slc5a-5

Overview
Nameslc5a-5 (AKN21420.1)
Smed IDSMED30013535
Length (bp)2180
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc5a-5 (SMED30013535) t-SNE clustered cells

Violin plots show distribution of expression levels for slc5a-5 (SMED30013535) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc5a-5 (SMED30013535) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc5a-5 (SMED30013535) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013535

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013535SMESG000028614.1 Contig6536newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013535SMESG000028614.1 Contig6536uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30013535SMESG000028614.1 SmedASXL_012610SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013535SMESG000028614.1 dd_Smed_v4_12883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013535SMESG000028614.1 dd_Smed_v6_12883_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30013535SMESG000028614.1 OX_Smed_1.0.15492ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc5a-5 vs. Ensembl Human
Match: SLC5A7 (solute carrier family 5 member 7 [Source:HGNC Symbol;Acc:HGNC:14025])

HSP 1 Score: 513.457 bits (1321), Expect = 1.478e-174
Identity = 310/591 (52.45%), Postives = 415/591 (70.22%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKL-----NQTALELISSAKEISEQEEK 1923
            G++++ VFYLLI+ VGIWAA ++K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V   I+VI+S++IA  YT+ GGLY+VAYTDVVQLFCIFVGLW++VPFA+ +  V  I      AK    W+G+ + + ++  ++DS L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MA+PA+L+GA+ ASTDWN T + L    T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+VF  GA A  M +  K++Y LWYL SDLVY++IFPQL+CV++   +NTYG++ GY+ G   R++ GE  +    LI +P Y  + N    Q FP+KT +M  S +  I +S    Y+F+SG    + D+F+ VV       + + E+ D T    IL K  + K       D  + V  R S+ L     N+ A   + S+ E S  E+ 
Sbjct:    7 GLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGT-VDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQLLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVV------ARHSEENMDKT----ILVKNENIK------LDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. Ensembl Human
Match: SLC5A7 (solute carrier family 5 member 7 [Source:HGNC Symbol;Acc:HGNC:14025])

HSP 1 Score: 513.457 bits (1321), Expect = 1.478e-174
Identity = 310/591 (52.45%), Postives = 415/591 (70.22%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKL-----NQTALELISSAKEISEQEEK 1923
            G++++ VFYLLI+ VGIWAA ++K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V   I+VI+S++IA  YT+ GGLY+VAYTDVVQLFCIFVGLW++VPFA+ +  V  I      AK    W+G+ + + ++  ++DS L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MA+PA+L+GA+ ASTDWN T + L    T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+VF  GA A  M +  K++Y LWYL SDLVY++IFPQL+CV++   +NTYG++ GY+ G   R++ GE  +    LI +P Y  + N    Q FP+KT +M  S +  I +S    Y+F+SG    + D+F+ VV       + + E+ D T    IL K  + K       D  + V  R S+ L     N+ A   + S+ E S  E+ 
Sbjct:    7 GLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGT-VDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQLLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVV------ARHSEENMDKT----ILVKNENIK------LDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. Ensembl Celegans
Match: cho-1 (High-affinity choline transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:O02228])

HSP 1 Score: 509.99 bits (1312), Expect = 1.231e-173
Identity = 295/521 (56.62%), Postives = 385/521 (73.90%), Query Frame = 1
Query:  190 LGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESEC----ENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNES----QYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQ 1728
            LGIV++  FY+LI+ VGIWA +KSK+  E ESE     E +MLAGR+IG +VGIFTMTATWVGG YINGTAE ++    GL+ CQAPVGYA+SL+MGG+ FA KMR +G++TMLDPFQ K+G+R+GGL+++PAL+GE FW+AAILSALGAT++VIL +  + +V LS+ IAV YT  GG YAVAYTDVVQLFCIFVGLW+ VP AM++   + I++ +  W+G     ++ +++ID  L+LV GGIPWQVYFQRVLSS++A  AQ LSF+A  GC++MA+P  L+GA+A +TDW  T +    N T  ES    +   V+PLV  YL P WVAFIGLGAVSAAVMSSADSS+LSAASMFA N+ K      AS+K++I +MRI++  +G +A +M + I+SIY LWYLC+DLVYVI+FPQL+CVVY  RSNTYGSL GY +G + RL  GE  +  PA   +P Y     +Q FP++T +M  S+  I IVS+ ++ +FKSG+ S E D+  CVVN+ PI 
Sbjct:    5 LGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN--GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGIDMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCMLLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNMVVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALTIQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMY--TDGVQYFPFRTTAMLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNI-PID 520          
BLAST of slc5a-5 vs. Ensembl Fly
Match: ChT (gene:FBgn0038641 transcript:FBtr0083668)

HSP 1 Score: 513.457 bits (1321), Expect = 2.415e-174
Identity = 309/579 (53.37%), Postives = 419/579 (72.37%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRS-NTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKS 1926
            G+VS+ +FYLLI+ VGIWA +K ++   G    E +MLAGR IGL VGIFTMTATWVGGGYINGTAE ++T   GL+WCQAP GYALSL+ GGIFFA  MR QG++TMLDP Q  FGERMGGLLF+PAL GE+FW+A IL+ALGAT++VI+++    +VILSS IA+ YT+FGGLY+VAYTDV+QLFCIF+GLW+ +PFA  N++V S++     W+G   P +K  +YID  L+LV GGIPWQVYFQRVLSS++A RAQ+LS++A+ GC++MA+P VL+GA+A +T WN T +K     T++E+    +LP+V+ YL P++V+F GLGAVSAAVMSSADSS+LSAASMFARNV K IF Q AS+ +IIW+MR+++  +G LA +M + I SIY LW +CSDLVYVI+FPQL+ VV+F +  NTYGSL  YI+    RLS GE+ +G   LIK+P YD+E   Q+FP++T +M +SL+ +I VS  T  MF+SGK     D F CVVN+     ++    E G  ++ ++A  ++ + Y   +   +   N R +  L       ++ A+ I+++  ++
Sbjct:    6 GVVSIVLFYLLILVVGIWAGRKKQS---GNDSEEEVMLAGRSIGLFVGIFTMTATWVGGGYINGTAEAIYT--SGLVWCQAPFGYALSLVFGGIFFANPMRKQGYITMLDPLQDSFGERMGGLLFLPALCGEVFWAAGILAALGATLSVIIDMDHRTSVILSSCIAIFYTLFGGLYSVAYTDVIQLFCIFIGLWMCIPFAWSNEHVGSLSDLEVDWIGHVEP-KKHWLYIDYGLLLVFGGIPWQVYFQRVLSSKTAGRAQLLSYVAAAGCILMAIPPVLIGAIAKATPWNETDYKGPYPLTVDETSM--ILPMVLQYLTPDFVSFFGLGAVSAAVMSSADSSVLSAASMFARNVYKLIFRQKASEMEIIWVMRVAIIVVGILATIMALTIPSIYGLWSMCSDLVYVILFPQLLMVVHFKKHCNTYGSLSAYIVALAIRLSGGEAILGLAPLIKYPGYDEETKEQMFPFRTMAMLLSLVTLISVSWWTKMMFESGKLPPSYDYFRCVVNIPEDVQRVGDPSESGEQLS-VMAGPLA-RSYGAATMAGKDERNGRINPALESDDDLPVAEARRINQETAQA 574          
BLAST of slc5a-5 vs. Ensembl Fly
Match: ChT (gene:FBgn0038641 transcript:FBtr0083669)

HSP 1 Score: 513.457 bits (1321), Expect = 2.415e-174
Identity = 309/579 (53.37%), Postives = 419/579 (72.37%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRS-NTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKS 1926
            G+VS+ +FYLLI+ VGIWA +K ++   G    E +MLAGR IGL VGIFTMTATWVGGGYINGTAE ++T   GL+WCQAP GYALSL+ GGIFFA  MR QG++TMLDP Q  FGERMGGLLF+PAL GE+FW+A IL+ALGAT++VI+++    +VILSS IA+ YT+FGGLY+VAYTDV+QLFCIF+GLW+ +PFA  N++V S++     W+G   P +K  +YID  L+LV GGIPWQVYFQRVLSS++A RAQ+LS++A+ GC++MA+P VL+GA+A +T WN T +K     T++E+    +LP+V+ YL P++V+F GLGAVSAAVMSSADSS+LSAASMFARNV K IF Q AS+ +IIW+MR+++  +G LA +M + I SIY LW +CSDLVYVI+FPQL+ VV+F +  NTYGSL  YI+    RLS GE+ +G   LIK+P YD+E   Q+FP++T +M +SL+ +I VS  T  MF+SGK     D F CVVN+     ++    E G  ++ ++A  ++ + Y   +   +   N R +  L       ++ A+ I+++  ++
Sbjct:    6 GVVSIVLFYLLILVVGIWAGRKKQS---GNDSEEEVMLAGRSIGLFVGIFTMTATWVGGGYINGTAEAIYT--SGLVWCQAPFGYALSLVFGGIFFANPMRKQGYITMLDPLQDSFGERMGGLLFLPALCGEVFWAAGILAALGATLSVIIDMDHRTSVILSSCIAIFYTLFGGLYSVAYTDVIQLFCIFIGLWMCIPFAWSNEHVGSLSDLEVDWIGHVEP-KKHWLYIDYGLLLVFGGIPWQVYFQRVLSSKTAGRAQLLSYVAAAGCILMAIPPVLIGAIAKATPWNETDYKGPYPLTVDETSM--ILPMVLQYLTPDFVSFFGLGAVSAAVMSSADSSVLSAASMFARNVYKLIFRQKASEMEIIWVMRVAIIVVGILATIMALTIPSIYGLWSMCSDLVYVILFPQLLMVVHFKKHCNTYGSLSAYIVALAIRLSGGEAILGLAPLIKYPGYDEETKEQMFPFRTMAMLLSLVTLISVSWWTKMMFESGKLPPSYDYFRCVVNIPEDVQRVGDPSESGEQLS-VMAGPLA-RSYGAATMAGKDERNGRINPALESDDDLPVAEARRINQETAQA 574          
BLAST of slc5a-5 vs. Ensembl Zebrafish
Match: slc5a7a (solute carrier family 5 member 7a [Source:ZFIN;Acc:ZDB-GENE-090313-273])

HSP 1 Score: 501.13 bits (1289), Expect = 1.023e-169
Identity = 306/610 (50.16%), Postives = 417/610 (68.36%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAP--LEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR--------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN------------LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKE 1956
            G+V++ +FYLLI+ VGIWAA K+K    +EG    E +M+ GRDIGL VG FTMTATWVGGGYINGTAE V+ PG GL W QAP GYALSL++GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FWSAAILSALGAT++VI+++  +++V++S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ N  V  I  T+ +        W+G    ++K  ++ D+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGC+IMA+P+VL+GA+ ASTDWN T +  +    + + Q   +LP+V+ +LCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD++I+W+MRI++F  GALA  M +   ++Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GY  G + R+  GE  +  P  I +P +  E+             +Q FP+KT SM  S +  +  S    Y+F+SG  S + D  + VV       Q +AE  D T    ++ K +          +  + V  R S+ L  T      + KE   +EE S+   +SP  E
Sbjct:    7 GLVAIVIFYLLILLVGIWAAWKNKNSGVMEGTDRSETIMVGGRDIGLFVGAFTMTATWVGGGYINGTAEYVYLPGFGLAWAQAPFGYALSLVLGGLFFAKPMRSRGYVTMLDPFQQLYGKRMGGLLFIPALMGEMFWSAAILSALGATLSVIIDIDINMSVVISALIAIFYTLVGGLYSVAYTDVVQLFCIFLGLWVSVPFALSNPAVSDIGVTAVKQLHANQTAWLGKIESSDK-WMWADNFCLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCIIMAIPSVLIGAIGASTDWNQTSYGPI--PPMQKDQSDMILPIVLQHLCPAYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDREIVWVMRITIFVFGALATAMALLTGTVYGLWYLSSDLVYVIIFPQLLSVLFIRGTNTYGSVAGYFFGLILRIGGGEPYLKLPPFIYYPGWTIEEKVHHLTHEVEYLVMQRFPFKTASMLASFLSNVAFSYLFKYLFESGTLSAKYDFLDAVV------AQHSAEIMDKTT---LVNKNI-------IGLNEMAPVKPRLSVTLAATF-----TRKETLTEEEDSS--PESPIHE 590          
BLAST of slc5a-5 vs. Ensembl Zebrafish
Match: CR925787.1 (solute carrier family 5 member 7a [Source:NCBI gene;Acc:100005589])

HSP 1 Score: 500.36 bits (1287), Expect = 1.873e-169
Identity = 306/610 (50.16%), Postives = 417/610 (68.36%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSK--APLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR--------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN------------LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKE 1956
            G+V++ +FYLLI+ VGIWAA K+K    +EG    E +M+ GRDIGL VG FTMTATWVGGGYINGTAE V+ PG GL W QAP GYALSL++GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FWSAAILSALGAT++VI+++  +++V++S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ N  V  I  T+ +        W+G    ++K  ++ D+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGC+IMA+P+VL+GA+ ASTDWN T +  +    + + Q   +LP+V+ +LCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD++I+W+MRI++F  GALA  M +   ++Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GY  G + R+  GE  +  P  I +P +  E+             +Q FP+KT SM  S +  +  S    Y+F+SG  S + D  + VV       Q +AE  D T    ++ K +          +  + V  R S+ L  T      + KE  E+E+ S    +SP  E
Sbjct:    7 GLVAIVIFYLLILLVGIWAAWKNKNSGVMEGTDRSETIMVGGRDIGLFVGAFTMTATWVGGGYINGTAEYVYLPGFGLAWAQAPFGYALSLVLGGLFFAKPMRSRGYVTMLDPFQQLYGKRMGGLLFIPALMGEMFWSAAILSALGATLSVIIDIDINMSVVISALIAIFYTLVGGLYSVAYTDVVQLFCIFLGLWVSVPFALSNPAVSDIGVTAVKQLHANQTAWLGKIESSDK-WMWADNFCLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCIIMAIPSVLIGAIGASTDWNQTSYGPI--PPMQKDQSDMILPIVLQHLCPAYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDREILWVMRITIFVFGALATAMALLTGTVYGLWYLSSDLVYVIIFPQLLSVLFIRGTNTYGSVAGYFFGLILRIGGGEPYLKLPPFIYYPGWTIEEKVHHLTHEVEYLVMQRFPFKTASMLASFLSNVAFSYLFKYLFESGTLSAKYDFLDAVV------AQHSAEIMDKTT---LVNKNI-------IGLNEMAPVKPRLSVTLAATF-----TRKETLEEEDSS---PESPIHE 589          
BLAST of slc5a-5 vs. Ensembl Zebrafish
Match: SLC5A7 (high-affinity choline transporter 1-like [Source:NCBI gene;Acc:799259])

HSP 1 Score: 379.793 bits (974), Expect = 3.530e-124
Identity = 240/472 (50.85%), Postives = 330/472 (69.92%), Query Frame = 1
Query:  490 MRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP---FYDQEQNL---------QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVI---NHILAKRMSFKKYPQTSQDSQSSVN 1842
            MR++G+VTMLDPFQ+ +G+RMGGLLFIPAL+GEIFWSAAILSALGAT++VI+++  +++V++S++IAV YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ N  V  IA T+ +      W+G   P++   ++ D+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGCL+MA+P+VL+GA+ ASTDWN T +  V     +ES    +LP+V+ +LCP +V+F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD++I+W+MRI++F  GA+A  M +   S+Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GY+ G L R+  GE  +  P  I +P     +++  L         Q FPYKT SM  SL+     S    Y+F+SG  S + D  + VV+      + + E  D T +   + IL   +S  K   TS  + + +N
Sbjct:    1 MRSRGYVTMLDPFQQLYGQRMGGLLFIPALLGEIFWSAAILSALGATLSVIVDMDINMSVMISALIAVFYTLVGGLYSVAYTDVVQLFCIFLGLWISVPFALSNPAVSDIAVTAVKAVFQDPWLGEIHPSDGW-MWADNFCLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCLVMAVPSVLIGAIGASTDWNQTSYGPVAPVDKDESDM--ILPIVLQHLCPSFVSFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDREIVWVMRITIFVFGAVATAMALLTGSVYGLWYLSSDLVYVIIFPQLLSVLFIKGTNTYGSVAGYVFGLLLRIGGGEPYLRLPPFIYYPGWQMREKQHRLTQEVERFVEQRFPYKTVSMLASLLSNAAFSYLAKYLFESGTLSPKYDFLDAVVS------KHSKETMDKTTLVAHDTILLSELSAVKPRHTSSLAGTFIN 463          
BLAST of slc5a-5 vs. Ensembl Xenopus
Match: SLC5A7 (solute carrier family 5 (sodium/choline cotransporter), member 7 [Source:NCBI gene;Acc:100490609])

HSP 1 Score: 488.034 bits (1255), Expect = 1.295e-164
Identity = 307/598 (51.34%), Postives = 408/598 (68.23%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEI 1959
            G+V++ +FYL I+ VGIWAA ++K         E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+    GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAILSALGATI+VI+++  +I+V++S++IA  YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFAM +  V  I  T+ +      W+G  I       ++DS L+L++GGIPWQ YFQRVLS+ SA  AQVLSFLA+FGCL+MA+P+VL+GA+ ASTDWN T ++   +  +NE +   +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q AS+K+I+W+MRI+VF  GA A  M +  KS+Y LWYL SDLVY+IIFPQL+CV++   +NTYGS+ GY+ G L R+S GE  +   A I +P    ++N   LQ FP+KT SM  S +  I  S    Y+F+ G  S + D    VV       + + E+ D T          +  K         + V  R S+ L  T      + KE     E S    DS NKE+
Sbjct:    7 GLVAIILFYLAILFVGIWAAWRTKNSRGDGDPREGIIVGGRDIGLLVGAFTMTATWVGGGYINGTAEAVYVSDYGLAWAQAPIGYSLSLIVGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAILSALGATISVIVDIDINISVVVSALIATFYTLVGGLYSVAYTDVVQLFCIFIGLWISVPFAMTHPAVTDITVTAVKEVYQKPWLGD-IRAADAWNWLDSFLLLMLGGIPWQAYFQRVLSASSATYAQVLSFLAAFGCLVMAIPSVLIGAIGASTDWNQTSYEH-DDPQMNE-EADMILPIVLQYLCPPYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASEKEIVWVMRITVFIFGAAATAMALLAKSVYGLWYLSSDLVYIIIFPQLLCVLFIKGTNTYGSVAGYVFGALLRISGGEPYLHLQAFICYPGCYADKNDMYLQRFPFKTLSMVASFLANIAFSYLARYLFEKGILSPKFDFLNAVV------AKHSEENMDKT----------TLVKSDNIVLSELAPVKPRQSLSLPSTF-----TNKEAISDLESSPESPDSENKEL 580          
BLAST of slc5a-5 vs. Ensembl Xenopus
Match: ENSXETT00000017413.1 (high affinity choline transporter 1 [Source:NCBI gene;Acc:100492076])

HSP 1 Score: 382.104 bits (980), Expect = 4.975e-124
Identity = 228/528 (43.18%), Postives = 350/528 (66.29%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTS------SRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP--FYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDE 1752
            G++++ VFY + +  G+WAA K+K   + + + E  ++ GR++ + VG+FT TATWVGG YINGTAE V+ P +GL W  AP+G+A + I+G +FF   MR++ +VTM+DP Q+ FG  MG +LF+P L+G++FW A+IL++LGAT++VIL+V   +++I+S+   + YT+ GGLY+VAYTDV+QL  + + LW+ VPFA++N   E+IA T+      + W+G   P   IA ++D    L +GGI WQ YFQRVL++ S+++A V S+L+   C +M +P++L+GAVA STDWN T + L       ES    +LPLV+ YLCP +V+  GLGA++AAVMSSADSS+LSA+SMFA N+ K +  + AS+++++W+MR+S+  +G++   +     S+Y++W+L  +LVY I+FPQL C ++   +NTYGS  G+I+GF+ RL  GES +  P  + +P         +Q FP+KTF+M +SLI I+ +S    ++F       + DI        P   Q   E+E
Sbjct:    7 GLIAVIVFYAMTLVTGLWAAWKAKKSEKNKKQTEVAIVGGRNLNIFVGLFTTTATWVGGAYINGTAEIVYLPSRGLAWVHAPLGFAATFIIGALFFVKPMRSKNYVTMMDPLQETFGNTMGSILFLPPLLGDVFWFASILASLGATVSVILDVKGYVSIIISACTVIIYTLLGGLYSVAYTDVIQLLFMIISLWICVPFALLNSASENIAYTAVNALYQAPWIGKIQPG-YIARWLDDLAYLSLGGIAWQTYFQRVLAASSSKQAMVTSYLSGLLCAVMGVPSILIGAVAVSTDWNQTSYGLPTPYERRESNM--ILPLVLQYLCPTYVSVAGLGAIAAAVMSSADSSLLSASSMFAYNIYKRLLRKKASEREVLWVMRLSMVLLGSVGTGLAFLSNSVYDMWFLSGELVYAILFPQLCCALFIPGTNTYGSAAGFILGFVLRLLGGESALKIPPFLHYPGCILVDGVFIQQFPFKTFTMTVSLITIVAISYLAQFLFMKNILPAQWDICYVFRKETPPLSQQELEEE 531          
BLAST of slc5a-5 vs. Ensembl Xenopus
Match: ENSXETT00000017420.1 (high affinity choline transporter 1 [Source:NCBI gene;Acc:100492076])

HSP 1 Score: 382.489 bits (981), Expect = 1.732e-123
Identity = 228/528 (43.18%), Postives = 350/528 (66.29%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTS------SRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP--FYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDE 1752
            G++++ VFY + +  G+WAA K+K   + + + E  ++ GR++ + VG+FT TATWVGG YINGTAE V+ P +GL W  AP+G+A + I+G +FF   MR++ +VTM+DP Q+ FG  MG +LF+P L+G++FW A+IL++LGAT++VIL+V   +++I+S+   + YT+ GGLY+VAYTDV+QL  + + LW+ VPFA++N   E+IA T+      + W+G   P   IA ++D    L +GGI WQ YFQRVL++ S+++A V S+L+   C +M +P++L+GAVA STDWN T + L       ES    +LPLV+ YLCP +V+  GLGA++AAVMSSADSS+LSA+SMFA N+ K +  + AS+++++W+MR+S+  +G++   +     S+Y++W+L  +LVY I+FPQL C ++   +NTYGS  G+I+GF+ RL  GES +  P  + +P         +Q FP+KTF+M +SLI I+ +S    ++F       + DI        P   Q   E+E
Sbjct:    7 GLIAVIVFYAMTLVTGLWAAWKAKKSEKNKKQTEVAIVGGRNLNIFVGLFTTTATWVGGAYINGTAEIVYLPSRGLAWVHAPLGFAATFIIGALFFVKPMRSKNYVTMMDPLQETFGNTMGSILFLPPLLGDVFWFASILASLGATVSVILDVKGYVSIIISACTVIIYTLLGGLYSVAYTDVIQLLFMIISLWICVPFALLNSASENIAYTAVNALYQAPWIGKIQPG-YIARWLDDLAYLSLGGIAWQTYFQRVLAASSSKQAMVTSYLSGLLCAVMGVPSILIGAVAVSTDWNQTSYGLPTPYERRESNM--ILPLVLQYLCPTYVSVAGLGAIAAAVMSSADSSLLSASSMFAYNIYKRLLRKKASEREVLWVMRLSMVLLGSVGTGLAFLSNSVYDMWFLSGELVYAILFPQLCCALFIPGTNTYGSAAGFILGFVLRLLGGESALKIPPFLHYPGCILVDGVFIQQFPFKTFTMTVSLITIVAISYLAQFLFMKNILPAQWDICYVFRKETPPLSQQELEEE 531          
BLAST of slc5a-5 vs. Ensembl Mouse
Match: Slc5a7 (solute carrier family 5 (choline transporter), member 7 [Source:MGI Symbol;Acc:MGI:1927126])

HSP 1 Score: 508.449 bits (1308), Expect = 1.033e-172
Identity = 309/586 (52.73%), Postives = 413/586 (70.48%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEK 1923
            G+V++ +FYLLI  VGIWAA K+K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V  +I+VI+S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ +  V  I      AK  S W+G+ I + ++  ++D+ L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MALPA+ +GA+ ASTDWN T +      T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+V   GA A  M +  K++Y LWYL SDLVY+IIFPQL+CV++   +NTYG++ GYI G   R++ GE  +    LI +P Y  ++N    Q FP+KT SM  S    I VS    Y+F+SG    + D+F+ VV       + + E+ D T    IL +  + K         + S+   ++   N+ AL  + S+ E S  E+ 
Sbjct:    7 GLVAIILFYLLIFLVGIWAAWKTKNSGNPEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYGPGCGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIVSALIAILYTLVGGLYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQSPWLGT-IESVEVYTWLDNFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAICIGAIGASTDWNQTAYGYPDPKTKEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVLVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQLLCVLFIKGTNTYGAVAGYIFGLFLRITGGEPYLYLQPLIFYPGYYSDKNGIYNQRFPFKTLSMVTSFFTNICVSYLAKYLFESGTLPPKLDVFDAVV------ARHSEENMDKT----ILVRNENIKLNELAPVKPRQSLTLSSTFT-NKEALLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. UniProt/SwissProt
Match: sp|Q9GZV3|SC5A7_HUMAN (High affinity choline transporter 1 OS=Homo sapiens OX=9606 GN=SLC5A7 PE=1 SV=1)

HSP 1 Score: 513.457 bits (1321), Expect = 7.097e-174
Identity = 310/591 (52.45%), Postives = 415/591 (70.22%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKL-----NQTALELISSAKEISEQEEK 1923
            G++++ VFYLLI+ VGIWAA ++K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V   I+VI+S++IA  YT+ GGLY+VAYTDVVQLFCIFVGLW++VPFA+ +  V  I      AK    W+G+ + + ++  ++DS L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MA+PA+L+GA+ ASTDWN T + L    T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+VF  GA A  M +  K++Y LWYL SDLVY++IFPQL+CV++   +NTYG++ GY+ G   R++ GE  +    LI +P Y  + N    Q FP+KT +M  S +  I +S    Y+F+SG    + D+F+ VV       + + E+ D T    IL K  + K       D  + V  R S+ L     N+ A   + S+ E S  E+ 
Sbjct:    7 GLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGGLYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGT-VDSSEVYSWLDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDWNQTAYGLPDPKTTEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQLLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVV------ARHSEENMDKT----ILVKNENIK------LDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. UniProt/SwissProt
Match: sp|Q9JMD7|SC5A7_RAT (High affinity choline transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a7 PE=1 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 1.820e-173
Identity = 311/586 (53.07%), Postives = 415/586 (70.82%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEK 1923
            G+V++ +FYLLI  VGIWAA K+K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V  +I+VI+S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ +  V  I      AK  S W+G+ I + ++  ++D+ L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MALPA+ +GA+ ASTDWN T +      T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+VF  GA A  M +  K++Y LWYL SDLVY+IIFPQL+CV++   +NTYG++ GYI G   R++ GE  +    LI +P Y  ++N    Q FP+KT SM  S    I VS    Y+F+SG    + DIF+ VV+      + + E+ D T    IL +  + K         + S+   ++   N+ AL  + S+ E S  E+ 
Sbjct:    7 GLVAIILFYLLIFLVGIWAAWKTKNSGNAEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYGPGCGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIVSALIAILYTLVGGLYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQSPWLGT-IESVEVYTWLDNFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAICIGAIGASTDWNQTAYGFPDPKTKEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQLLCVLFIKGTNTYGAVAGYIFGLFLRITGGEPYLYLQPLIFYPGYYPDKNGIYNQRFPFKTLSMVTSFFTNICVSYLAKYLFESGTLPPKLDIFDAVVS------RHSEENMDKT----ILVRNENIKLNELAPVKPRQSLTLSSTFT-NKEALLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. UniProt/SwissProt
Match: sp|Q9VE46|SC5A7_DROME (High-affinity choline transporter 1 OS=Drosophila melanogaster OX=7227 GN=ChT PE=2 SV=2)

HSP 1 Score: 513.457 bits (1321), Expect = 2.421e-173
Identity = 309/579 (53.37%), Postives = 419/579 (72.37%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRS-NTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKS 1926
            G+VS+ +FYLLI+ VGIWA +K ++   G    E +MLAGR IGL VGIFTMTATWVGGGYINGTAE ++T   GL+WCQAP GYALSL+ GGIFFA  MR QG++TMLDP Q  FGERMGGLLF+PAL GE+FW+A IL+ALGAT++VI+++    +VILSS IA+ YT+FGGLY+VAYTDV+QLFCIF+GLW+ +PFA  N++V S++     W+G   P +K  +YID  L+LV GGIPWQVYFQRVLSS++A RAQ+LS++A+ GC++MA+P VL+GA+A +T WN T +K     T++E+    +LP+V+ YL P++V+F GLGAVSAAVMSSADSS+LSAASMFARNV K IF Q AS+ +IIW+MR+++  +G LA +M + I SIY LW +CSDLVYVI+FPQL+ VV+F +  NTYGSL  YI+    RLS GE+ +G   LIK+P YD+E   Q+FP++T +M +SL+ +I VS  T  MF+SGK     D F CVVN+     ++    E G  ++ ++A  ++ + Y   +   +   N R +  L       ++ A+ I+++  ++
Sbjct:    6 GVVSIVLFYLLILVVGIWAGRKKQS---GNDSEEEVMLAGRSIGLFVGIFTMTATWVGGGYINGTAEAIYT--SGLVWCQAPFGYALSLVFGGIFFANPMRKQGYITMLDPLQDSFGERMGGLLFLPALCGEVFWAAGILAALGATLSVIIDMDHRTSVILSSCIAIFYTLFGGLYSVAYTDVIQLFCIFIGLWMCIPFAWSNEHVGSLSDLEVDWIGHVEP-KKHWLYIDYGLLLVFGGIPWQVYFQRVLSSKTAGRAQLLSYVAAAGCILMAIPPVLIGAIAKATPWNETDYKGPYPLTVDETSM--ILPMVLQYLTPDFVSFFGLGAVSAAVMSSADSSVLSAASMFARNVYKLIFRQKASEMEIIWVMRVAIIVVGILATIMALTIPSIYGLWSMCSDLVYVILFPQLLMVVHFKKHCNTYGSLSAYIVALAIRLSGGEAILGLAPLIKYPGYDEETKEQMFPFRTMAMLLSLVTLISVSWWTKMMFESGKLPPSYDYFRCVVNIPEDVQRVGDPSESGEQLS-VMAGPLA-RSYGAATMAGKDERNGRINPALESDDDLPVAEARRINQETAQA 574          
BLAST of slc5a-5 vs. UniProt/SwissProt
Match: sp|O02228|SC5A7_CAEEL (High-affinity choline transporter 1 OS=Caenorhabditis elegans OX=6239 GN=cho-1 PE=2 SV=2)

HSP 1 Score: 509.99 bits (1312), Expect = 1.566e-172
Identity = 295/521 (56.62%), Postives = 385/521 (73.90%), Query Frame = 1
Query:  190 LGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESEC----ENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNES----QYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQ 1728
            LGIV++  FY+LI+ VGIWA +KSK+  E ESE     E +MLAGR+IG +VGIFTMTATWVGG YINGTAE ++    GL+ CQAPVGYA+SL+MGG+ FA KMR +G++TMLDPFQ K+G+R+GGL+++PAL+GE FW+AAILSALGAT++VIL +  + +V LS+ IAV YT  GG YAVAYTDVVQLFCIFVGLW+ VP AM++   + I++ +  W+G     ++ +++ID  L+LV GGIPWQVYFQRVLSS++A  AQ LSF+A  GC++MA+P  L+GA+A +TDW  T +    N T  ES    +   V+PLV  YL P WVAFIGLGAVSAAVMSSADSS+LSAASMFA N+ K      AS+K++I +MRI++  +G +A +M + I+SIY LWYLC+DLVYVI+FPQL+CVVY  RSNTYGSL GY +G + RL  GE  +  PA   +P Y     +Q FP++T +M  S+  I IVS+ ++ +FKSG+ S E D+  CVVN+ PI 
Sbjct:    5 LGIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTMTATWVGGAYINGTAEALYN--GGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKYGQRIGGLMYVPALLGETFWTAAILSALGATLSVILGIDMNASVTLSACIAVFYTFTGGYYAVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCMLLLVFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSPWNNGTKVESIPPDKRNMVVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAHNIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALTIQSIYGLWYLCADLVYVILFPQLLCVVYMPRSNTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMY--TDGVQYFPFRTTAMLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVNI-PID 520          
BLAST of slc5a-5 vs. UniProt/SwissProt
Match: sp|Q8BGY9|SC5A7_MOUSE (High affinity choline transporter 1 OS=Mus musculus OX=10090 GN=Slc5a7 PE=1 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 7.224e-172
Identity = 309/586 (52.73%), Postives = 413/586 (70.48%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESI------AKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEK 1923
            G+V++ +FYLLI  VGIWAA K+K     E   E +++ GRDIGL+VG FTMTATWVGGGYINGTAE V+ PG GL W QAP+GY+LSLI+GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGE+FW+AAI SALGATI+VI++V  +I+VI+S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ +  V  I      AK  S W+G+ I + ++  ++D+ L+L++GGIPWQ YFQRVLSS SA  AQVLSFLA+FGCL+MALPA+ +GA+ ASTDWN T +      T  E+    +LP+V+ YLCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q ASDK+I+W+MRI+V   GA A  M +  K++Y LWYL SDLVY+IIFPQL+CV++   +NTYG++ GYI G   R++ GE  +    LI +P Y  ++N    Q FP+KT SM  S    I VS    Y+F+SG    + D+F+ VV       + + E+ D T    IL +  + K         + S+   ++   N+ AL  + S+ E S  E+ 
Sbjct:    7 GLVAIILFYLLIFLVGIWAAWKTKNSGNPEERSEAIIVGGRDIGLLVGGFTMTATWVGGGYINGTAEAVYGPGCGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQIYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDVNISVIVSALIAILYTLVGGLYSVAYTDVVQLFCIFIGLWISVPFALSHPAVTDIGFTAVHAKYQSPWLGT-IESVEVYTWLDNFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAICIGAIGASTDWNQTAYGYPDPKTKEEADM--ILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLSFRQNASDKEIVWVMRITVLVFGASATAMALLTKTVYGLWYLSSDLVYIIIFPQLLCVLFIKGTNTYGAVAGYIFGLFLRITGGEPYLYLQPLIFYPGYYSDKNGIYNQRFPFKTLSMVTSFFTNICVSYLAKYLFESGTLPPKLDVFDAVV------ARHSEENMDKT----ILVRNENIKLNELAPVKPRQSLTLSSTFT-NKEALLDVDSSPEGSGTEDN 578          
BLAST of slc5a-5 vs. TrEMBL
Match: A0A0H3YEX2 (Slc5a-5 OS=Schmidtea mediterranea OX=79327 GN=slc5a-5 PE=2 SV=1)

HSP 1 Score: 1101.66 bits (2848), Expect = 0.000e+0
Identity = 599/599 (100.00%), Postives = 599/599 (100.00%), Query Frame = 1
Query:  178 MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK 1974
            MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDIAVILSSIIAVAYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMALPAVLLGAVAASTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGAVSAAVMSSADSSILSAASMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTFSMFISLIFIIIVSLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK
Sbjct:    1 MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDIAVILSSIIAVAYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMALPAVLLGAVAASTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGAVSAAVMSSADSSILSAASMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTFSMFISLIFIIIVSLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK 599          
BLAST of slc5a-5 vs. TrEMBL
Match: A0A0R3SEQ9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS3269 PE=3 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 323/521 (62.00%), Postives = 406/521 (77.93%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSK---------------APLEGE-SECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECV 1707
            GIV +  FYLLI+ VGIWAA+KSK                P +GE ++ E++MLAGRDIGL VGIFTMTATWVGGGYINGTAE+V+ P QGL+ CQAP+GYALSL++GGIFFA KMR+ G+VTMLDP Q K+G+RM GLLFIPALMGEIFWSAAIL+ALGATI V++ +   ++VI+S+ IA+ YT+FGGLYAVAYTDVVQLFCIFVGLWL++PFAM +  V SI+  S+RW+GS IP   +A+YID+ LML++GGIPWQVYFQRVLS+R+AR AQVLS++AS GCL+MA+P +L+GAVAASTDWNAT +K  V+N +  S+ K VLPLV+ YLCP  ++F+GLGAVSAAVMSSADSS+ SAASMFA NVVK IF  +ASD+ I+ +MR+S+F +GALAC +GI IKS+YELW+L SDLVYVI+FPQLV V++   +NTYGS  GYI G   RL+ GE     P L  +P YD E+ +Q  P KT SM  SL    + S     ++K+GK S ++D+F+C+
Sbjct:    8 GIVGIICFYLLILVVGIWAARKSKKSAFAARRPTNGNSSTPAQGEMTDSEDVMLAGRDIGLFVGIFTMTATWVGGGYINGTAESVYDPTQGLLLCQAPIGYALSLVIGGIFFANKMRSFGYVTMLDPLQAKYGDRMCGLLFIPALMGEIFWSAAILAALGATIAVVVGIDGTVSVIVSACIALLYTLFGGLYAVAYTDVVQLFCIFVGLWLSIPFAMTHSAVHSISLNSTRWIGS-IPTNSVALYIDNLLMLILGGIPWQVYFQRVLSARTARNAQVLSYMASLGCLLMAVPPILIGAVAASTDWNATNYKGTVDNLIPPSERKLVLPLVLQYLCPPAISFVGLGAVSAAVMSSADSSVFSAASMFAHNVVKPIF-PSASDRVILIVMRVSIFIVGALACFLGIMIKSVYELWFLSSDLVYVILFPQLVSVLFIPFTNTYGSFAGYITGLFLRLTCGEKAFSLPPLFYYPGYDHEEGIQRAPVKTISMLGSLAMSTLASYLMHRLWKAGKLSGKRDVFKCM 526          
BLAST of slc5a-5 vs. TrEMBL
Match: A0A1S3IDZ2 (high-affinity choline transporter 1 OS=Lingula unguis OX=7574 GN=LOC106163417 PE=3 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 321/578 (55.54%), Postives = 435/578 (75.26%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKS 1926
            G++S+ VFY+LI+ VGIWA +K+K+  E  ++ E +MLAGR+IGLVVGIFTMTATWVGGGYINGTAE +F+   G++WCQAP GYALSL+ GG+FFA KMR +G+VTMLDPFQ+K+GERMGGLLFIPAL+GE+FWSAAILSALGAT++VI+ + +  AVI+S+ +AV YT+FGGLY+VAYTDV+QL CI +GLWL++PFAM + +V +I +T+ +W+G+ +P  +   YIDSAL+L  GGIPWQVYFQRVLS+++A RAQ+LS++A+ G +++A+PAVL+GA+A+STDWN+T++   +   +   + K VLPLV+ YLCP  V+FIGLG++SAAVMSSADSS+LSA+SMFARNV K    Q AS+++IIW+MR ++F +GALA +MGI I +IY LW+LCSDLVYVI+FPQLVCV+Y   +NTYGSL G+I G  FRL+ GE  IG   LIK+PFYD++ N QLFPYKT SM I+L  I  VSL   Y+F++G   K  D+F+C+VN+   +  L A       +  I   + ++    +T+     ++ +  S  LN   L    +    + +  KS
Sbjct:    6 GLISIIVFYVLILAVGIWAGRKTKS-TEANADSEEVMLAGRNIGLVVGIFTMTATWVGGGYINGTAEIIFS--SGMVWCQAPFGYALSLVFGGLFFANKMRTEGYVTMLDPFQRKYGERMGGLLFIPALLGEVFWSAAILSALGATLSVIIELDNTTAVIVSACVAVVYTLFGGLYSVAYTDVIQLMCIVIGLWLSIPFAMTHPSVGNIVETAPKWIGT-LPASQSGTYIDSALLLTFGGIPWQVYFQRVLSAKTAFRAQILSYVAAAGVVVLAIPAVLVGAIASSTDWNSTEYDGEL--PIPAEEQKLVLPLVLQYLCPTAVSFIGLGSISAAVMSSADSSVLSASSMFARNVYKMTCRQNASEREIIWVMRFAIFGVGALATIMGITISTIYGLWFLCSDLVYVILFPQLVCVIYLKAANTYGSLAGFIFGLFFRLAGGEMLIGLHPLIKYPFYDEKNNAQLFPYKTLSMLITLFTIWAVSLPFKYVFENGMLPKHYDVFQCIVNIPEEKTGLRAATPSEAEMTSITLDQKTY----ETNGKVNPALKFSKSDLLNAENLSQPPTPNSNNHRTSKS 573          
BLAST of slc5a-5 vs. TrEMBL
Match: G7YWU1 (High affinity choline transporter 1 OS=Clonorchis sinensis OX=79923 GN=Slc5a7 PE=3 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 315/504 (62.50%), Postives = 398/504 (78.97%), Query Frame = 1
Query:  235 VGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP-FYDQEQNL-QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLN 1740
            VG WAA+KS++   G +E E++MLAGR+IGL+VGIFTMTATWVGGGYINGTAEN F PGQGL+WCQAP+GYA SL++GG FFA +MR+   VTMLDPFQ K+GERM GLLFIPAL+GE FWSAAILSALGAT+ VI+ +    +VI+S+ IA+ YT+FGGLY+VAYTDVVQLFCIFVGLW+++PFA++NK    I++T  RW GS +      IY+D+ LML  GGIPWQVYFQRVLS R+A++AQ+LSF+A+ GCLIMALP+VL+GAV ASTDWN T +    N T+ + + K VLPLV+ YLCP WV+F+GLGAVSAAVMSS+DSS+LSAASMFARNVVK +FWQ+A+++QIIW+MR S+F +GAL+CL+ I I+SIY LWYLCSDL+YVI+FPQL+CV+Y   SNTYGSL+GYI+G   RL++GE+ +G PAL K+P FYD  Q+  Q FP KTF+M  +L+  I+VS  TD  F+      + D F C        G ++
Sbjct:   20 VGFWAARKSRSNPAGTTETEDVMLAGRNIGLIVGIFTMTATWVGGGYINGTAENTFRPGQGLVWCQAPIGYAASLVLGGFFFAKRMRSLAFVTMLDPFQNKYGERMCGLLFIPALLGETFWSAAILSALGATLGVIVELDHTTSVIISACIALLYTLFGGLYSVAYTDVVQLFCIFVGLWISLPFALLNKATVPISQTWDRWKGS-VEAVDAGIYVDNLLMLTFGGIPWQVYFQRVLSCRTAKQAQILSFVAAIGCLIMALPSVLIGAVGASTDWNMTGYGRAENFTIPDGEAKLVLPLVLRYLCPVWVSFVGLGAVSAAVMSSSDSSVLSAASMFARNVVKPVFWQSATERQIIWVMRASIFGVGALSCLLAICIQSIYGLWYLCSDLIYVILFPQLICVLYVRFSNTYGSLIGYILGLFVRLTSGEALLGLPALFKYPYFYDDPQDFYQRFPCKTFAMLCTLVVTIVVSYFTDLYFRKDSKRLKYDFFHCYKQRASASGSIH 522          
BLAST of slc5a-5 vs. TrEMBL
Match: A0A4S2M9C4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002695 PE=3 SV=1)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 322/525 (61.33%), Postives = 414/525 (78.86%), Query Frame = 1
Query:  172 LTMVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP-FYDQEQNL-QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLN 1740
            + M++  G+V++ +FYLLI+ VG WAA+KS++   G +E E++MLAGR+IGL+VGIFTMTATWVGGGYINGTAEN F PGQGL+WCQAP+GYA SL++GG FFA +MR+   VTMLDPFQ K+GERM GLLFIPAL+GE FWSAAILSALGAT+ VI+ +    +VI+S+ IA+ YT+FGGLY+VAYTDVVQLFCIFVGLW+++PFA++NK    I++T  RW GS +      +Y+D+ LML  GGIPWQVYFQRVLS R+A++AQ+LSF+A+ GCLIMALP+VL+GAV ASTDWN T +    N T+ + + K VLPLV+ YLCP WV+F+GLGAVSAAVMSS+DSS+LSAASMFARNVVK +FWQ+A+++QIIW+MR S+F +GAL+CL+ I I+SIY LWYLCSDL+YVI+FPQL+CV+Y   SNTYGSLVGYI+G   RL++GE+ +G PAL K+P FYD  ++  Q FP KTF+M  +L+  I+VS  TD  F+      + D F C        G ++
Sbjct:   81 IIMLYIPGLVAIIIFYLLILLVGFWAARKSRSNPAGTTETEDVMLAGRNIGLLVGIFTMTATWVGGGYINGTAENTFRPGQGLVWCQAPIGYAASLVLGGFFFAKRMRSLAFVTMLDPFQNKYGERMCGLLFIPALLGETFWSAAILSALGATLGVIVELDQTTSVIISACIALLYTLFGGLYSVAYTDVVQLFCIFVGLWISLPFALLNKATVPISQTWDRWKGS-VEALDAGMYVDNLLMLTFGGIPWQVYFQRVLSCRTAKQAQILSFVAAIGCLIMALPSVLIGAVGASTDWNMTGYGRAENFTIPDGEAKLVLPLVLRYLCPVWVSFVGLGAVSAAVMSSSDSSVLSAASMFARNVVKPVFWQSATERQIIWVMRASIFGVGALSCLLAICIQSIYGLWYLCSDLIYVILFPQLICVLYVRFSNTYGSLVGYILGLFVRLTSGEALLGLPALFKYPYFYDDPRDFYQRFPCKTFAMLSTLVVTILVSYFTDLYFRKDSKRLKYDFFHCYKQRASASGSIH 604          
BLAST of slc5a-5 vs. Ensembl Cavefish
Match: slc5a7a (solute carrier family 5 member 7 [Source:NCBI gene;Acc:103035099])

HSP 1 Score: 496.508 bits (1277), Expect = 4.392e-168
Identity = 291/526 (55.32%), Postives = 387/526 (73.57%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSK--APLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFY---------DQEQN---LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVV 1710
            G+ ++ +FYLLI+ VGIWAA K+K     EG    E +M+ GRDIGL VG FTMTATWVGGGYINGTAE V+ PG GL W QAP GYA+SL++GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGEIFWSAAILSALGAT++VI+++  +++VI+S++IA+ YT+ GG+Y+VAYTDVVQLFCIFVGLW++VPFA+ N  V  I  T+ +      W+G    ++K  ++ D+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGC++MA+P+VL+GA+ ASTDWN T +  V     +ES+   +LP+V+ +LCP +V+F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD +I+W+MRI++F  GALA  M +   ++Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GY+ G + R+  GE  +  P  I +P +          QE     +Q FP+KT SM  S +  +  S    Y+F+SGK S + D  + VV
Sbjct:    7 GVAAIVIFYLLILIVGIWAAWKNKNSGVEEGTDRSETIMVGGRDIGLFVGAFTMTATWVGGGYINGTAEYVYLPGYGLAWAQAPFGYAMSLVLGGLFFAKPMRSRGYVTMLDPFQQIYGKRMGGLLFIPALMGEIFWSAAILSALGATLSVIVDININMSVIISALIAIFYTLVGGVYSVAYTDVVQLFCIFVGLWISVPFALSNPAVADIGVTAVKELYQDPWLGEIDSSDK-WMWADNFCLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCIVMAVPSVLIGAIGASTDWNQTSYGSVPPMQKDESEM--ILPIVLQHLCPPYVSFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDSEIVWVMRITIFVFGALATAMALLTGTVYGLWYLSSDLVYVIIFPQLISVLFVRGTNTYGSVAGYVFGLILRIGGGEPYLKLPPFIYYPGWYINKKVHHTTQEVEYLVVQKFPFKTMSMLASFLGNVAFSYLFKYLFESGKLSAKYDFLDAVV 529          
BLAST of slc5a-5 vs. Ensembl Cavefish
Match: ENSAMXT00000046234.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002032.1:177974:189073:1 gene:ENSAMXG00000036001.1 transcript:ENSAMXT00000046234.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 1.404e-47
Identity = 116/274 (42.34%), Postives = 166/274 (60.58%), Query Frame = 1
Query:  928 YFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN------------LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVN 1713
            ++    ++ S  +A  L FL+SF          L       TDWN T +  +     +ES    +LP+V+ +LCP +V+F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD++I+W+MRI++F  GALA  M +   ++Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GY+ G L R+  GE  +  P  I +P + +E+             +Q FP+KT +M  SL+   + S    Y+F+SG  S + D  + VV+
Sbjct:   10 HYMDSFAAVSKTKAMHLIFLSSF----------LSTYSLFETDWNQTSYGSIPPMEKDESDM--ILPIVLQHLCPPFVSFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDREIVWVMRITIFVFGALATAMALLTGTVYGLWYLSSDLVYVIIFPQLISVLFIKGTNTYGSVAGYVFGLLLRIGGGEPYLKLPPFIYYPGWIEEEKVHNLTGEVEHIVVQKFPFKTAAMLASLLGNAVCSYMAKYLFESGMLSPKYDFLDAVVS 271          
BLAST of slc5a-5 vs. Ensembl Sea Lamprey
Match: slc5a7a (solute carrier family 5 member 7a [Source:ZFIN;Acc:ZDB-GENE-090313-273])

HSP 1 Score: 311.612 bits (797), Expect = 9.685e-100
Identity = 202/384 (52.60%), Postives = 271/384 (70.57%), Query Frame = 1
Query:  604 AILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFP------FYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMK 1719
            A +S LGAT++VI+++  D+AV++S+ IAV YT+ GGLY+VAYTDVVQL CIF+GL L+VPFA+MN  V SI++T+        W+GS  P +   I++D+ L+L++GGIPWQVYFQRVLS+ SA  AQVLS+LA+FGCL+MA+P +++GAV AST+WN T + L      NES    +LP+VM +LCPE+++F GLGAV+AAVMSSADSSILSA+SMFARN+ K    Q ASD +I+W+MRI+VF  G  A  + +  KS+Y LWYL SDLVYVI+FPQL+CV++   +NTYGS+  Y++G LFR+S GE  +    LI +P      F      +Q FP+KT SM +S    I VS    Y+F+ G  S   D  +CVV M 
Sbjct:    3 ARMSPLGATLSVIVDINIDMAVVVSACIAVLYTLVGGLYSVAYTDVVQLICIFLGLGLSVPFALMNPAVSSISETAHASDTQPGWLGSVDPRDAF-IWVDNYLLLMLGGIPWQVYFQRVLSASSAAYAQVLSYLAAFGCLVMAVPCIIIGAVGASTNWNETSYGLPDPKARNESDM--ILPIVMQHLCPEYISFFGLGAVAAAVMSSADSSILSASSMFARNIYKLAVRQQASDTEIVWVMRITVFIFGFAATALALLAKSVYGLWYLSSDLVYVILFPQLICVLFIKGANTYGSITAYVVGLLFRISGGEPYLHLDPLICYPGCYITDFGQGPVTVQRFPFKTLSMLVSFHVNIAVSYLAKYLFEKGHLSPRFDFLDCVVAMD 383          
BLAST of slc5a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004085.1 (pep scaffold:Pmarinus_7.0:GL482976:3947:15220:-1 gene:ENSPMAG00000003735.1 transcript:ENSPMAT00000004085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.286 bits (765), Expect = 9.515e-95
Identity = 184/417 (44.12%), Postives = 274/417 (65.71%), Query Frame = 1
Query:  466 GGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNL--QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKD 1692
            G +FFA  MR   +VTMLDPFQ ++G+ +G L +IP   G++FW+ A+L+ALG+TI+VIL++   IAVI+S+ I + YT+ GGLY+VAYTD++QL  + VGL + VPFAMMN  V++I  T +       W G  +    I  +ID+ L + +G IPWQ YFQRVL++ S   AQV+SFL++   L++A+P+VL+GAVA STDWN T + L   +   E     +LP+V+ ++CP ++A +G+G ++AAVMSSADS++LSA S+F RNV   I    ASD++ +W++R +V   G++A ++ ++ +S Y LW  C +L Y+++FPQL CV++   SN YG +V +  G LFRL+ GE  +  PAL+++P Y +   L  Q  P KT +M ISL   +  S  T ++F SG      D
Sbjct:    1 GALFFAKPMRMGCYVTMLDPFQIRYGKWLGSLFYIPTAFGDLFWATAVLTALGSTISVILDIDRTIAVIVSAFITIIYTLLGGLYSVAYTDIIQLLFMVVGLVVCVPFAMMNPAVKNIGTTLTETVYQEPWRGR-LETGDITRWIDNMLYMTLGNIPWQGYFQRVLAAESGTHAQVISFLSALNTLLLAIPSVLIGAVAVSTDWNMTTYGLPSPHERGED--GMILPIVLQHICPNYIAIMGIGVLAAAVMSSADSALLSAGSLFTRNVYTQIIRPQASDQESMWVLRSTVLITGSVATVLALQTQSTYSLWLWCGELTYIVLFPQLCCVLFLSASNGYGLIVAFFSGLLFRLTGGEPLLSLPALVRYPGYHEVDGLVHQALPMKTIAMLISLTVNVAASFLTRHLFVSGTLPGRWD 414          
BLAST of slc5a-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002383.1 (pep scaffold:Pmarinus_7.0:GL486127:689:2759:1 gene:ENSPMAG00000002174.1 transcript:ENSPMAT00000002383.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 5.300e-43
Identity = 92/218 (42.20%), Postives = 144/218 (66.06%), Query Frame = 1
Query: 1054 DWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNL--QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFE 1701
            DWN T + L   +   E+    +LP+V+ ++CP +++ +G+GA++AAVMSSADS++LSA+S+F RN+   +    ASD++ +W++RIS+  IG++A ++ IK  S Y LW LC D+ YV++FPQ   V++F  SN+YG +VG+++G   RL+ GE+ +G PAL ++P Y +E  L  Q+FP KT SM +SL+  I V   T ++F S K     D F 
Sbjct:    1 DWNMTTYGLPTPHERGEN--GMILPIVLQHICPYFISILGMGALAAAVMSSADSALLSASSLFTRNIYAKLIRPKASDQETLWVLRISILAIGSMAMILAIKTVSTYSLWLLCGDMAYVVVFPQFCLVLFFQASNSYGLVVGFVLGLFVRLTGGEALLGLPALFRYPGYYEEGGLDYQMFPMKTLSMTVSLLSNIGVCYLTRHLFLSKKLPARFDFFN 216          
BLAST of slc5a-5 vs. Ensembl Nematostella
Match: EDO44300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWE4])

HSP 1 Score: 448.743 bits (1153), Expect = 4.654e-151
Identity = 265/504 (52.58%), Postives = 364/504 (72.22%), Query Frame = 1
Query:  214 FYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKT----SSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFK---LVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFEC 1704
            FY++I+ +G+WAA++ K   EGE E    MLAGR IGL VG FTMTATWVGGGYINGTAE V+T    L+W QAP GYALSL++GG+ FA  MR + + TMLDPFQ+K+G RMGGLL+IPALMGEIFW+ AILSALGAT++V++ +G +++VI+S+ IA+ YT+ GGLY+VAYTDV+QL CIF+GLWL++PFA+ +  V  I+ T    +S W+G   P +    +ID AL+L  GGIPWQVYFQRVLS ++   ++ LS  A+ GC+IMA+PAV++GA+  ST      F    L +   L+  Q   VLP+V+ +L P ++AF GLGAVSAAVMSSADSS+LSAASMF+ N+ K IF Q A+ ++++W+MR+++F +GA+A +M + ++S+Y LW+LC D+VYV +FPQL CV++F  +NTYGS  G+I+G L R+  GE  +  P +IKFP+Y+ E + QLFP++T SM  + + I+ VS     +F  G      D  EC
Sbjct:   13 FYIVILVLGLWAARRRK---EGEEET---MLAGRSIGLFVGTFTMTATWVGGGYINGTAEMVYT--STLVWAQAPWGYALSLVIGGLVFAKIMRKREYFTMLDPFQEKYGVRMGGLLYIPALMGEIFWTGAILSALGATVSVVIGLGQELSVIVSACIAIFYTLIGGLYSVAYTDVIQLVCIFIGLWLSIPFALTHDAVTDISVTATADASGWIGE-FPVQP-GPWIDFALLLTFGGIPWQVYFQRVLSCKTVNASRNLSLAAAVGCIIMAIPAVIIGAIGKSTGNRLYPFASNYLTLCIELSHFQGPLVLPMVLRHLTPNYIAFFGLGAVSAAVMSSADSSVLSAASMFSHNIYKMIFRQKATQRELLWVMRLAIFLVGAIATIMALVVESVYTLWFLCGDVVYVTLFPQLCCVIFFHDTNTYGSFTGFILGILLRVLGGEPALKIPVIIKFPYYN-ETDGQLFPFRTLSMVCAFVTILAVSYLARLLFHKGVLPLSADFAEC 505          
BLAST of slc5a-5 vs. Ensembl Nematostella
Match: EDO46558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPS9])

HSP 1 Score: 436.032 bits (1120), Expect = 4.662e-146
Identity = 259/508 (50.98%), Postives = 354/508 (69.69%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLN---ESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDR-SNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFEC 1704
            G++ + VFYL I+ VG+WAAKK K      S  E  MLAGR +G+ VG FTMTATWVGGGYINGTAE V+  G+GL+W QAP GY  SL++GG+FFA  MR + ++TMLDPF +K+G R GG+ FIPAL+GE+FWSA+IL+ALG+T++V++ +    +VI S+ IAVAYT+ GGLY+VAYTD++QL CIF+GLWL++PF M N  V  I+     W+G   P  K  +++D  + L+ GGIPWQVYFQRVL+ R+ + AQ LSF A+ GC+I  +P++++GA    TDW+ T F     N  N   E     +LP+ + YL P  V+FIGLGAVSAAVMSS+DSS+LSA++MF+ NV K +F   A  +++ W++RI++  +GA+A  M + +KSIY L+ LCSD+VYVI+FPQL+CV+Y D+  NTYG++ GYI+G   R+  GE  +G    I FP+Y+ E + QLFPY+T SM   L  II+VS     +F  G    + D F C
Sbjct:    8 GLLGILVFYLAILAVGLWAAKKRK------SNEEESMLAGRSLGIYVGSFTMTATWVGGGYINGTAEAVYAEGKGLVWAQAPWGYTTSLVLGGLFFAKIMRMREYMTMLDPFTRKYGPRFGGVCFIPALIGEVFWSASILAALGSTVSVVVGLDRFTSVITSAAIAVAYTLVGGLYSVAYTDILQLICIFIGLWLSIPFIMTNPAVGDISD-HKEWIGEWEP-AKAGLWLDYGMHLIFGGIPWQVYFQRVLACRTPKVAQGLSFTAAIGCVIFTIPSIIIGAAGKVTDWSKTSFYTGPVNATNVTVEFDQSLILPMALQYLTPTAVSFIGLGAVSAAVMSSSDSSVLSASTMFSHNVYKLVFRPQALSREMYWVLRIAIIGVGAIATTMALTVKSIYVLFVLCSDIVYVILFPQLLCVIYMDKIVNTYGAVSGYIVGLSLRILGGEPNVGIQPTIIFPWYN-ETDGQLFPYRTLSMASGLFAIIVVSQLLQILFNRGIVPMKYDFFHC 506          
BLAST of slc5a-5 vs. Ensembl Medaka
Match: ENSORLT00000019489.2 (high-affinity choline transporter 1 [Source:NCBI gene;Acc:101160945])

HSP 1 Score: 504.212 bits (1297), Expect = 4.393e-171
Identity = 291/527 (55.22%), Postives = 390/527 (74.00%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGES--ECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTS------SRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQN------------LQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVN 1713
            G+V++ +FYL+I+ VGIWAA K+K    GES    E++M+ GRDIGL VG FTMTATWVGGGYINGTAE V+ P  GL W QAP GYALSL++GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGEIFWSAAILSALGAT++VI+++  DI+V+LS++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ N  V  I  T+      S W+G   P ++  +++D+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGCL+MA+P+VL+GA+ ASTDWN T +  +     ++S    +LP+V+ +LCP +++F GLGAVSAAVMSSADSSILSA+SMFARN+ +    Q+ASD++I+W+MR+++F  GA+A  M +   S+Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+ GYI GFL R+  GE  +  P  I +P +  E+             LQ FP+K+ SM  S +  +  S    Y+F++G  S + D  + VV+
Sbjct:    7 GLVAIVIFYLVILFVGIWAAWKNKNSGVGESGDRSESIMVGGRDIGLFVGGFTMTATWVGGGYINGTAEYVYLPDYGLAWAQAPFGYALSLVVGGLFFAKPMRSRGYVTMLDPFQQMYGKRMGGLLFIPALMGEIFWSAAILSALGATLSVIVDINIDISVVLSALIAIFYTLVGGLYSVAYTDVVQLFCIFLGLWISVPFALSNPVVSDITVTANEKIYQSPWLGKIKPEDR-WLWVDNFFLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCLVMAVPSVLIGAIGASTDWNKTTYGPIAPKDKDDSD--KILPIVLQHLCPPYISFFGLGAVSAAVMSSADSSILSASSMFARNIYQLALRQSASDREIVWVMRVTIFVFGAIATAMALLTGSVYGLWYLSSDLVYVIIFPQLLSVLFVKGTNTYGSVAGYIFGFLLRIGGGEPYLKLPPFIYYPNWVIEEKIHHLTGNVEYFVLQRFPFKSMSMVASFLANVAFSYLAKYLFETGMLSHKYDFLDAVVS 530          
BLAST of slc5a-5 vs. Ensembl Medaka
Match: slc5a7a (high-affinity choline transporter 1-like [Source:NCBI gene;Acc:101171815])

HSP 1 Score: 501.13 bits (1289), Expect = 9.818e-170
Identity = 300/575 (52.17%), Postives = 408/575 (70.96%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSK--APLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSR------WMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNL------------QLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSI 1857
            G+V++A+FYLLI+ VGIWAA K+K     EG    E +M+ GRDIGL VG FTMTATWVGGGYINGTAE V+ P  GL W QAP GYALSL++GG+FFA  MR++G+VTMLDPFQ+ +G+RMGGLLFIPALMGEIFWSAAIL+ALGAT++VI+++   ++VI+S++IA+ YT+ GGLY+VAYTDVVQLFCIF+GLW++VPFA+ N  V  I  ++ +      W GS I  + I ++ID+  +L++GGIPWQVYFQRVLS+ SA  AQVLSFLA+FGCLIMA+P+VL+GA+ ASTDWN T +  +     ++ Q   +LP+V+ +LCP +V+F GLGAVSAAVMSSADSSILSA+SMFARN+ +  F Q+ASD++I+W+MRI++F  G LA +M +   ++Y LWYL SDLVYVIIFPQL+ V++   +NTYGS+  Y+ G + R+  GE  +  P  I +P +  E+ +            Q FP+KT SM  S +   I S    Y+F+SGK S + D  + VV+     G++  +    T  N+I    M+  + P+ S    ++   R+++
Sbjct:    7 GLVAIAIFYLLILVVGIWAAWKNKHSGEAEGTDRSETIMVGGRDIGLFVGGFTMTATWVGGGYINGTAEYVYLPEYGLAWAQAPFGYALSLVVGGLFFAKPMRSRGYVTMLDPFQQLYGKRMGGLLFIPALMGEIFWSAAILNALGATLSVIVDINIKMSVIISALIAIFYTLVGGLYSVAYTDVVQLFCIFLGLWISVPFALTNPAVSDITVSAVKKVHQAPWKGS-INKDDIWVWIDNFCLLMLGGIPWQVYFQRVLSASSATYAQVLSFLAAFGCLIMAVPSVLIGAIGASTDWNQTSYGSIAPK--DKDQADMILPIVLQHLCPPFVSFFGLGAVSAAVMSSADSSILSASSMFARNIYQLAFRQSASDREIVWVMRITIFVFGGLATMMALVTGTVYGLWYLSSDLVYVIIFPQLLSVLFVKGTNTYGSVAAYLFGLVLRIGGGEPYLRLPPFIYYPGWIIEKQIHQETGIIEDFVKQRFPFKTVSMVASFVANFIFSHLAKYLFESGKISHKYDFLDAVVSRH--SGEIMDKTTLVTRSNNIGLSEMAPVR-PRLSVTLAAAFTRRDTL 575          
BLAST of slc5a-5 vs. Ensembl Medaka
Match: ENSORLT00000010735.2 (high-affinity choline transporter 1-like [Source:NCBI gene;Acc:101161884])

HSP 1 Score: 352.443 bits (903), Expect = 1.009e-112
Identity = 197/483 (40.79%), Postives = 317/483 (65.63%), Query Frame = 1
Query:  193 GIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENL-----MLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKT-------SSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNL--QLFPYKT 1599
            G+VS+ +FY+ I+ +G+W + K+K   + E  C        ++ GR+I ++VGIFTMTATWVGGGYI GTAE V++P QGLIW   P  Y L+  +GG+FFA  MR++ +VTMLDPFQ ++G     +L +PA++ +I W + +L+ALG T++VIL +   I++I+S+ +++ YT  GGLY+VAYTD++QL  IFV LWL +PF +++  V SI++T          W+G  +  E    ++D  L++V+GG+ +Q  +QR+LS+ S+ +AQ+  F A+    +M +P+V++G +A S DWN T + L             +LPL +  L P WV+ +G+G+V+AAVMSS DS++LS+AS+F +N+ K+   ++AS++++ W++++SV  +G     +     S+  LW +  DL+Y +IFPQLVCV++F  +N YG++ G++ GFL RL +GE  +  PA + +P + +E  +  Q FPY+T
Sbjct:    7 GLVSVVIFYVCILAIGVWGSHKAK---KVEKTCPGSKSDVSIIGGRNISVLVGIFTMTATWVGGGYILGTAEAVYSPNQGLIWAMGPPAYFLNFFLGGLFFAKPMRSKRYVTMLDPFQNRYGNTFTAVLLVPAIISDILWVSCVLAALGGTMSVILGLSSTISIIISAAVSIIYTFLGGLYSVAYTDIIQLCFIFVSLWLCIPFLVLSPAVGSISQTLPLNQTVGHSWVGH-LELEDAGKWVDQMLLMVLGGLSYQALYQRILSAASSVQAQITCFAAAGAVFLMGIPSVVIGILAVSADWNQTDYGL--PPPFERGDSGKILPLALQQLTPTWVSVLGIGSVAAAVMSSMDSALLSSASLFTKNIYKTTLRRSASERELQWVIKVSVLIVGLAGMGLAFGGTSVLALWLMSGDLLYCVIFPQLVCVLHFPYTNIYGAISGFLSGFLLRLLSGEPLLAIPAALLYPGWKEENGIISQRFPYRT 483          
BLAST of slc5a-5 vs. Planmine SMEST
Match: SMESG000028614.1 (SMESG000028614.1)

HSP 1 Score: 1099.73 bits (2843), Expect = 0.000e+0
Identity = 598/599 (99.83%), Postives = 599/599 (100.00%), Query Frame = 1
Query:  178 MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDXXXXXXXXXXXXYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMXXXXXXXXXXXXSTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGXXXXXXXXXXXXXXXXXXXMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKFPFYDQEQNLQLFPYKTXXXXXXXXXXXXXXLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK 1974
            MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDIAVILSSIIAVAYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMALPAVLLGAVAASTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGAVSAAVMSSADSSILSAASMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIK+PFYDQEQNLQLFPYKTFSMFISLIFIIIVSLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK
Sbjct:    1 MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGLVVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIFFAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGATITVILNVGDDIAVILSSIIAVAYTMFGGLYAVAYTDVVQLFCIFVGLWLAVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQVYFQRVLSSRSARRAQVLSFLASFGCLIMALPAVLLGAVAASTDWNATKFKLVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGAVSAAVMSSADSSILSAASMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYELWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTIGFPALIKYPFYDQEQNLQLFPYKTFSMFISLIFIIIVSLATDYMFKSGKWSKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDSQSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK 599          
The following BLAST results are available for this feature:
BLAST of slc5a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SLC5A71.478e-17452.45solute carrier family 5 member 7 [Source:HGNC Symb... [more]
SLC5A71.478e-17452.45solute carrier family 5 member 7 [Source:HGNC Symb... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cho-11.231e-17356.62High-affinity choline transporter 1 [Source:UniPr... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ChT2.415e-17453.37gene:FBgn0038641 transcript:FBtr0083668[more]
ChT2.415e-17453.37gene:FBgn0038641 transcript:FBtr0083669[more]
back to top
BLAST of slc5a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc5a7a1.023e-16950.16solute carrier family 5 member 7a [Source:ZFIN;Acc... [more]
CR925787.11.873e-16950.16solute carrier family 5 member 7a [Source:NCBI gen... [more]
SLC5A73.530e-12450.85high-affinity choline transporter 1-like [Source:N... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC5A71.295e-16451.34solute carrier family 5 (sodium/choline cotranspor... [more]
ENSXETT00000017413.14.975e-12443.18high affinity choline transporter 1 [Source:NCBI g... [more]
ENSXETT00000017420.11.732e-12343.18high affinity choline transporter 1 [Source:NCBI g... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slc5a71.033e-17252.73solute carrier family 5 (choline transporter), mem... [more]
back to top
BLAST of slc5a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9GZV3|SC5A7_HUMAN7.097e-17452.45High affinity choline transporter 1 OS=Homo sapien... [more]
sp|Q9JMD7|SC5A7_RAT1.820e-17353.07High affinity choline transporter 1 OS=Rattus norv... [more]
sp|Q9VE46|SC5A7_DROME2.421e-17353.37High-affinity choline transporter 1 OS=Drosophila ... [more]
sp|O02228|SC5A7_CAEEL1.566e-17256.62High-affinity choline transporter 1 OS=Caenorhabdi... [more]
sp|Q8BGY9|SC5A7_MOUSE7.224e-17252.73High affinity choline transporter 1 OS=Mus musculu... [more]
back to top
BLAST of slc5a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEX20.000e+0100.00Slc5a-5 OS=Schmidtea mediterranea OX=79327 GN=slc5... [more]
A0A0R3SEQ90.000e+062.00Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S3IDZ20.000e+055.54high-affinity choline transporter 1 OS=Lingula ung... [more]
G7YWU10.000e+062.50High affinity choline transporter 1 OS=Clonorchis ... [more]
A0A4S2M9C40.000e+061.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc5a7a4.392e-16855.32solute carrier family 5 member 7 [Source:NCBI gene... [more]
ENSAMXT00000046234.11.404e-4742.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc5a7a9.685e-10052.60solute carrier family 5 member 7a [Source:ZFIN;Acc... [more]
ENSPMAT00000004085.19.515e-9544.12pep scaffold:Pmarinus_7.0:GL482976:3947:15220:-1 g... [more]
ENSPMAT00000002383.15.300e-4342.20pep scaffold:Pmarinus_7.0:GL486127:689:2759:1 gene... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc5a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO443004.654e-15152.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465584.662e-14650.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc5a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000019489.24.393e-17155.22high-affinity choline transporter 1 [Source:NCBI g... [more]
slc5a7a9.818e-17052.17high-affinity choline transporter 1-like [Source:N... [more]
ENSORLT00000010735.21.009e-11240.79high-affinity choline transporter 1-like [Source:N... [more]
back to top
BLAST of slc5a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028614.10.000e+099.83SMESG000028614.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013535
GenBankAKN21420.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013535 ID=SMED30013535|Name=slc5a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2180bp
TGACATTTCAATGTTCTCATCTTATAGTTTTGCCAAATATTGTCGTCATT
TCTAATTGTTAAGCCAAGTTCCGCTCGGCGATTCAGTAAAGGTTAATTAG
ATACTCTGAATTCGAAATAGGTAAGTCAGTGCGGTGCACACGGGTATTCG
ACTTCATCAAAATTCGAATAATTAACAATGGTATTCTGGCTAGGAATTGT
GTCTTTGGCAGTGTTTTATTTGCTAATCATTGGAGTTGGAATATGGGCCG
CTAAAAAGTCCAAAGCGCCACTTGAAGGAGAATCGGAGTGTGAAAACTTA
ATGTTAGCTGGAAGAGATATCGGCTTGGTTGTAGGAATATTTACAATGAC
AGCAACATGGGTTGGAGGAGGATATATAAACGGGACAGCTGAAAATGTGT
TTACTCCAGGACAAGGCTTAATTTGGTGCCAAGCACCTGTTGGTTATGCT
TTAAGTTTAATAATGGGAGGAATTTTCTTTGCTGGTAAGATGAGAGCTCA
AGGACATGTAACAATGTTAGATCCATTCCAAAAGAAATTCGGTGAGCGCA
TGGGTGGCTTACTTTTCATTCCTGCTTTAATGGGTGAAATATTTTGGTCC
GCTGCCATTTTATCAGCCTTAGGTGCAACAATTACAGTTATCCTTAATGT
TGGAGACGACATAGCAGTTATATTGTCTTCAATTATTGCTGTAGCATATA
CTATGTTTGGGGGTCTTTATGCTGTAGCGTATACTGATGTTGTTCAACTC
TTCTGTATATTTGTTGGATTGTGGTTGGCCGTACCTTTTGCAATGATGAA
CAAAAATGTCGAATCAATTGCCAAAACGAGCTCAAGATGGATGGGAAGTG
CAATTCCAAATGAAAAAATAGCAATTTATATTGATTCAGCTTTAATGTTA
GTTATGGGAGGAATCCCATGGCAGGTTTATTTCCAAAGAGTTTTGTCGAG
TCGCTCAGCTCGAAGAGCTCAAGTACTCAGTTTTCTTGCTTCTTTTGGTT
GTTTGATCATGGCTTTACCAGCTGTCTTGTTGGGAGCCGTAGCTGCATCT
ACAGATTGGAATGCAACGAAATTCAAATTAGTCGTTAACAATACTCTAAA
CGAGTCCCAATATAAGAATGTGCTTCCACTGGTAATGCATTACCTATGCC
CAGAATGGGTGGCATTCATTGGACTTGGAGCAGTTTCGGCCGCGGTCATG
TCTTCGGCGGACTCATCTATCCTTTCAGCAGCATCAATGTTTGCTAGGAA
TGTCGTGAAATCCATTTTCTGGCAAACGGCAAGCGATAAACAAATAATAT
GGATCATGCGAATAAGTGTTTTTTTCATTGGTGCTCTTGCGTGTTTAATG
GGAATAAAAATCAAATCAATTTATGAACTTTGGTATTTGTGTTCAGATTT
GGTATATGTCATTATATTCCCCCAACTTGTTTGTGTAGTGTATTTTGACA
GATCAAATACATACGGCTCATTGGTTGGTTACATAATAGGATTTTTGTTT
CGGCTATCAGCCGGGGAAAGCACCATTGGTTTTCCAGCCTTGATCAAATT
TCCTTTTTATGACCAAGAACAAAACCTTCAACTATTTCCTTATAAAACAT
TTTCAATGTTCATTTCTCTGATTTTTATCATCATTGTCTCATTGGCAACC
GACTACATGTTCAAATCTGGAAAATGGTCGAAGGAAAAAGATATTTTTGA
ATGTGTTGTTAACATGAAGCCAATTCAAGGCCAATTGAATGCTGAAGATG
AAGACGGAACTGTCATTAATCACATTCTCGCCAAACGAATGTCTTTTAAA
AAATATCCTCAAACTTCTCAAGACAGTCAAAGTAGTGTCAATTATCGAAA
CAGTATAAAGCTGAATCAAACAGCGTTGGAGTTGATTTCAAGTGCAAAAG
AAATTTCCGAACAAGAAGAAAAATCTACTTTTGTTCAAGACAGTCCCAAT
AAAGAAATTCCAGATAAAAATAAATAAAGTTTTTTTTAAGTAAATTTTTA
ATATTTTCAAACAAAGTTTAGTGAGAAATTTCAAGTTTTATGGTTGTGAA
AAATTGTACTTTTGTTTCTTCGGTTGTGATTTTTAAAATTGTTTAAAAAG
GTACTTTTTAATGATGTTTTAATGATATTTACGTTTTAGATGTTTGTAGA
TTTATTGTTTAACTACAGGTTGTGATGTCG
back to top

protein sequence of SMED30013535-orf-1

>SMED30013535-orf-1 ID=SMED30013535-orf-1|Name=SMED30013535-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=600bp
MVFWLGIVSLAVFYLLIIGVGIWAAKKSKAPLEGESECENLMLAGRDIGL
VVGIFTMTATWVGGGYINGTAENVFTPGQGLIWCQAPVGYALSLIMGGIF
FAGKMRAQGHVTMLDPFQKKFGERMGGLLFIPALMGEIFWSAAILSALGA
TITVILNVGDDIAVILSSIIAVAYTMFGGLYAVAYTDVVQLFCIFVGLWL
AVPFAMMNKNVESIAKTSSRWMGSAIPNEKIAIYIDSALMLVMGGIPWQV
YFQRVLSSRSARRAQVLSFLASFGCLIMALPAVLLGAVAASTDWNATKFK
LVVNNTLNESQYKNVLPLVMHYLCPEWVAFIGLGAVSAAVMSSADSSILS
AASMFARNVVKSIFWQTASDKQIIWIMRISVFFIGALACLMGIKIKSIYE
LWYLCSDLVYVIIFPQLVCVVYFDRSNTYGSLVGYIIGFLFRLSAGESTI
GFPALIKFPFYDQEQNLQLFPYKTFSMFISLIFIIIVSLATDYMFKSGKW
SKEKDIFECVVNMKPIQGQLNAEDEDGTVINHILAKRMSFKKYPQTSQDS
QSSVNYRNSIKLNQTALELISSAKEISEQEEKSTFVQDSPNKEIPDKNK*
back to top
Aliases
The feature 'slc5a-5' has the following synonyms
Synonym
slc5a-5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038377Na/Glc_symporter_sf
IPR001734Na/solute_symporter
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001734Sodium/solute symporterPFAMPF00474SSFcoord: 42..438
e-value: 6.6E-31
score: 107.6
IPR001734Sodium/solute symporterPROSITEPS50283NA_SOLUT_SYMP_3coord: 3..452
score: 43.929
IPR038377Sodium/glucose symporter superfamilyGENE3DG3DSA:1.20.1730.10coord: 33..516
e-value: 1.2E-62
score: 214.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 575..599
NoneNo IPR availablePANTHERPTHR45897FAMILY NOT NAMEDcoord: 2..525
NoneNo IPR availableCDDcd11474SLC5sbd_CHTcoord: 7..488
e-value: 0.0
score: 547.508
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 48..67
NoneNo IPR availableTMHMMTMhelixcoord: 4..23
NoneNo IPR availableTMHMMTMhelixcoord: 162..184
NoneNo IPR availableTMHMMTMhelixcoord: 231..253
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
NoneNo IPR availableTMHMMTMhelixcoord: 330..352
NoneNo IPR availableTMHMMTMhelixcoord: 401..423
NoneNo IPR availableTMHMMTMhelixcoord: 373..395
NoneNo IPR availableTMHMMTMhelixcoord: 191..208
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
NoneNo IPR availableTMHMMTMhelixcoord: 467..489