +++++ +   D     D+ +G++ IP++ +D  +PI  W    L+      Q ++                  G+I +++++VP    +T N   A +  ++ V
Sbjct:  117 GKLEYSLDYNFTDNQLIVGILQAQDLPAMD-MGGTSDPYVKVYMLPDKKKKFETKVQRKN--LCPVFNETFTFKIPYSELGGQTLVLQVFDFDRFGKHDV-IGEIKIPMNSIDLGQPIHEWKD--LVGGEKEEQEKL------------------GDICISLRYVPTAGKLTVNIMEAKNLKKMDV 278          
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Match: ENSORLT00000041991.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 69.707 bits (169), Expect = 8.718e-12
Identity = 47/194 (24.23%), Postives = 93/194 (47.94%), Query Frame = 1
Query: 1012 GEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNV 1593
            G +   +++  R+ +F I + +C++L  +D       PY+   L+PD++   +R TSVKK    P F++I +Y +    L+++ +++ + H D    R+  LG+V + LS  DF    + + + +    P++  +                    GE+ LAI+ +P+       A    + GE+H+WVK  + +
Sbjct:  926 GNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYRVRMDYLQTQMLVLSVWHHDTFG-RNSFLGEVDVDLSKWDFDHTQMNYLALKAKTMPTVEPTNGR-----------------GEMRLAIRFLPQISHSEGVAKDISNSGEIHIWVKDCKGL 1101          
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 1362.05 bits (3524), Expect = 0.000e+0
Identity = 690/692 (99.71%), Postives = 692/692 (100.00%), Query Frame = 1
Query:   91 MSAMSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 2166
            MSAMSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKK+VLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSA+AQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF
Sbjct:    1 MSAMSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKIVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAIAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 692          
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 1357.04 bits (3511), Expect = 0.000e+0
Identity = 687/689 (99.71%), Postives = 689/689 (100.00%), Query Frame = 1
Query:  100 MSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 2166
            MSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKK+VLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSA+AQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF
Sbjct:    1 MSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKIVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAIAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 689          
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Match: SMESG000014370.1 (SMESG000014370.1)

HSP 1 Score: 1318.14 bits (3410), Expect = 0.000e+0
Identity = 668/670 (99.70%), Postives = 670/670 (100.00%), Query Frame = 1
Query:  157 MTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 2166
            MTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKK+VLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSA+AQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF
Sbjct:    1 MTQDEIADFEKVMNRIDAINELEANRIRRLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRSSILCRICQLPVCHSCWRSVVDKKLKICPSCHKKIVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAIAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF 670          
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Match: SMESG000078217.1 (SMESG000078217.1)

HSP 1 Score: 151.369 bits (381), Expect = 7.520e-38
Identity = 187/753 (24.83%), Postives = 333/753 (44.22%), Query Frame = 1
Query:  142 IDLSEMTQDEIADFEKVMNRIDAINELEANRIRRLKTL--------IISQENAK---LSSVH---------------PNNKALKNLL--CHSCGSYCLSSRIAIGKSSTRS--SILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQM-KKRLSVDQSSEYSRISPNP----------VKEI------------------TQSHSPKRKL----LHRLRSYNSVHEELDEMENILT----IHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELE-SRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSSAQ---TRNSNIPAYF-------------------GEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVP-PSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIWVNSKHGWLNRIIHPXXXXXXXXXXXXXDCDASPRHGNQCRGASTGMIEEKMWAAMLDRSNTWVDGTIKLK 2127
            ++L  +T+ E    E V+NR + +N+ E  R+R+L +         I  + N     L+S H                NN    NL+  C SCG      R +I   S  S     C +C+  +C  C   +    ++IC SCHK ++ +AK+G WF+  + K+  SVD     S I  +            KE                    +S  PKRK       R+ S N ++   +  EN+ +    I+    ++    ++  + + K  +   +  ++ E  SE  +K+       +++K Y+RPL  ++     +          D +++  K V              GE+++ L ++   S   + + +CKNL   D   + I PY+ + + P+  K+S++ T    +   P+F++ F  ++     + ++S++ +LCHK+D + +DLA+GQ+I+    +     I +W +F  ++  S  +S I      +Q   + N+ +P+                     GE+S+AIK+V   YS     N      ELH+WVKS R       +++I      + F +SD+   + SK     S  ++K L+ +  FG    VA+  L            A    EN SQY+WS+I+KF + D+ EL+T +LE+++W++S + +LN+I+  +C+G V L     +  +      Q    S    E ++W AML++ N W+D T+ LK
Sbjct:   14 VELEFLTESEKKKLEVVLNRNEKLNKKEHARLRKLSSTESESTFVEICPEYNLSTRSLNSCHLYRNSVSEIMKENFKKNNTLEINLIGNCISCGR-----RFSILPWSCASPNGSSCILCKSKMCKKCTHHMDRPNVEICKSCHKNILFEAKSGKWFYNNINKEEPSVDSIRSSSAIGNDRWTSSEKIISFKKEFGSADQLENTGMQTQSSISARSFLPKRKFNNSAYFRIESPNRLNLSPETTENVTSPFRRINKHFKSYYLNTNNYIDATLKSEDSGCALDMDDETASECALKVSTGTIFGSNSKCYFRPLQILNQNTTNNNL--ITNDSSDMSSNQSKFV--------------GEIMLSLLYDDNTSTVNVTVHKCKNLVSADPEMNCINPYIILFVRPNPLKQSKKKTRTHYSTNSPVFEEYFTINLEIGSHDFNQSLIFLLCHKNDKTGKDLAVGQLILTADDIIHCDQINQWCNFNRMVSSSDHRSVISHQSDISQRYKSSNNILPSPLSDCITFSNNDLVNPDFTIAGELSIAIKYVT-FYSNNKPVN------ELHLWVKSARFTDIESSSNDINEKNTGKTFKSSDNNISSNSKCSAKKSSTNNKWLNDM--FGYQNIVAKSHLFTNHGVHSKEISATKYLENESQYIWSSIMKFES-DLTELKTSTLEISLWIHSNNAFLNKILPSKCIGSVFLGINNENQKSGTLRDKQYHFKSIN--ENRLWQAMLNKHNIWIDETLVLK 733          
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Match: SMESG000074360.1 (SMESG000074360.1)

HSP 1 Score: 78.5666 bits (192), Expect = 7.882e-15
Identity = 125/521 (23.99%), Postives = 205/521 (39.35%), Query Frame = 1
Query:  400 CRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKKRLSVDQSSEYSRISPNPVKEITQS-HSPKRKLLHRLRSYNSV--HEELDEMENILTIHSPASNWKFQISDQPEYSQKRTEHSPSFY---INSELESEEEVKLDLSDDVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQNPSFSP-------GGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVLLLPDXXXXXXXXXXXXXNCFCPIFDQIFKYSINFAELESRSILVMLCHKDDLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIE-PSLSQSRIERSFSSAQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRNVAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFGQNQPVARVCLLPYRTSM-QSTSPAKSQSENSSQYVWSTILKFTNVDVEELRTRSLEVTIW 1917
            C  C+  +C+ C  +++ K  +IC  C+ K   D KTG WF    K            R   NP   +  S    K K         S+     +   E+I TI S  S         P Y +K  + SP+     IN      +E  +D+ D   N  ++  +  + +  QP    S     P    T       H +NSI + ++          G+VL  + +N       I + QC+NL   D       PY+   LLPD++K S++ ++ K++   PIF +   Y+++   L +R++ V + HK  L + +  LG+V + L+ +D S+    WY  Q  +  P+ S   I                Y GE+ + +K+ P        +   D  G LHV +     V   QL                              F    L   V  F          LLP R++  +  +P +  + N     W ++L+F++V +EEL+ RSLE++I+
Sbjct:  100 CSECKKGICNGC-TAIMFKDERICYLCYLKACKDLKTGKWFAVTSKLN---------GRFRRNPAAVLVNSMRKLKSKPPPPPIPNGSIVSKGSIGSKESIDTIGSVGSIKSIGSKHIPIYLRK--DESPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSET-LELQPRSQTSAHYLHPTNLETLKTMS--HSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCQNLAVADRNKRQTNPYIKTYLLPDKTKTSKKKSTSKRSNINPIFKETLIYNVSKESLSARTLSVGVWHK-RLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHI----------------YKGELIIKLKYKP--------STRRDGKGSLHVLI-----VEAQQL-----------------------------EFDGQSLNVYVKGF----------LLPDRSNKGKKKTPVQKSTSNIK---WDSLLQFSDVTLEELKDRSLELSIY 533          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL33.119e-1521.34synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL33.119e-1521.34synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL33.119e-1521.34synaptotagmin like 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYT51.194e-1125.00synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
SYT53.370e-1125.74synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
snt-13.333e-924.73Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-13.747e-924.73Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-25.785e-928.70Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btsz2.348e-2325.13gene:FBgn0266756 transcript:FBtr0334289[more]
btsz3.502e-2325.13gene:FBgn0266756 transcript:FBtr0334288[more]
btsz2.277e-2225.51gene:FBgn0266756 transcript:FBtr0334290[more]
btsz2.277e-2225.51gene:FBgn0266756 transcript:FBtr0334293[more]
btsz2.602e-2225.51gene:FBgn0266756 transcript:FBtr0334287[more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-266g18.63.508e-1228.02si:ch211-266g18.6 [Source:ZFIN;Acc:ZDB-GENE-131121... [more]
sytl2b1.427e-1126.77synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-12... [more]
syt5b1.728e-1132.23synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
syt5b2.071e-1132.23synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
sytl53.267e-1125.30synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc41a15.622e-1528.87solute carrier family 41 member 1 [Source:Xenbase;... [more]
slc41a15.690e-1528.87solute carrier family 41 member 1 [Source:Xenbase;... [more]
slc41a15.861e-1528.87solute carrier family 41 member 1 [Source:Xenbase;... [more]
slc41a15.931e-1528.87solute carrier family 41 member 1 [Source:Xenbase;... [more]
SYTL46.439e-1529.95synaptotagmin like 4 [Source:NCBI gene;Acc:1004951... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sytl38.907e-1721.24synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl31.487e-1224.14synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl31.556e-1224.14synaptotagmin-like 3 [Source:MGI Symbol;Acc:MGI:19... [more]
Syt54.451e-1225.25synaptotagmin V [Source:MGI Symbol;Acc:MGI:1926368... [more]
Syt21.445e-1028.00synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99N48|SYTL3_MOUSE6.230e-1621.24Synaptotagmin-like protein 3 OS=Mus musculus OX=10... [more]
sp|Q4VX76|SYTL3_HUMAN1.498e-1421.34Synaptotagmin-like protein 3 OS=Homo sapiens OX=96... [more]
sp|Q9R0N5|SYT5_MOUSE3.114e-1125.25Synaptotagmin-5 OS=Mus musculus OX=10090 GN=Syt5 P... [more]
sp|P47861|SYT5_RAT3.170e-1125.25Synaptotagmin-5 OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|O00445|SYT5_HUMAN1.618e-1025.74Synaptotagmin-5 OS=Homo sapiens OX=9606 GN=SYT5 PE... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EUU32.423e-2928.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FAN95.338e-2728.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Y2HTX56.216e-2325.32Synaptotagmin-like protein 5 OS=Araneus ventricosu... [more]
A0A2T7P7121.243e-2226.16Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A131XGS82.469e-2225.79Putative ca2+-dependent phospholipid-binding prote... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5b3.522e-1427.96synaptotagmin-1-like [Source:NCBI gene;Acc:1030298... [more]
sytl51.545e-1122.19synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl2b1.547e-1128.87synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
sytl2b1.752e-1128.87synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
sytl51.940e-1122.19synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006493.15.208e-1530.12pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
SYT58.034e-1236.80synaptotagmin 5 [Source:HGNC Symbol;Acc:HGNC:11513... [more]
sytl2a2.456e-1029.11synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
sytl2a4.194e-1030.57synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
syt2a3.306e-822.79synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO329312.487e-832.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl54.904e-1422.85synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
sytl51.103e-1322.85synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
syt5b1.519e-1226.11synaptotagmin-1-like [Source:NCBI gene;Acc:1011565... [more]
syt5a2.967e-1224.73synaptotagmin-1 [Source:NCBI gene;Acc:101166053][more]
ENSORLT00000041991.18.718e-1224.23synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Synaptotagmin-like protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014370.10.000e+099.71SMESG000014370.1[more]
SMESG000014370.10.000e+099.71SMESG000014370.1[more]
SMESG000014370.10.000e+099.70SMESG000014370.1[more]
SMESG000078217.17.520e-3824.83SMESG000078217.1[more]
SMESG000074360.17.882e-1523.99SMESG000074360.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013540 ID=SMED30013540|Name=Synaptotagmin-like protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2242bp
CCGATCTATTAAAGTGGGCTTTTTGAAAATTCAAATCTGATTACACAATT
TCATTGACAAATATCACAGACAACCGGTTAATATATATCAATGTCGGCGA
TGAGCTTCCAGTCGGACAGGTACTTGCCCCCCTTGCCCCAGATAGATCTC
AGTGAAATGACGCAAGATGAGATCGCCGATTTCGAGAAAGTAATGAACCG
AATAGACGCTATCAACGAATTGGAAGCCAACAGAATCAGAAGACTCAAAA
CTTTGATAATTTCCCAGGAAAACGCAAAATTGTCGTCAGTCCATCCTAAT
AACAAAGCTCTAAAGAACCTCCTTTGCCATTCATGCGGCTCCTATTGTTT
GTCCTCGAGAATCGCAATTGGAAAGTCGTCGACCCGGTCATCTATCCTTT
GCAGGATCTGCCAACTTCCTGTCTGCCACTCGTGCTGGAGGTCAGTTGTG
GATAAAAAATTGAAAATATGCCCAAGTTGTCATAAAAAATTAGTCCTAGA
CGCCAAAACCGGAAACTGGTTCCATCAGCAAATGAAAAAGCGGCTCTCAG
TTGACCAATCGTCAGAATACTCAAGGATCTCCCCAAACCCCGTCAAAGAA
ATTACTCAAAGCCATTCACCAAAAAGAAAACTCCTCCATCGACTTCGAAG
CTACAATTCAGTTCATGAAGAGTTGGACGAGATGGAAAATATCCTCACGA
TTCATTCGCCGGCCTCCAACTGGAAATTTCAGATTTCAGATCAGCCAGAA
TACTCTCAGAAACGGACTGAACACAGCCCATCGTTTTACATCAATTCAGA
ACTGGAATCAGAGGAGGAGGTAAAATTAGATCTCAGCGATGATGTTGTGA
ATAGTAATAAAAATTATTACCGACCCCTGTCACACATATCTAGTCAGCCT
CTAAAATCTTGTTCCAATGGTAGTCCGATCCCAGTTGAGGATCACACCAC
AGATGTATGCAAATCAGTCCATGATGCAAATTCGATACAGAATCCAAGTT
TCTCACCCGGGGGAGAAGTTCTAATCGAGCTAGATTTCAATTTCCGTATG
TCCCAATTCATCATAATCCTCCGTCAGTGTAAAAATCTGCCGCAAATTGA
TACGATTAATAGTATAATCTGCCCATATCTCTTTGTTCTTCTACTTCCCG
ATAGATCGAAAAAGAGTAGAAGGACGACAAGTGTTAAAAAGAATTGTTTT
TGTCCAATTTTCGACCAAATATTTAAATACTCCATCAACTTCGCCGAATT
AGAGTCCAGGAGCATATTGGTGATGCTTTGCCACAAGGATGACCTATCTT
CTCGAGACCTTGCTCTGGGTCAGGTAATTATTCCTCTCAGCTTCGTTGAT
TTTAGTCGACCAATTGTCAGATGGTATTCATTTCAGCTACTTATTGAACC
AAGCCTCAGCCAATCTAGAATTGAGAGATCTTTTTCATCTGCACAAACCA
GGAATTCTAACATCCCTGCTTACTTTGGGGAAATTTCTCTGGCAATCAAA
CATGTTCCGAAAGGTTATTCCATGACAGCGAACGCAAATCACGCAGACTC
ATTTGGTGAGTTACATGTTTGGGTGAAATCTATGCGCAATGTCGCACAGC
ATCAGTTGAATTCCAACATTTGCGTGCCTCCTTCTCGCAGATTCTCGACC
AGTGACGACAAAGGCATCACAGAGAGTAAAATCATTGATAACATTAGTTT
TGGAAGCAGCAAATTACTCAGCGCCGTAGCCCAATTCGGACAGAACCAGC
CCGTAGCCAGAGTATGCCTTCTCCCTTACCGAACAAGTATGCAAAGCACG
AGTCCAGCGAAATCACAGTCGGAAAACAGTTCACAATACGTTTGGTCTAC
AATACTGAAATTCACCAATGTCGACGTAGAAGAGTTGCGCACGCGCAGCC
TCGAGGTGACCATTTGGGTGAATTCTAAACATGGCTGGTTGAATAGGATA
ATCCATCCTCGCTGCGTTGGTGGCGTTCGACTCTGTCGAGGAGGAAGAGA
TTGTGATGCAAGTCCAAGACACGGAAATCAGTGTCGGGGAGCTTCAACGG
GAATGATAGAAGAGAAAATGTGGGCAGCAATGCTGGATCGGAGCAATACT
TGGGTTGATGGAACCATCAAGCTTAAAATGGATTCTTCATTTTTAAATAT
AAACGTTCCTGAATTCTAATAACATTTATTTGGGAAATATTTGTCACTTT
AGGCTGTATCGTTTATTCCAATGCAACTATATTTGATTTATG
back to top

protein sequence of SMED30013540-orf-1

>SMED30013540-orf-1 ID=SMED30013540-orf-1|Name=SMED30013540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=693bp
MSAMSFQSDRYLPPLPQIDLSEMTQDEIADFEKVMNRIDAINELEANRIR
RLKTLIISQENAKLSSVHPNNKALKNLLCHSCGSYCLSSRIAIGKSSTRS
SILCRICQLPVCHSCWRSVVDKKLKICPSCHKKLVLDAKTGNWFHQQMKK
RLSVDQSSEYSRISPNPVKEITQSHSPKRKLLHRLRSYNSVHEELDEMEN
ILTIHSPASNWKFQISDQPEYSQKRTEHSPSFYINSELESEEEVKLDLSD
DVVNSNKNYYRPLSHISSQPLKSCSNGSPIPVEDHTTDVCKSVHDANSIQ
NPSFSPGGEVLIELDFNFRMSQFIIILRQCKNLPQIDTINSIICPYLFVL
LLPDRSKKSRRTTSVKKNCFCPIFDQIFKYSINFAELESRSILVMLCHKD
DLSSRDLALGQVIIPLSFVDFSRPIVRWYSFQLLIEPSLSQSRIERSFSS
AQTRNSNIPAYFGEISLAIKHVPKGYSMTANANHADSFGELHVWVKSMRN
VAQHQLNSNICVPPSRRFSTSDDKGITESKIIDNISFGSSKLLSAVAQFG
QNQPVARVCLLPYRTSMQSTSPAKSQSENSSQYVWSTILKFTNVDVEELR
TRSLEVTIWVNSKHGWLNRIIHPRCVGGVRLCRGGRDCDASPRHGNQCRG
ASTGMIEEKMWAAMLDRSNTWVDGTIKLKMDSSFLNINVPEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041282FYVE_2
IPR035892C2_domain_sf
IPR000008C2_dom
IPR013083Znf_RING/FYVE/PHD
IPR011011Znf_FYVE_PHD
IPR010911Rab_BD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 322..428
e-value: 5.1E-6
score: 36.0
IPR000008C2 domainPFAMPF00168C2coord: 325..430
e-value: 1.6E-10
score: 41.2
IPR000008C2 domainPROSITEPS50004C2coord: 305..413
score: 10.279
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 15..164
e-value: 4.4E-18
score: 67.0
IPR041282FYVE-type zinc fingerPFAMPF02318FYVE_2coord: 21..148
e-value: 1.7E-11
score: 44.3
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 304..436
e-value: 3.1E-24
score: 87.3
NoneNo IPR availablePANTHERPTHR45716FAMILY NOT NAMEDcoord: 154..680
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 300..431
IPR010911Rab-binding domainPROSITEPS50916RABBDcoord: 17..147
score: 9.097
IPR011011Zinc finger, FYVE/PHD-typeSUPERFAMILYSSF57903FYVE/PHD zinc fingercoord: 22..153