Histone acetyltransferase type B catalytic subunit

Overview
NameHistone acetyltransferase type B catalytic subunit
Smed IDSMED30013519
Length (bp)1212
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase type B catalytic subunit (SMED30013519) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase type B catalytic subunit (SMED30013519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase type B catalytic subunit (SMED30013519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase type B catalytic subunit (SMED30013519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013519h1SMcG0012066 SmedASXL_010393SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30013519h1SMcG0012066 dd_Smed_v4_10558_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Human
Match: HAT1 (histone acetyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:4821])

HSP 1 Score: 205.682 bits (522), Expect = 1.487e-61
Identity = 128/395 (32.41%), Postives = 219/395 (55.44%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIVKND-NCKCYGKLIDQYTL-----NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-GKTKDFSVGNQAVL--EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F ++++ + + K +G L+  Y++      EN   T+ IY++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +        + DIT EDPS  +  LRDFV  K    L  F  + +     +        K KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   +  K +D +   + +   E+ ++   I    ++E+LE+ +  ++
Sbjct:   15 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENF--TFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMVIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELV 406          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Celegans
Match: hat-1 (Histone AcetylTransferase [Source:UniProtKB/TrEMBL;Acc:Q21484])

HSP 1 Score: 193.356 bits (490), Expect = 2.338e-57
Identity = 122/399 (30.58%), Postives = 211/399 (52.88%), Query Frame = 2
Query:   62 FTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDKL--SNVERNL-----ESFKN-IVKNDNCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQK--YKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKT-KDFSVGNQAVL----------EMNDEEKSILFEREYERLEQCYSIIIMKLDK 1195
            +  D  +++ +  ++   EI     + P+  +Q +G+ E IFGY++L + +  +A +L  +I+ SY  K +N   + AD+    +IDKL   +V  N+     E F+  ++K  + K +G+++ ++ L    YE Y + E   ++  F LF ER+Q L +FF++  S  D  + +W ++ IY++    + D S      G+ T+F F+ Y D++R RI+Q+L+LP ++K G G   +  F     A+  + D+TVE P DQF  LRD+VDC N ++L+EF  + +K     K R     KLKIS QQ  R+YEIL  +  NK +  E    +  V +RL     K+ +D+   N A+           +M++E K     + Y+RL + Y   I ++++
Sbjct:   15 YISDGLAVVKMTFLKNMQEISTAPRYEPEMVYQHFGDEETIFGYEDLEVTIHHTAQTLYSYINVSYSSKAKNENGLEADD----VIDKLVHPDVRPNVLVSGKEEFQQKLIKQKDFKPFGEMVHKFELKGKSYEVYKVAE---QTEEFNLFLERIQTLGMFFIECCSLTDNTEDNWLHYFIYERCDTGEGDGSTVANVAGYATLFKFYNYIDRIRPRIAQMLLLPQYRKSGIGASFMESFLRDLRASPEVFDVTVESPGDQFVSLRDYVDCVNCMTLREFAPENLKRGYSDKMRQAALEKLKISRQQARRVYEILRYRATNKKDKEELKAQRIDVKRRLYAPMKKSDQDWKRLNLALTPDELRQAACGQMDEETKFSTLSQNYDRLMEAYQKTIDRIEQ 406          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Fly
Match: Hat1 (gene:FBgn0037376 transcript:FBtr0078670)

HSP 1 Score: 214.542 bits (545), Expect = 2.097e-65
Identity = 141/403 (34.99%), Postives = 215/403 (53.35%), Query Frame = 2
Query:   41 VESYLEEFTCDANSLINIKLIRTEDEIDK-CIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV------ENTEDILADNFEHSLIDKLSNVERNLESF-KNIVKNDNCKCYGKLIDQYTL--NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-------GKTKDFSVGNQ---AVLEMNDEEKSILFEREYERLEQCYSIIIMKL 1189
            +E Y ++F  DA  +++ KLIR + +I+   + F P   HQ +GE+E IFGY++L + + ++A  L  ++   Y  +V      E   D +      SL D    +  NL+ F K + K D  + +G+ I +Y    ++     + IY+ E +S +F  F  RLQ  +L+FVD +S+ID +DP W YF+ Y+KYK+ D  + YAT G+ TV+ ++AYP   R RISQ+LILPPFQK G   +L+   Y    +  N+ DITVEDPS+ FQ LR+FVD ++ + LK F    I     K+        LK++  Q+ ++YE+L L + N  +  E   Y+  V KRL  V+        K + F +  +   A L    +    L E EY  +EQ Y   I KL
Sbjct:    4 IEKY-QDFVIDALEVVDFKLIRDKADINNDALTFHPAMAHQIFGETETIFGYQDLHVRVMYTAGPLHIYLGVDYGKRVNEISGGEIKADDVVSTIAQSLPDGCYFI--NLDEFLKTLDKADKFQPFGEKISEYRRVSDDGSERLFEIYQCEYKSSSFLKFFARLQTFILWFVDAASYIDTDDPQWCYFLSYEKYKNNDGQWQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLATQLVESIYRFYQSQKNVVDITVEDPSEDFQRLRNFVDARSCMKLKSFAPGEIVKGFNKEMVREAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKMERFKMDTEMLRARLPTVQQRMEQLHE-EYRVVEQEYQSTIAKL 402          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Fly
Match: Hat1 (gene:FBgn0037376 transcript:FBtr0078669)

HSP 1 Score: 214.542 bits (545), Expect = 2.097e-65
Identity = 141/403 (34.99%), Postives = 215/403 (53.35%), Query Frame = 2
Query:   41 VESYLEEFTCDANSLINIKLIRTEDEIDK-CIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV------ENTEDILADNFEHSLIDKLSNVERNLESF-KNIVKNDNCKCYGKLIDQYTL--NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-------GKTKDFSVGNQ---AVLEMNDEEKSILFEREYERLEQCYSIIIMKL 1189
            +E Y ++F  DA  +++ KLIR + +I+   + F P   HQ +GE+E IFGY++L + + ++A  L  ++   Y  +V      E   D +      SL D    +  NL+ F K + K D  + +G+ I +Y    ++     + IY+ E +S +F  F  RLQ  +L+FVD +S+ID +DP W YF+ Y+KYK+ D  + YAT G+ TV+ ++AYP   R RISQ+LILPPFQK G   +L+   Y    +  N+ DITVEDPS+ FQ LR+FVD ++ + LK F    I     K+        LK++  Q+ ++YE+L L + N  +  E   Y+  V KRL  V+        K + F +  +   A L    +    L E EY  +EQ Y   I KL
Sbjct:    4 IEKY-QDFVIDALEVVDFKLIRDKADINNDALTFHPAMAHQIFGETETIFGYQDLHVRVMYTAGPLHIYLGVDYGKRVNEISGGEIKADDVVSTIAQSLPDGCYFI--NLDEFLKTLDKADKFQPFGEKISEYRRVSDDGSERLFEIYQCEYKSSSFLKFFARLQTFILWFVDAASYIDTDDPQWCYFLSYEKYKNNDGQWQYATAGYTTVYEYYAYPQNKRPRISQMLILPPFQKLGLATQLVESIYRFYQSQKNVVDITVEDPSEDFQRLRNFVDARSCMKLKSFAPGEIVKGFNKEMVREAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKMERFKMDTEMLRARLPTVQQRMEQLHE-EYRVVEQEYQSTIAKL 402          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Zebrafish
Match: hat1 (histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-99])

HSP 1 Score: 218.009 bits (554), Expect = 1.169e-66
Identity = 126/352 (35.80%), Postives = 205/352 (58.24%), Query Frame = 2
Query:   41 VESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIV-KNDNCKCYGKLIDQYTLNENVYE----TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            +E  L E+ CD N  I +KL+R  ED  D+   F P+F+HQ +G+ E  FGYK L+I L  SA +L       Y  +V +  D +  D+ E  + + + +    N + F +++ K  N K +G L   Y ++ NV      TY I++ ++  P F+ ++ERLQ  L++F++ +SFIDV+D  W++F++++KY + D    YAT+G++TV+N++ YPDK R R+SQ+LILPPFQ +GHG +LL   +     +  ++DIT EDPS+ +  LRDFV  K  L+L  F  + +     ++  S    KLKI+ +   R+YEIL L+  +  +  +  +++  V KRL   + K +
Sbjct:    1 MEKKLAEYKCDTNEAICLKLVRFPEDIDDESTTFHPEFSHQLFGDDEVAFGYKGLQIQLYQSAGNLNTLFKVKYTARVTDKFDCVEPDDVEGKIREIIPAGFCCNTDDFISVLEKEANFKPFGSLQHTYKVH-NVEAGEDLTYQIHKVDISCPGFREYHERLQTFLMWFIETASFIDVDDDRWDFFLVFEKY-NKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLLETVHRYYCTSPKVQDITAEDPSENYVKLRDFVLVKLCLTLPSFASEKLSQGFSEEMASEAREKLKINKKHARRVYEILRLRNTDMNDEKKAREFRLEVKKRLFGPYRKNQ 350          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Zebrafish
Match: hat1 (histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-99])

HSP 1 Score: 218.009 bits (554), Expect = 1.732e-66
Identity = 126/354 (35.59%), Postives = 206/354 (58.19%), Query Frame = 2
Query:   35 DSVESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIV-KNDNCKCYGKLIDQYTLNENVYE----TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            + +E  L E+ CD N  I +KL+R  ED  D+   F P+F+HQ +G+ E  FGYK L+I L  SA +L       Y  +V +  D +  D+ E  + + + +    N + F +++ K  N K +G L   Y ++ NV      TY I++ ++  P F+ ++ERLQ  L++F++ +SFIDV+D  W++F++++KY + D    YAT+G++TV+N++ YPDK R R+SQ+LILPPFQ +GHG +LL   +     +  ++DIT EDPS+ +  LRDFV  K  L+L  F  + +     ++  S    KLKI+ +   R+YEIL L+  +  +  +  +++  V KRL   + K +
Sbjct:    5 NDMEKKLAEYKCDTNEAICLKLVRFPEDIDDESTTFHPEFSHQLFGDDEVAFGYKGLQIQLYQSAGNLNTLFKVKYTARVTDKFDCVEPDDVEGKIREIIPAGFCCNTDDFISVLEKEANFKPFGSLQHTYKVH-NVEAGEDLTYQIHKVDISCPGFREYHERLQTFLMWFIETASFIDVDDDRWDFFLVFEKY-NKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLLETVHRYYCTSPKVQDITAEDPSENYVKLRDFVLVKLCLTLPSFASEKLSQGFSEEMASEAREKLKINKKHARRVYEILRLRNTDMNDEKKAREFRLEVKKRLFGPYRKNQ 356          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Match: prpf19 (pre-mRNA processing factor 19 [Source:Xenbase;Acc:XB-GENE-975233])

HSP 1 Score: 233.417 bits (594), Expect = 4.774e-72
Identity = 134/391 (34.27%), Postives = 232/391 (59.34%), Query Frame = 2
Query:   38 SVESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTL-NENVYE--TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            ++E  L E+ CD N  I +KL+R  ED  D+ + F P+++HQ +G+ E  FGYK L+I L +SA +L+      Y  KV++  D++  D+ E+ + + + S      + F ++++ + N K  G ++  YT+ NE   E  TY IY++++  P F+ ++ERLQ  L++F++ +S+IDV+D  W+YF++++KY + D +  YAT+G++TV+N++ YPDK R R+SQ+L+LPPFQ +GHG +LL   +   ++  N+ DIT EDPS+ F  LRDFV  K   +L  F ++ +     ++  +    KLKI+ +   R+YEIL L+  +  +  +   Y+  V KRL   + K +      +  L   E+ ++   I    ++E+LE+ Y  ++
Sbjct:   24 AMEKKLAEYKCDTNEAIKLKLVRFPEDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRELIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKY-NKDGATLYATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRLDVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLV 413          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Match: prpf19 (pre-mRNA processing factor 19 [Source:Xenbase;Acc:XB-GENE-975233])

HSP 1 Score: 216.853 bits (551), Expect = 6.275e-66
Identity = 128/385 (33.25%), Postives = 223/385 (57.92%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTL-NENVYE--TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            LE ++C         L   ED  D+ + F P+++HQ +G+ E  FGYK L+I L +SA +L+      Y  KV++  D++  D+ E+ + + + S      + F ++++ + N K  G ++  YT+ NE   E  TY IY++++  P F+ ++ERLQ  L++F++ +S+IDV+D  W+YF++++KY + D +  YAT+G++TV+N++ YPDK R R+SQ+L+LPPFQ +GHG +LL   +   ++  N+ DIT EDPS+ F  LRDFV  K   +L  F ++ +     ++  +    KLKI+ +   R+YEIL L+  +  +  +   Y+  V KRL   + K +      +  L   E+ ++   I    ++E+LE+ Y  ++
Sbjct:   11 LETYSCGCAKQKVYVLRFPEDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRELIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKY-NKDGATLYATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRLDVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLV 394          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Match: prpf19 (pre-mRNA processing factor 19 [Source:Xenbase;Acc:XB-GENE-975233])

HSP 1 Score: 214.927 bits (546), Expect = 2.066e-65
Identity = 126/374 (33.69%), Postives = 220/374 (58.82%), Query Frame = 2
Query:   86 INIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTL-NENVYE--TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            I  K+   ED  D+ + F P+++HQ +G+ E  FGYK L+I L +SA +L+      Y  KV++  D++  D+ E+ + + + S      + F ++++ + N K  G ++  YT+ NE   E  TY IY++++  P F+ ++ERLQ  L++F++ +S+IDV+D  W+YF++++KY + D +  YAT+G++TV+N++ YPDK R R+SQ+L+LPPFQ +GHG +LL   +   ++  N+ DIT EDPS+ F  LRDFV  K   +L  F ++ +     ++  +    KLKI+ +   R+YEIL L+  +  +  +   Y+  V KRL   + K +      +  L   E+ ++   I    ++E+LE+ Y  ++
Sbjct:    9 ICFKVRFPEDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRELIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKY-NKDGATLYATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRLDVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLV 381          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Match: prpf19 (pre-mRNA processing factor 19 [Source:Xenbase;Acc:XB-GENE-975233])

HSP 1 Score: 214.927 bits (546), Expect = 3.777e-65
Identity = 124/366 (33.88%), Postives = 217/366 (59.29%), Query Frame = 2
Query:  110 EDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTL-NENVYE--TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            ED  D+ + F P+++HQ +G+ E  FGYK L+I L +SA +L+      Y  KV++  D++  D+ E+ + + + S      + F ++++ + N K  G ++  YT+ NE   E  TY IY++++  P F+ ++ERLQ  L++F++ +S+IDV+D  W+YF++++KY + D +  YAT+G++TV+N++ YPDK R R+SQ+L+LPPFQ +GHG +LL   +   ++  N+ DIT EDPS+ F  LRDFV  K   +L  F ++ +     ++  +    KLKI+ +   R+YEIL L+  +  +  +   Y+  V KRL   + K +      +  L   E+ ++   I    ++E+LE+ Y  ++
Sbjct:   31 EDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRELIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKY-NKDGATLYATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRLDVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLV 395          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Match: prpf19 (pre-mRNA processing factor 19 [Source:Xenbase;Acc:XB-GENE-975233])

HSP 1 Score: 214.927 bits (546), Expect = 4.581e-65
Identity = 124/366 (33.88%), Postives = 217/366 (59.29%), Query Frame = 2
Query:  110 EDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTL-NENVYE--TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            ED  D+ + F P+++HQ +G+ E  FGYK L+I L +SA +L+      Y  KV++  D++  D+ E+ + + + S      + F ++++ + N K  G ++  YT+ NE   E  TY IY++++  P F+ ++ERLQ  L++F++ +S+IDV+D  W+YF++++KY + D +  YAT+G++TV+N++ YPDK R R+SQ+L+LPPFQ +GHG +LL   +   ++  N+ DIT EDPS+ F  LRDFV  K   +L  F ++ +     ++  +    KLKI+ +   R+YEIL L+  +  +  +   Y+  V KRL   + K +      +  L   E+ ++   I    ++E+LE+ Y  ++
Sbjct:   43 EDIEDESMTFNPEYSHQIFGDEEVAFGYKGLKILLYYSAGNLSNMFRVEYSSKVDDKFDLVQPDDVENKIRELIPSGFCCGSDDFISLLEKEVNFKPMGTVVHTYTVHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFIETASYIDVDDEKWDYFLVFEKY-NKDGATLYATVGYMTVYNYYVYPDKTRPRVSQMLVLPPFQGEGHGAQLLETVHRYYVSASNILDITAEDPSENFVRLRDFVLVKLCQNLPCFSLEKLLCGFSQEMVTEAQEKLKINKKHARRVYEILRLRATDMSDSEKAKAYRLDVKKRLVGPYKKNQREMAKMKQCLRPEELTNQMNQIDLNTQHEQLEESYQQLV 407          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Mouse
Match: Hat1 (histone aminotransferase 1 [Source:MGI Symbol;Acc:MGI:96013])

HSP 1 Score: 207.223 bits (526), Expect = 2.883e-62
Identity = 127/393 (32.32%), Postives = 217/393 (55.22%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIV-KNDNCKCYGKLIDQYTLNENVYE---TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-GKTKDFSVGNQAVL--EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F +++ K  N K +G L+  YT+         T+ I+++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +   ++   + DIT EDPS  +  LRDFV  K    L  F  + +     +          KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   +  K +D +   + +   E+ ++   I    ++E+LE+ +  ++
Sbjct:   12 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTLFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKETNFKPFGTLLHTYTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYISFPTVLDITAEDPSRSYLKLRDFVLVKFCQFLPSFSRERLLQGFSEDMAIQAQQMFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMKKCLRPEELTNQMNQIEISVQHEQLEERFQELV 403          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Mouse
Match: Hat1 (histone aminotransferase 1 [Source:MGI Symbol;Acc:MGI:96013])

HSP 1 Score: 201.83 bits (512), Expect = 4.228e-60
Identity = 128/400 (32.00%), Postives = 218/400 (54.50%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIV-KNDNCKCYGKLIDQYTLNENVYE---TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITV-------EDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-GKTKDFSVGNQAVL--EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F +++ K  N K +G L+  YT+         T+ I+++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +   ++   + DITV       EDPS  +  LRDFV  K    L  F  + +     +          KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   +  K +D +   + +   E+ ++   I    ++E+LE+ +  ++
Sbjct:   12 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTLFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKETNFKPFGTLLHTYTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYISFPTVLDITVLFFHFLAEDPSRSYLKLRDFVLVKFCQFLPSFSRERLLQGFSEDMAIQAQQMFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMKKCLRPEELTNQMNQIEISVQHEQLEERFQELV 410          
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Match: sp|Q5M939|HAT1_RAT (Histone acetyltransferase type B catalytic subunit OS=Rattus norvegicus OX=10116 GN=Hat1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 9.476e-63
Identity = 130/395 (32.91%), Postives = 220/395 (55.70%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIV-KNDNCKCYGKLIDQYTL-----NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F +++ K  + K +G L+  Y++      EN   T+ IY++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +   +A+ ++ DIT EDPS  +  LRDFV  K    L  F  + +     +        K KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   + K +      +  L   E+ ++   I    ++E+LE+ +  ++
Sbjct:   15 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEADFKPFGTLLHTYSVPSPTGGENF--TFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYIASSSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSRERLLQGFNEDMAIQAQQKFKINKQHARRVYEILRLLVTDMSDAEQCRSYRLDIKRRLISPYKKKQTDLAKMRKCLRPEELTNQMNQIEISVQHEQLEEQFQELV 406          
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Match: sp|Q8BY71|HAT1_MOUSE (Histone acetyltransferase type B catalytic subunit OS=Mus musculus OX=10090 GN=Hat1 PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.017e-61
Identity = 127/393 (32.32%), Postives = 217/393 (55.22%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIV-KNDNCKCYGKLIDQYTLNENVYE---TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-GKTKDFSVGNQAVL--EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F +++ K  N K +G L+  YT+         T+ I+++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +   ++   + DIT EDPS  +  LRDFV  K    L  F  + +     +          KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   +  K +D +   + +   E+ ++   I    ++E+LE+ +  ++
Sbjct:   12 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTLFRVEYSSKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKETNFKPFGTLLHTYTVPSQTGGETFTFQIHKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYISFPTVLDITAEDPSRSYLKLRDFVLVKFCQFLPSFSRERLLQGFSEDMAIQAQQMFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMKKCLRPEELTNQMNQIEISVQHEQLEERFQELV 403          
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Match: sp|O14929|HAT1_HUMAN (Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 4.025e-61
Identity = 128/395 (32.41%), Postives = 219/395 (55.44%), Query Frame = 2
Query:   32 KDSVESYLEEFTCDANSLINIKLIRTEDEIDKCI-GFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV-ENTEDILADNFEHSLIDKLS-NVERNLESFKNIVKND-NCKCYGKLIDQYTL-----NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVF-GKTKDFSVGNQAVL--EMNDEEKSILFEREYERLEQCYSIII 1180
            K +VE  L E+ C+ N+ I +KL+R  ++++  I  F P++THQ +G+ E  FGYK L+I L + A SL+      Y  KV EN + + AD+ E  +   +      N   F ++++ + + K +G L+  Y++      EN   T+ IY++++    F+ ++ERLQ  L++F++ +SFIDV+D  W YF++++KY + D +  +AT+G++TV+N++ YPDK R R+SQ+LIL PFQ QGHG +LL   +        + DIT EDPS  +  LRDFV  K    L  F  + +     +        K KI+ Q   R+YEIL L   +  +  +   Y+  + +RL   +  K +D +   + +   E+ ++   I    ++E+LE+ +  ++
Sbjct:   15 KSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENF--TFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKY-NKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELV 406          
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Match: sp|P0CO06|HAT1_CRYNJ (Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=HAT1 PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.178e-51
Identity = 115/420 (27.38%), Postives = 212/420 (50.48%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTED--------EIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTE-----------DILADNFEHSLIDKLSNVERNLESFKNIV-----------------KNDNCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLS-FNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCK-----NVLSLKEFKVDIIKNSLFKK--FRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIII 1180
            LEE+  D+N ++N++++RT +        E      F P FT+  +G++EKIFGYK L I L F++ SL  ++  SYD K+ ++              +  ++  S ++    V  + E+FK +                  + D+    GK I+    NE+V E Y +Y++   +P F+ ++ R+Q  +L F++G S++  ++ +WE+ V+Y++    D   F Y  +G+++V+ F+ YPD+VR R+SQ +ILPP+Q QGHG +L  + +   L    + ++T+EDP++ F+ LRD  D +      ++      VD+ K     +  +   +  K KI+ +Q  R+ E+L  + ++K N  +   Y+  V  RL         +    + + +M  EE+     + YE + + Y  I+
Sbjct:    5 LEEWISDSNQVLNLQMVRTPEDASLLQYEEQQNIDVFNPAFTYPIFGDNEKIFGYKGLDIKLHFASGSLRQYLDISYDAKLASSTTPPDEIEGALYKFIPPDYTKSEVEFQKRVAGDAETFKPLGEKIGSYAHPSAGRKGKGQGDSGMAAGKAIED---NEDVVE-YEMYKATWSTPGFREYHRRMQIFVLLFIEGGSYVHEDEDAWEFIVLYERRTRPDSGIFTYHFVGYVSVYPFWCYPDRVRLRLSQFVILPPYQHQGHGSKLYNMLFRHMLDRSEVAELTIEDPAEAFEDLRDRNDLRFLVKEGIVKDPMLYVDVGKGKRGSRVEWELAIRRKYKIAQRQFDRLLEMLLFRQLDKGNPDKVKAYRLHVKARL---------YRFNYEMLSQMTVEERKEALAKTYESVVEDYKRIL 411          
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Match: sp|P0CO07|HAT1_CRYNB (Histone acetyltransferase type B catalytic subunit OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=HAT1 PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.178e-51
Identity = 115/420 (27.38%), Postives = 212/420 (50.48%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTED--------EIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTE-----------DILADNFEHSLIDKLSNVERNLESFKNIV-----------------KNDNCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLS-FNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCK-----NVLSLKEFKVDIIKNSLFKK--FRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIII 1180
            LEE+  D+N ++N++++RT +        E      F P FT+  +G++EKIFGYK L I L F++ SL  ++  SYD K+ ++              +  ++  S ++    V  + E+FK +                  + D+    GK I+    NE+V E Y +Y++   +P F+ ++ R+Q  +L F++G S++  ++ +WE+ V+Y++    D   F Y  +G+++V+ F+ YPD+VR R+SQ +ILPP+Q QGHG +L  + +   L    + ++T+EDP++ F+ LRD  D +      ++      VD+ K     +  +   +  K KI+ +Q  R+ E+L  + ++K N  +   Y+  V  RL         +    + + +M  EE+     + YE + + Y  I+
Sbjct:    5 LEEWISDSNQVLNLQMVRTPEDASLLQYEEQQNIDVFNPAFTYPIFGDNEKIFGYKGLDIKLHFASGSLRQYLDISYDAKLASSTTPPDEIEGALYKFIPPDYTKSEVEFQKRVAGDAETFKPLGEKIGSYAHPSAGRKGKGQGDSGMAAGKAIED---NEDVVE-YEMYKATWSTPGFREYHRRMQIFVLLFIEGGSYVHEDEDAWEFIVLYERRTRPDSGIFTYHFVGYVSVYPFWCYPDRVRLRLSQFVILPPYQHQGHGSKLYNMLFRHMLDRSEVAELTIEDPAEAFEDLRDRNDLRFLVKEGIVKDPMLYVDVGKGKRGSRVEWELAIRRKYKIAQRQFDRLLEMLLFRQLDKGNPDKVKAYRLHVKARL---------YRFNYEMLSQMTVEERKEALAKTYESVVEDYKRIL 411          
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Match: A0A2T7PV17 (Histone acetyltransferase type B catalytic subunit OS=Pomacea canaliculata OX=400727 GN=C0Q70_04260 PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.751e-85
Identity = 150/395 (37.97%), Postives = 239/395 (60.51%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTEDEI-DKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSY--DVKVENTEDILADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTLNENVYET-YHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKT-KDF-----SVGNQAVLE----MNDEEKSILFEREYERLEQCYSIIIMKL 1189
            LEEF C ANS +++KL+R E ++ D    F P  THQ +G+ E IFGYK+L +DL ++A  L P++   Y   V ++  + + ADN    L++ + S V+ NL+ F   ++ D N + YG L+  Y ++    E  + IY++++E   F+ F+ RLQ  +LFF+D +SFIDV+D  W ++++++KY   D    YAT G++TV+N++AYP+K+R RISQ L+LPPFQ+QGHG +LL  FYN       + DITVEDPS+ FQ LRDFVDC N   L+ ++   + N   ++       KLK+S +Q  R+YEIL LK  ++ N     +Y+  + +RL   F K+ +DF     ++G + + +    M  E++ ++ E+ ++   Q Y  +I +L
Sbjct:    8 LEEFKCCANSALHLKLVRHESDLEDDTKTFKPDMTHQLFGDQESIFGYKDLEVDLFYTAGKLIPYLGMKYVDRVPLKGLDGVYADNVTAKLMEVMASGVQTNLDDFVTAIQKDVNFRPYGDLLHCYKVHIGEQEREFQIYKADIEVKGFKSFHNRLQTFILFFIDAASFIDVDDDKWRFYLLFEKYV-QDGECRYATAGYMTVYNYYAYPEKIRPRISQFLVLPPFQRQGHGAQLLQTFYNDVCPRPEVLDITVEDPSENFQRLRDFVDCCNCQKLESYQPKCLLNGFCEQMTDEAQQKLKLSKRQARRVYEILRLKITDESNPSMYRQYRLDLKRRLNIPFQKSRRDFKKLERALGPEELAQTMSCMTQEQRHLILEKNFQEHVQMYRQVIDRL 401          
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Match: A0A3S1A1W2 (Histone acetyltransferase type B catalytic subunit OS=Elysia chlorotica OX=188477 GN=EGW08_003787 PE=3 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.601e-81
Identity = 138/338 (40.83%), Postives = 209/338 (61.83%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTEDEIDKCIG-FAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTE-DILADNFEHSLIDKLS-NVERNLESFKNIVKNDNC-KCYGKLIDQYTL--NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRL 1048
            LEE+ C AN  I  K +RTED+I+   G F P+ THQ +G+SE IFGYK L I + ++A +L P+ + S+   V   + D+ ADN E  L+D L      +L+ F+  +  +   + +G+LID Y++       +T+ +Y +++E P F+ ++ R+Q  + FF+D +S+IDV+D  W+Y+++++KY ++  +  YA  G++T +NFFAYP++VR RISQVLILPPFQK G   RL+  FYN   +   + DITVEDPS+ FQ +RDFVDC N   L+ F+ D+++    +        KLK+S  Q  R+YEIL LK  N+ N      Y+  V KRL
Sbjct:   12 LEEYRCSANDAIRFKFVRTEDDIENVDGVFHPEMTHQIFGDSEMIFGYKGLDISIYYTAANLVPYFNISFKAAVNEKQFDVPADNVEKLLLDDLPPGYVTSLDQFRQALPEEATFRPFGELIDSYSVETRNGTRKTFEVYFTKIEEPGFRKYHSRMQTFIKFFIDAASYIDVDDERWDYYLVFEKYVESG-NPRYALAGYMTTYNFFAYPERVRPRISQVLILPPFQKMGLCARLVQTFYNVCYSRGEVLDITVEDPSENFQRVRDFVDCSNCGKLESFQADLLRGGFSRDMVQEAQEKLKLSKLQTRRVYEILRLKSTNENNKQMFRDYRLDVKKRL 348          
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Match: V4AGL7 (Histone acetyltransferase type B catalytic subunit OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_232538 PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.978e-81
Identity = 149/380 (39.21%), Postives = 228/380 (60.00%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTEDEI-DKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV--ENTEDILADNFEHSLIDKLS-NVERNLESF-KNIVKNDNCKCYGKLIDQYTL-NENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKT-KDFSVGNQAVLEMN-DEEKSILFEREYERLEQCY 1168
            LEEF  +AN +I+ KL+R E+++ D    F P  THQ +GE E IFGYK+L + + ++A  L  ++S SY  KV  +  + ++ D     L  ++      NL+ F   + K  N K +G+++  Y +  +     + +Y+++++ P F+ ++ RLQ  LLFF+D +S+IDV+D  W YF++++KY++   +  YA  G++T++N++AYP+K R RISQVLILPPFQ+QGHG  LL  FYNT     ++ DITVEDPS+ FQ LRDFVDCKNV  L+EF+ + I+ S           KLK+S +Q  R+YEIL LK  +  N  +   Y+  V +RL   F K  +DF    +A+     DE  +   E+  E LE+ +
Sbjct:   11 LEEFKLNANDVIHFKLVRDENDVEDYDKSFKPDMTHQVFGEQESIFGYKDLEVKMYYTAAKLNTYLSMSYIDKVTPKRFDGLVPDEVLPKLAQEIPPGYYTNLDDFLATLPKEVNFKPFGEMLHSYKVKTDGSSRNFEVYKTDIDVPGFRDYHSRLQTFLLFFIDAASYIDVDDDRWNYFLVFEKYRNNGETM-YAIAGYMTIYNYYAYPNKTRPRISQVLILPPFQRQGHGAELLQTFYNTCYDRDDIMDITVEDPSENFQRLRDFVDCKNVCKLREFQPNNIRVSFNDAMLQAARQKLKLSRRQARRVYEILRLKATDGSNTQQYRDYRLEVKRRLNSPFTKNRRDFQKLKKALNPQELDETMNTTEEKRLEYLEKSF 389          
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Match: W4XPC8 (Histone acetyltransferase type B catalytic subunit OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 9.272e-79
Identity = 146/395 (36.96%), Postives = 226/395 (57.22%), Query Frame = 2
Query:   29 NKDSVESYLEEFTCDANSLINIKLIRTEDEI-DKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKV--ENTEDILADNFEHSLIDKLSNVER-NLESFKNIVKND-NCKCYGKLIDQYTLNENVYET---YHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVL---EMNDEEKSILFEREYERLEQCYSIII 1180
            N DS+ S LEEF   AN +I +KL+R++++I D    FAP+FTHQ +GE+E +FGY+ L++ L FSA  LTP+++ +++ KV  +  + + AD     +++KL      NL+ F   +  D   +  G L+  Y+  +  +     + IY+  + +P F+ F+  LQ  L +FVD SS+ID +D  W Y+ I+++Y   D +  Y+T+G+ TV+ ++AYPDK+R RISQVLILPPFQ+QGHG + L   Y     +  + DITVEDPSD F  LRDF+DC+    L  F  + +   L          KLK++ +Q+ +IYEIL LK  +  N      Y+  V KRL   F K K      + VL   E+   E+    E  ++ LE+ + +++
Sbjct:    8 NMDSMRSALEEFISRANDVIEMKLVRSKEDIEDSTRSFAPEFTHQIFGENETVFGYRGLKVQLYFSAARLTPYLTYTFEEKVNPKKFDGVQADPILKPIVEKLEITPMDNLDRFVASLDEDVGFQPMGDLLHSYSNTDEAHGATRHFEIYKCNVMTPGFKEFHSHLQTFLWWFVDASSYIDFDDERWMYYTIFERYPH-DGTKRYSTVGYSTVYRYYAYPDKIRPRISQVLILPPFQRQGHGAQFLETMYADFRKDTEVLDITVEDPSDDFVRLRDFIDCRACAQLPSFAPENLPKGLCDAMEKEALEKLKLNKKQVRKIYEILRLKSTDYSNTEHAKAYRLDVKKRLNIPFQKQKADYEKLKKVLKPEELTAAEEGTSLEERHQTLEKWFQLLL 401          
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Match: A0A0B6YTN1 (Hat1_N domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF34409 PE=4 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 4.490e-78
Identity = 144/346 (41.62%), Postives = 210/346 (60.69%), Query Frame = 2
Query:   53 LEEFTCDANSLINIKLIRTEDEID-KCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENT--EDILADNFEHSLIDKL-SNVERNLESFKNIVKND-NCKCYGKLIDQYTLNENVYE-TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            LEEF C A  +I  KL+R+E++ID +   F P+  HQ +G+SE IFGYK L++ + +SA  L P+  +SYD  V N     +L D+ E  + ++L +    NL+SF+  +  D   K YG+LID YT++    E  + +Y  ++E P F+ ++ RLQ  + FF+D +S+IDV+D  W+YF++++KYK    S  YA  G++TV+NF+AYP ++R RISQVL+LPPFQK G G +L+   YN   +   + DITVEDPS+ FQ +RD+VD KN   LK F+ D +             +KLK+S  Q  RIYEIL LK  N+ N      Y+  V KRL   F + +
Sbjct:   15 LEEFKCPATEVIRFKLVRSEEDIDDEEKTFQPEMAHQIFGDSETIFGYKGLKVCIYYSAARLLPYFITSYD-DVCNMVHHGVLPDDIEKKISEELPAGYITNLDSFRASLPEDWRFKPYGQLIDSYTISAKTGERQFEVYSVKIEEPGFRNYHSRLQSFIKFFIDAASYIDVDDEQWDYFLLFEKYKVVGES-RYAVAGYMTVYNFYAYPSRIRPRISQVLVLPPFQKLGLGAKLIQTLYNLCYSRPEVLDITVEDPSENFQRVRDYVDAKNCQKLKSFQPDELLKGFSHDMLHEAQNKLKLSKVQARRIYEILRLKATNESNKDMFRAYRLDVKKRLNIPFLRNR 358          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Cavefish
Match: hat1 (histone acetyltransferase 1 [Source:NCBI gene;Acc:103031739])

HSP 1 Score: 221.861 bits (564), Expect = 4.252e-68
Identity = 121/353 (34.28%), Postives = 209/353 (59.21%), Query Frame = 2
Query:   35 DSVESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKLS-NVERNLESFKNIV-KNDNCKCYGKLIDQYTLN---ENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            + +E  L E+ CD N  I +KL+R  ED  D+   F P+++HQ +G+ E  FGYK L+I L ++A +L+      Y  +V  T D +  D+ E  + + +      N + F +++ K  N K +G L+  Y ++   E V  TY I++ ++ S  F+ ++ERLQ  L++F++ +SFID++D  W++F++++KY + D    YAT+G++TV+N++ YPDK R R+SQ+LILPPFQ +GHG +LL   +     +  ++D+T EDPS+ +  LRDFV  K  ++L  F  + + +   ++  +    KLKI+ +   R+YEIL L+  +  +  +  +++  V KRL   + K +
Sbjct:    5 NEMEKKLAEYKCDTNEAICLKLVRFPEDVEDEGTTFHPEYSHQLFGDDEVAFGYKGLQIQLYYTAGNLSTLFKVKYSARVTETFDCVEPDDVEGKIREIIPPGFSCNTDDFISLLEKEGNFKPFGSLLHTYKVHNVEEGVDLTYQIHKVDILSAGFREYHERLQTFLMWFIETASFIDIDDDRWDFFLVFEKY-NKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLLETVHRYYCNSPKVQDVTAEDPSENYVKLRDFVLVKLCMALPSFSTEKLAHGFSEEMATEAREKLKINKKHARRVYEILRLRNTDMSDEEKAREFRLEVKKRLFGPYRKNQ 356          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Sea Lamprey
Match: hat1 (histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-99])

HSP 1 Score: 163.696 bits (413), Expect = 3.430e-48
Identity = 83/204 (40.69%), Postives = 126/204 (61.76%), Query Frame = 2
Query:  455 ESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGK 1066
            ++++ +  F+ F+ RLQ  L++F++ +SFIDV+D  W YF++Y+KY   D S  YA  G++TV++++AYPDK R RISQ+L+LPP+Q + HG RLL   +   +A  N+ DIT EDPS+ F  LRDFVD K  ++L  F  D +     +   +    +LK++ +Q  R+YEIL LK  +  N  +   Y   V +RL   F K
Sbjct:    1 QADMTNSGFKEFHSRLQTFLIWFIETASFIDVDDERWNYFLLYEKYMQ-DGSPRYAVAGYMTVYSYYAYPDKTRPRISQMLVLPPYQGESHGARLLEAVHRFYIAEPNVLDITAEDPSENFSRLRDFVDTKLCMALPAFSPDKLLLGFTRTMATEAQLRLKVNKRQARRVYEILRLKATDGSNQKQFELYCQDVKQRLNLPFKK 203          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Yeast
Match: HAT1 (Catalytic subunit of the Hat1p-Hat2p histone acetyltransferase complex; uses the cofactor acetyl coenzyme A to acetylate free nuclear and cytoplasmic histone H4; involved in telomeric silencing and DNA double-strand break repair [Source:SGD;Acc:S000005922])

HSP 1 Score: 130.954 bits (328), Expect = 6.662e-35
Identity = 95/338 (28.11%), Postives = 164/338 (48.52%), Query Frame = 2
Query:   56 EEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDKLSNVERNLESF---KNIVKNDNCK---CYGK------------LIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWE-YFVIYQKYKDADLSFNYATIGFLTVFNFFAY----------PDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGL 982
            E +T  AN  + + ++      +  + F+P FT+  YG+SEKI+GYK+L I L F + +  P+++  Y  K+ +              D + +VE+ L SF    +++  D  K   C+ +             + +Y+LN    E + +Y+S L     +  + R+Q   L F++ +++ID  DPSW+ Y+++ +K K+         IGF+T + ++ Y            K R +ISQ LI PP+Q +GHG  L      + L + ++ +ITVEDP++ F  LRD  D + +  L    V    + L  +F       LK+  +Q  R+ E+L L
Sbjct:    9 ETWTSSANEALRVSIVG-----ENAVQFSPLFTYPIYGDSEKIYGYKDLIIHLAFDSVTFKPYVNVKYSAKLGD--------------DNIVDVEKKLLSFLPKDDVIVRDEAKWVDCFAEERKTHNLSDVFEKVSEYSLNG---EEFVVYKSSLVDDFARRMHRRVQIFSLLFIEAANYIDETDPSWQIYWLLNKKTKE--------LIGFVTTYKYWHYLGAKSFDEDIDKKFRAKISQFLIFPPYQNKGHGSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDIQRLRKLGYDAVFQKHSDLSDEFLESSRKSLKLEERQFNRLVEMLLL 316          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Nematostella
Match: EDO36047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR8])

HSP 1 Score: 82.4185 bits (202), Expect = 1.164e-18
Identity = 51/177 (28.81%), Postives = 94/177 (53.11%), Query Frame = 2
Query:   41 VESYLEEFTCDANSLINIKLIRTEDEI-DKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDK----LSNVERNLESF-KNIVKNDNCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVN 553
            +++ L  + C+AN  +  KL+ +E ++ DK   F P F+HQF+G+SE IFGY  L + L + A +L  ++  +Y+    N    +AD  E + I      ++    N + F   + +  +    G+LI  Y   + + + Y IY  +  +P F+ ++ RLQ  +L+F+D +S+I + 
Sbjct:    2 IDNLLARYKCNANETVCFKLVTSEKDVFDKGRQFHPAFSHQFFGDSETIFGYCGLEVQLYYHAGTLLTYLGLTYE---SNINGKVADGIEVNCIPSYFIIITGFLTNKDEFIAKLPEQSSFVPMGELIHSY---QRMGKDYKIYSCDTMTPRFKDYHTRLQTFILWFIDAASYIGIT 172          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Medaka
Match: hat1 (histone acetyltransferase 1 [Source:NCBI gene;Acc:101160773])

HSP 1 Score: 224.557 bits (571), Expect = 3.991e-69
Identity = 127/352 (36.08%), Postives = 205/352 (58.24%), Query Frame = 2
Query:   35 DSVESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIV-KNDNCKCYGKLIDQYTL-NENVYE-TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            +++E  L E+ CD N  I++K++R  ED  D    F P+F+HQ +G+ E  FGYK L+I L ++A +L+      Y  KV    D +  D+ E  + + + +    N + F +++ K  N K +G L+  YT+ NE   E TY I++ E+  P F+ ++ERLQ  L++F++ +SFID +D  W++F++++KY + D    YAT+G++TV+N++ YPDK R R+SQ+LILPPFQ +GHG +LL   +    +   ++DIT EDPS+ +  LRDFV  K   +L  F  D +              KLKI+ +   R+YEIL L+  +  +  +  +Y+  V KRL   + K +
Sbjct:    5 NAMEKKLAEYKCDTNEAISLKVVRFPEDVDDDSTTFHPEFSHQVFGDDEIAFGYKGLQIQLFYTAGNLSTLFKVKYSSKVTEAFDCVEPDDVEGKIREIIPAGFTSNTDDFTSLLEKEANFKPFGTLLHSYTVHNEEAGEFTYQIHKVEISCPGFREYHERLQTFLMWFIETASFIDADDDRWDFFLVFEKY-NKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLLEAVHRFYCSLPKVQDITAEDPSENYVKLRDFVLVKLCQNLPSFAEDKLLLGFSADMVQEAQDKLKINKKHARRVYEILRLRATDMSDEKQAREYRLEVKKRLFGPYRKNQ 355          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Medaka
Match: hat1 (histone acetyltransferase 1 [Source:NCBI gene;Acc:101160773])

HSP 1 Score: 190.66 bits (483), Expect = 2.071e-56
Identity = 119/350 (34.00%), Postives = 195/350 (55.71%), Query Frame = 2
Query:   41 VESYLEEFTCDANSLINIKLIR-TEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDIL-ADNFEHSLIDKL-SNVERNLESFKNIV-KNDNCKCYGKLIDQYTL-NENVYE-TYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTK 1072
            +E  L E+ CD N  I++K++R  ED  D    F P+F+HQ +G+ E  FGYK L+I L ++A +L+      Y  KV    D +  D+ E  + + + +    N + F +++ K  N K +G L+  YT+ NE   E TY I++ E+  P F+ ++ERLQ  L++F++ +SFID +D  W++F++++KY + D    YAT+G++TV+N++ YPDK R R+SQ+LILPPFQ +GHG +LL   +    +   ++DIT E     F  L  F+D  N +            S +  F+   H++         R+YEIL L+  +  +  +  +Y+  V KRL   + K +
Sbjct:    1 MEKKLAEYKCDTNEAISLKVVRFPEDVDDDSTTFHPEFSHQVFGDDEIAFGYKGLQIQLFYTAGNLSTLFKVKYSSKVTEAFDCVEPDDVEGKIREIIPAGFTSNTDDFTSLLEKEANFKPFGTLLHSYTVHNEEAGEFTYQIHKVEISCPGFREYHERLQTFLMWFIETASFIDADDDRWDFFLVFEKY-NKDGETLYATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEGHGAQLLEAVHRFYCSLPKVQDITGE---HLFIPLMVFLDICNAVCFHR------GCSCWTTFK---HAR---------RVYEILRLRATDMSDEKQAREYRLEVKKRLFGPYRKNQ 328          
BLAST of Histone acetyltransferase type B catalytic subunit vs. Planmine SMEST
Match: SMESG000021731.1 (SMESG000021731.1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 389/392 (99.23%), Postives = 389/392 (99.23%), Query Frame = 2
Query:   20 MNINKDSVESYLEEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDKLSNVERNLESFKNIVKNDNCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIIIMKLDK 1195
            MNINKDSVESYLEEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDKLSNVERNLESFKNIVKND CKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSF YATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVD IKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIIIMKLDK
Sbjct:    1 MNINKDSVESYLEEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYGESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLIDKLSNVERNLESFKNIVKNDTCKCYGKLIDQYTLNENVYETYHIYESELESPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFKYATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALANLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDTIKNSLFKKFRSLVHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKTKDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIIIMKLDK 392          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HAT11.487e-6132.41histone acetyltransferase 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hat-12.338e-5730.58Histone AcetylTransferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hat12.097e-6534.99gene:FBgn0037376 transcript:FBtr0078670[more]
Hat12.097e-6534.99gene:FBgn0037376 transcript:FBtr0078669[more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hat11.169e-6635.80histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-G... [more]
hat11.732e-6635.59histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpf194.774e-7234.27pre-mRNA processing factor 19 [Source:Xenbase;Acc:... [more]
prpf196.275e-6633.25pre-mRNA processing factor 19 [Source:Xenbase;Acc:... [more]
prpf192.066e-6533.69pre-mRNA processing factor 19 [Source:Xenbase;Acc:... [more]
prpf193.777e-6533.88pre-mRNA processing factor 19 [Source:Xenbase;Acc:... [more]
prpf194.581e-6533.88pre-mRNA processing factor 19 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hat12.883e-6232.32histone aminotransferase 1 [Source:MGI Symbol;Acc:... [more]
Hat14.228e-6032.00histone aminotransferase 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5M939|HAT1_RAT9.476e-6332.91Histone acetyltransferase type B catalytic subunit... [more]
sp|Q8BY71|HAT1_MOUSE2.017e-6132.32Histone acetyltransferase type B catalytic subunit... [more]
sp|O14929|HAT1_HUMAN4.025e-6132.41Histone acetyltransferase type B catalytic subunit... [more]
sp|P0CO06|HAT1_CRYNJ3.178e-5127.38Histone acetyltransferase type B catalytic subunit... [more]
sp|P0CO07|HAT1_CRYNB3.178e-5127.38Histone acetyltransferase type B catalytic subunit... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PV171.751e-8537.97Histone acetyltransferase type B catalytic subunit... [more]
A0A3S1A1W21.601e-8140.83Histone acetyltransferase type B catalytic subunit... [more]
V4AGL71.978e-8139.21Histone acetyltransferase type B catalytic subunit... [more]
W4XPC89.272e-7936.96Histone acetyltransferase type B catalytic subunit... [more]
A0A0B6YTN14.490e-7841.62Hat1_N domain-containing protein (Fragment) OS=Ari... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hat14.252e-6834.28histone acetyltransferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hat13.430e-4840.69histone acetyltransferase 1 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HAT16.662e-3528.11Catalytic subunit of the Hat1p-Hat2p histone acety... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360471.164e-1828.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hat13.991e-6936.08histone acetyltransferase 1 [Source:NCBI gene;Acc:... [more]
hat12.071e-5634.00histone acetyltransferase 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone acetyltransferase type B catalytic subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021731.10.000e+099.23SMESG000021731.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013519 ID=SMED30013519|Name=Histone acetyltransferase type B catalytic subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1212bp
ATAAATTTAAAGTTTTGAAATGAATATTAATAAAGATTCTGTGGAATCCT
ATTTAGAAGAATTTACATGTGATGCTAATAGTCTTATAAATATTAAATTA
ATTAGAACCGAAGATGAAATTGATAAATGCATTGGTTTTGCCCCACAATT
TACACATCAGTTTTATGGCGAAAGTGAAAAAATATTTGGTTATAAAAATT
TGAGAATAGATCTTTGTTTTTCCGCTCATAGTTTAACTCCTTTTATCAGC
AGTTCTTATGATGTAAAGGTTGAAAACACTGAAGATATTTTAGCAGACAA
CTTTGAACATTCGTTAATTGATAAACTATCAAACGTTGAAAGGAATTTAG
AATCCTTTAAAAATATTGTTAAGAATGATAATTGTAAATGCTATGGCAAA
CTTATTGACCAGTACACATTAAATGAAAATGTTTATGAAACATATCACAT
TTACGAATCTGAATTAGAGTCACCAGCTTTCCAGTTGTTTAATGAAAGAC
TTCAGTATTTGCTCTTGTTCTTTGTTGATGGTTCTTCGTTCATTGATGTC
AATGATCCTTCTTGGGAATATTTTGTTATATACCAGAAATATAAAGATGC
AGATTTAAGCTTTAATTATGCAACAATAGGCTTTTTAACTGTTTTTAATT
TCTTCGCATACCCAGACAAAGTAAGAAAACGAATTAGTCAAGTATTAATT
CTTCCACCATTTCAAAAACAAGGCCACGGTGAACGGTTATTGACTATATT
CTACAACACAGCTCTTGCCAATTTAAACCTGAAAGACATTACTGTTGAGG
ATCCTTCCGATCAATTTCAGATTCTTAGAGATTTCGTTGATTGTAAAAAT
GTTCTCAGCTTAAAAGAATTTAAAGTCGACATAATAAAAAACAGTTTATT
CAAAAAATTTCGCAGCTTAGTGCATTCGAAATTAAAAATCAGCAATCAGC
AGATTATTAGAATTTATGAAATCCTCGGATTGAAATTTGTCAATAAATTG
AATGTTGTTGAAGGCATGAAATACAAATATTCAGTAATCAAACGGCTGAC
TGACGTATTTGGGAAAACCAAAGATTTTAGTGTTGGAAATCAGGCGGTTC
TAGAAATGAATGATGAAGAAAAATCGATTTTATTCGAAAGAGAATATGAG
AGATTAGAACAATGCTATTCGATCATTATTATGAAATTAGATAAATAAAT
GTTGAATTGATA
back to top

protein sequence of SMED30013519-orf-1

>SMED30013519-orf-1 ID=SMED30013519-orf-1|Name=SMED30013519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=393bp
MNINKDSVESYLEEFTCDANSLINIKLIRTEDEIDKCIGFAPQFTHQFYG
ESEKIFGYKNLRIDLCFSAHSLTPFISSSYDVKVENTEDILADNFEHSLI
DKLSNVERNLESFKNIVKNDNCKCYGKLIDQYTLNENVYETYHIYESELE
SPAFQLFNERLQYLLLFFVDGSSFIDVNDPSWEYFVIYQKYKDADLSFNY
ATIGFLTVFNFFAYPDKVRKRISQVLILPPFQKQGHGERLLTIFYNTALA
NLNLKDITVEDPSDQFQILRDFVDCKNVLSLKEFKVDIIKNSLFKKFRSL
VHSKLKISNQQIIRIYEILGLKFVNKLNVVEGMKYKYSVIKRLTDVFGKT
KDFSVGNQAVLEMNDEEKSILFEREYERLEQCYSIIIMKLDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:0042393histone binding
GO:0004402histone acetyltransferase activity
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR037113Hat1_N_sf
IPR013523Hist_AcTrfase_HAT1_C
IPR017380Hist_AcTrfase_B-typ_cat-su
IPR019467Hat1_N
IPR016181Acyl_CoA_acyltransferase
Vocabulary: biological process
TermDefinition
GO:0016568chromatin modification
GO:0006325chromatin organization
GO:0006348chromatin silencing at telomere
GO:0016573histone acetylation
Vocabulary: cellular component
TermDefinition
GO:0000781chromosome, telomeric region
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019467Histone acetyl transferase HAT1 N-terminalPFAMPF10394Hat1_Ncoord: 15..170
e-value: 2.0E-36
score: 125.7
IPR037113Histone acetyl transferase 1, N-terminal domain superfamilyGENE3DG3DSA:3.90.360.10coord: 21..170
e-value: 3.7E-79
score: 268.0
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 123..271
e-value: 3.7E-79
score: 268.0
IPR013523Histone acetyltransferase HAT1, C-terminalGENE3DG3DSA:1.10.10.390coord: 272..325
e-value: 2.6E-8
score: 35.6
IPR017380Histone acetyltransferase type B, catalytic subunitPANTHERPTHR12046HISTONE ACETYLTRANSFERASE TYPE B CATALYTIC SUBUNITcoord: 4..390
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 13..321